KCC000019A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000019A_C01 KCC000019A_c01
ccgccCGAACCATATCTTTCAGGGCAGTGCGGATGAAGCTGTGAATAAGAGCAGCGCAGT
ATCAGGCTCCGAAGCGGGCATTAGTCCCTGAATCATGGCCGAGGTCGACTCTCCGCCCGG
GAGCCGCCTGTTCATCGTCTGTGGCAAGAATGTCGAGGCTGAGACGCTGCAGGTTGCTTT
CCGCCCTTTCGGCAATGTCCAGAACGTGAAGGTCATCCGCGAGAAGGGAGTTGCGTATGT
GAAGTATGACAAGGCTTCCTCTGCTGCCCTGGCGATGGAGAACCTTAACGGGGCTGTGCT
GAACAACGGCCGGGGCCCGAAGCTCAAGGTGCTGCTGGCGGAGGCCCCGAACACCTCGCG
GGGCATGCACCCTCCGAGGCCCGCCGAGCAGGAGATTAGCTCGGACCCGGACAACATTCC
GCCGCGTTCGCGTCTGTTCATCGTTGTGCCCAAGCAGGCCGAGCCGCAGCAGATCAACGA
CGCTATCGCCATCTATGATGGCCTGGAGTACTGCAAGACGGACCTGGTCGCGGCCAAGGG
TGTCGTCTTCTGCAAGTTCACCAAGGCGTCGTTCGCGCTGCGCGCACTGGAGGATGTAAC
CGGGCGTGGCACGGTTGGCCCCTACAAGGTCAAGTGCATGCTGGCGGAGCCGAAGACCAA
GCGCGGCCGCGGCGACGGCTCGCCCCAGGATATGTTTTCGCCGCTGACCCAGGCGACAAA
GCTGGACTACGGCATCAACCACCACCTGCCCCCGGACGCCTCGCACATGGGGCCTCTGGA
TCTGCCGATGGGCCACGGCCTGTCTCCCTCCCAGATCGGCGTGCCGGACTACGGCGCTAT
CAGCGGCCTAGGCGGTCTGGGTGGCCTGGGCAGCTTTCACAACCTGGGCGATGCCAACCT
GGCCAACATGCAGTCGCACTTGTCGGCGCAGGTGGGCGCGCTCGGCTTCAACATGAGCCT
GGGCAGACTGCACAACAGCTCCACGGTGACGCCACACGACTCGCCCACGCTGAGCAAGCA
GCGCTTGTTCGTGGTGGTGCATAAGACCGTGAACCAGGACGTGCTGGCGCGCCTGTTCCG
GAAGTTCAACGGCATGGAGTACTGCGACCTGAAGAAGGACCCCGCGACCGGCCGCTCCAA
GGGCTTCTGCTTCGTCAACTACTCCACTCCGGAGGCCGCGGCCGCCGCGATCGCGCAGCT
AAACGGCATTGAGTTGCCGCCGCACTCGAACCAGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000019A_C01 KCC000019A_c01
         (1236 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_315504.1| ENSANGP00000021161 [Anopheles gambiae] gi|21299...   108  1e-22
ref|NP_647887.1| CG1316-PA [Drosophila melanogaster] gi|23092993...   107  6e-22
dbj|BAC16207.1| developmentally regulated RNA-binding protein 1 ...    97  8e-19
ref|NP_694453.1| developmentally regulated RNA-binding protein 1...    97  8e-19
ref|NP_695218.1| developmentally regulated RNA-binding protein 1...    96  1e-18

>ref|XP_315504.1| ENSANGP00000021161 [Anopheles gambiae] gi|21299140|gb|EAA11285.1|
            ENSANGP00000021161 [Anopheles gambiae str. PEST]
          Length = 499

 Score =  108 bits (271), Expect = 1e-22
 Identities = 106/392 (27%), Positives = 162/392 (41%), Gaps = 17/392 (4%)
 Frame = +2

Query: 98   AEVDSPPGSRLFIVCGKNVEAETLQVAFRPFGNVQNVKVIRE------KGVAYVKYDKAS 259
            +  D+PP SRLFI+C K+V  E L+  F  FG+++ + ++++      KGVAY+KY K S
Sbjct: 19   SSADTPPMSRLFIICSKSVTEENLREHFDKFGDIEEIWIVKDRATGEGKGVAYIKYAKTS 78

Query: 260  SAALAMENLNGAVLNNGRGPKLKVLLAEAPNTSRGMHPPRPAEQEISSDPDNIPPRSRLF 439
             AA A+E +NG  + +   P +KVL+  A N  +G       E+E            RLF
Sbjct: 79   DAARALEEMNGKCVGDNTRP-IKVLV--AANRQQGSRKQTENEEE---------KYLRLF 126

Query: 440  IVVPKQAEPQQINDAIAIYDGLEYCKTDLVA---------AKGVVFCKFTKASFALRALE 592
            +++PK    + + +        +Y   DLV           KG  + KF +   A +A E
Sbjct: 127  VIIPKDMTEEALREEFG-----KYGTVDLVTIIRDKVTKEGKGFAYVKFGRFLHAAQAFE 181

Query: 593  DVTGRGTVGPYKVKCMLAEPKTKRGRGDGSPQD-MFSPLTQATKLDYGINHHLPPDASHM 769
                       K K + AEPK  R   +G   D    P         G    +    + M
Sbjct: 182  GCDP-------KYKAVFAEPKPPRNAANGFADDRRVGPGGGGVGSVSGAGAMM--GFAAM 232

Query: 770  GPLDLPMGHGLSPSQI-GVPDYGAISGLGGLGGLGSFHNLGDANLANMQSHLSAQVGALG 946
            G  D   G G +  +  G  D+GA SG GG GG                           
Sbjct: 233  GGNDRRSGAGGAVDRRGGGNDFGAFSGYGGAGG--------------------------- 265

Query: 947  FNMSLGRLHNSSTVTPHDSPTLSKQRLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPA 1126
                      +S + P+ + T+    L V+    +NQD L RLF    G++YC +  D  
Sbjct: 266  ----------NSAMVPNGNETM----LTVLCSPVLNQDQLWRLFDIIPGLDYCQINND-- 309

Query: 1127 TGRSKGFCFVNYSTPEAAAAAIAQLNGIELPP 1222
                     V Y+  ++A  A  +++G+E PP
Sbjct: 310  FNNRNVTATVVYNNSQSAMYARDKIHGLEYPP 341

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 27/82 (32%), Positives = 42/82 (50%)
 Frame = +2

Query: 962  GRLHNSSTVTPHDSPTLSKQRLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSK 1141
            G   N+ T     + T    RLF++  K+V ++ L   F KF  +E   + KD ATG  K
Sbjct: 8    GTSRNNFTEEKSSADTPPMSRLFIICSKSVTEENLREHFDKFGDIEEIWIVKDRATGEGK 67

Query: 1142 GFCFVNYSTPEAAAAAIAQLNG 1207
            G  ++ Y+    AA A+ ++NG
Sbjct: 68   GVAYIKYAKTSDAARALEEMNG 89

 Score = 47.4 bits (111), Expect = 5e-04
 Identities = 32/90 (35%), Positives = 47/90 (51%), Gaps = 1/90 (1%)
 Frame = +2

Query: 95  MAEVDSPPGSRLFIVC-GKNVEAETLQVAFRPFGNVQNVKVIREKGVAYVKYDKASSAAL 271
           +A  ++    R FIVC  K +    L+  F  FG++ +V ++  K   Y KY    SA  
Sbjct: 409 LANANAEVAQRCFIVCIPKALPTSVLKQTFCRFGDLIDVYLLPNKNCGYAKYASEESAKK 468

Query: 272 AMENLNGAVLNNGRGPKLKVLLAEAPNTSR 361
           A++ L+GA + N R   LKVL AE P+  R
Sbjct: 469 AIKQLHGADILNVR---LKVLEAEEPSNDR 495

>ref|NP_647887.1| CG1316-PA [Drosophila melanogaster] gi|23092993|gb|AAF47879.2|
            CG1316-PA [Drosophila melanogaster]
            gi|25012783|gb|AAN71483.1| RE70333p [Drosophila
            melanogaster]
          Length = 470

 Score =  107 bits (266), Expect = 6e-22
 Identities = 110/381 (28%), Positives = 161/381 (41%), Gaps = 10/381 (2%)
 Frame = +2

Query: 107  DSPPGSRLFIVCGKNVEAETLQVAFRPFGNVQNVKVIRE------KGVAYVKYDKASSAA 268
            D PP SRLFI+C K    E  + AF P+G ++++ V+++      KG+AYVK+ K S AA
Sbjct: 23   DDPPMSRLFIICNKAHTEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAA 82

Query: 269  LAMENLNGAVLNNGRGPKLKVLLAEAPNTSRGMHPPRPAEQEISSDPDNIPPRSRLFIVV 448
             A E +NG  +       LKVL+  A N ++G +     +++            RLFIV+
Sbjct: 83   KAQEEMNGKTIGK-MDRTLKVLV--AANRNQGSNKSENEQEKY----------VRLFIVI 129

Query: 449  PKQAEPQQINDAIAIYDGLEYC----KTDLVAAKGVVFCKFTKASFALRALEDVTGRGTV 616
            PK A  + I +  + +  +E      + +    KG  + +FTK  +A  A E+ +     
Sbjct: 130  PKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSA---- 185

Query: 617  GPYKVKCMLAEPKTKRGRGDGSPQDMFSPLTQATKLDYGINHHLPPDASHMGPLDLPMGH 796
               K K + AEPK       GS        T+  +  YG         S   PL    G 
Sbjct: 186  ---KYKAVFAEPK-------GS--------TRTQRDQYG-------RPSEDNPLYSSSGR 220

Query: 797  GLSPSQIGVPDYGAISGLGGLGGLGSFHNLGDANLANMQSHLSAQVGALGFNMSLGRLHN 976
            G S    G    G+ SG GG     +  N+   N  +M + L  Q               
Sbjct: 221  GNSNFNGG----GSSSGGGGSNSYNNDWNVSQNN--DMAAFLRMQ--------------- 259

Query: 977  SSTVTPHDSPTLSKQRLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSKGFCFV 1156
                   + P      L V V   VNQD L RLF    G++YC + ++   G       V
Sbjct: 260  -------NVPVAQPSCLEVNVSNCVNQDQLWRLFDIIPGLDYCQIMRE--HGPRTNEALV 310

Query: 1157 NYSTPEAAAAAIAQLNGIELP 1219
             Y  PEAA  A  +L+G+E P
Sbjct: 311  VYDNPEAAIYAKDKLHGLEYP 331

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 32/90 (35%), Positives = 46/90 (50%)
 Frame = +2

Query: 95  MAEVDSPPGSRLFIVCGKNVEAETLQVAFRPFGNVQNVKVIREKGVAYVKYDKASSAALA 274
           +A  D     RLFIV   N+    L+  F  +  + +V ++  K   YVKY +  SA LA
Sbjct: 373 LASPDDQVAQRLFIVLSANLPHSILKNIFSCWSGLIDVYLLPNKNCGYVKYAEVESAQLA 432

Query: 275 MENLNGAVLNNGRGPKLKVLLAEAPNTSRG 364
           +  LNGA +    G K+KV+ AE  + S G
Sbjct: 433 IRTLNGAEI---CGTKIKVMEAEERSGSDG 459

 Score = 41.6 bits (96), Expect = 0.029
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 4/81 (4%)
 Frame = +2

Query: 389 QEISSDPDNIPPRSRLFIVVPKQAEPQQINDAIAIYDGLE----YCKTDLVAAKGVVFCK 556
           QE S+D D  PP SRLFI+  K    +   +A + Y  +E             KG+ + K
Sbjct: 17  QEYSNDDD--PPMSRLFIICNKAHTEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVK 74

Query: 557 FTKASFALRALEDVTGRGTVG 619
           F+K S A +A E++ G+ T+G
Sbjct: 75  FSKTSDAAKAQEEMNGK-TIG 94

>dbj|BAC16207.1| developmentally regulated RNA-binding protein 1 [Homo sapiens]
          Length = 476

 Score = 96.7 bits (239), Expect = 8e-19
 Identities = 68/227 (29%), Positives = 115/227 (49%), Gaps = 10/227 (4%)
 Frame = +2

Query: 62  SGSEAGISP*IMAEVDSPPGSRLFIVCGKNVEAETLQVAFRPFGNVQNVKVIRE------ 223
           S S  G  P + + +D PP SR+F+V  K      L+  F PFG++Q++ V+R+      
Sbjct: 7   SASGGGFRPGVDS-LDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKES 65

Query: 224 KGVAYVKYDKASSAALAMENLNGAVLNNGRGPKLKVLLAEAPNTSRGMHPPRPAEQEISS 403
           KG+A+VK+ ++S A  AME ++G  L       +KV +A+  + S G H  R  E E   
Sbjct: 66  KGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQ--SRSSGSH--RDVEDE--- 118

Query: 404 DPDNIPPRSRLFIVVPKQAEPQQINDAIAIYDGLEYC---KTDLVA-AKGVVFCKFTKAS 571
                   +R+F+++PK    + + +   +Y  +EYC   K  +   +KG+ + ++ K S
Sbjct: 119 ------ELTRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPS 172

Query: 572 FALRALEDVTGRGTVGPYKVKCMLAEPKTKRGRGDGSPQDMFSPLTQ 712
            A +A+E+            + +LAEPK K    + S QD +S + Q
Sbjct: 173 QAAQAIENC-------DRSFRAILAEPKNK--ASESSEQDYYSNMRQ 210

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 32/85 (37%), Positives = 48/85 (55%), Gaps = 1/85 (1%)
 Frame = +2

Query: 98  AEVDSPPGSRLFIVCGKN-VEAETLQVAFRPFGNVQNVKVIREKGVAYVKYDKASSAALA 274
           A  ++P   RLFIV   + +  + L+  F  FGN+  V ++  K V Y KY    SA  A
Sbjct: 384 APAETPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIEVYLVSGKNVGYAKYADRISANDA 443

Query: 275 MENLNGAVLNNGRGPKLKVLLAEAP 349
           +  L+G +LN   G +LKV+LA++P
Sbjct: 444 IATLHGKILN---GVRLKVMLADSP 465

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 22/57 (38%), Positives = 34/57 (59%)
 Frame = +2

Query: 1022 RLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSKGFCFVNYSTPEAAAAAI 1192
            R+FV++ K+  ++ L   F+ +  +EYC + K+  TG SKG  +V Y  P  AA AI
Sbjct: 122  RIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAI 178

 Score = 38.1 bits (87), Expect = 0.32
 Identities = 20/71 (28%), Positives = 36/71 (50%)
 Frame = +2

Query: 1022 RLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSKGFCFVNYSTPEAAAAAIAQL 1201
            R+F+V+ K   + VL   F  F  ++   + +D  T  SKG  FV ++    A  A+ ++
Sbjct: 27   RIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEM 86

Query: 1202 NGIELPPHSNQ 1234
            +G  L P+  +
Sbjct: 87   HGQCLGPNDTK 97

 Score = 36.6 bits (83), Expect = 0.93
 Identities = 21/68 (30%), Positives = 35/68 (50%)
 Frame = +2

Query: 1019 QRLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSKGFCFVNYSTPEAAAAAIAQ 1198
            +RL VV      ++ L  +F    G+EYC++++DP +    G   V Y    +A  A  +
Sbjct: 248  KRLSVVSRVPFTEEQLFSIFDIVPGLEYCEVQRDPYSNYGHG--VVQYFNVASAIYAKYK 305

Query: 1199 LNGIELPP 1222
            L+G + PP
Sbjct: 306  LHGFQYPP 313

>ref|NP_694453.1| developmentally regulated RNA-binding protein 1; putative RNA
           binding protein RB-1 [Homo sapiens]
           gi|22001377|gb|AAM88417.1|AF526533_1 putative RNA
           binding protein RB-1 [Homo sapiens]
          Length = 328

 Score = 96.7 bits (239), Expect = 8e-19
 Identities = 68/227 (29%), Positives = 115/227 (49%), Gaps = 10/227 (4%)
 Frame = +2

Query: 62  SGSEAGISP*IMAEVDSPPGSRLFIVCGKNVEAETLQVAFRPFGNVQNVKVIRE------ 223
           S S  G  P + + +D PP SR+F+V  K      L+  F PFG++Q++ V+R+      
Sbjct: 7   SASGGGFRPGVDS-LDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKES 65

Query: 224 KGVAYVKYDKASSAALAMENLNGAVLNNGRGPKLKVLLAEAPNTSRGMHPPRPAEQEISS 403
           KG+A+VK+ ++S A  AME ++G  L       +KV +A+  + S G H  R  E E   
Sbjct: 66  KGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQ--SRSSGSH--RDVEDE--- 118

Query: 404 DPDNIPPRSRLFIVVPKQAEPQQINDAIAIYDGLEYC---KTDLVA-AKGVVFCKFTKAS 571
                   +R+F+++PK    + + +   +Y  +EYC   K  +   +KG+ + ++ K S
Sbjct: 119 ------ELTRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPS 172

Query: 572 FALRALEDVTGRGTVGPYKVKCMLAEPKTKRGRGDGSPQDMFSPLTQ 712
            A +A+E+            + +LAEPK K    + S QD +S + Q
Sbjct: 173 QAAQAIENC-------DRSFRAILAEPKNK--ASESSEQDYYSNMRQ 210

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 22/57 (38%), Positives = 34/57 (59%)
 Frame = +2

Query: 1022 RLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSKGFCFVNYSTPEAAAAAI 1192
            R+FV++ K+  ++ L   F+ +  +EYC + K+  TG SKG  +V Y  P  AA AI
Sbjct: 122  RIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAI 178

 Score = 38.1 bits (87), Expect = 0.32
 Identities = 20/71 (28%), Positives = 36/71 (50%)
 Frame = +2

Query: 1022 RLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSKGFCFVNYSTPEAAAAAIAQL 1201
            R+F+V+ K   + VL   F  F  ++   + +D  T  SKG  FV ++    A  A+ ++
Sbjct: 27   RIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEM 86

Query: 1202 NGIELPPHSNQ 1234
            +G  L P+  +
Sbjct: 87   HGQCLGPNDTK 97

 Score = 36.6 bits (83), Expect = 0.93
 Identities = 21/68 (30%), Positives = 35/68 (50%)
 Frame = +2

Query: 1019 QRLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSKGFCFVNYSTPEAAAAAIAQ 1198
            +RL VV      ++ L  +F    G+EYC++++DP +    G   V Y    +A  A  +
Sbjct: 246  KRLSVVSRVPFTEEQLFSIFDIVPGLEYCEVQRDPYSNYGHG--VVQYFNVASAIYAKYK 303

Query: 1199 LNGIELPP 1222
            L+G + PP
Sbjct: 304  LHGFQYPP 311

>ref|NP_695218.1| developmentally regulated RNA-binding protein 1 [Rattus norvegicus]
           gi|22831320|dbj|BAC16206.1| developmentally regulated
           RNA-binding protein 1 [Rattus norvegicus]
          Length = 476

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 68/229 (29%), Positives = 115/229 (49%), Gaps = 10/229 (4%)
 Frame = +2

Query: 62  SGSEAGISP*IMAEVDSPPGSRLFIVCGKNVEAETLQVAFRPFGNVQNVKVIRE------ 223
           SG   G  P + + +D PP SR+F+V  K      L+  F PFG++Q++ V+R+      
Sbjct: 7   SGGSGGFRPGVDS-LDEPPNSRIFLVISKYTSESVLREHFSPFGDIQDIWVVRDKHTKES 65

Query: 224 KGVAYVKYDKASSAALAMENLNGAVLNNGRGPKLKVLLAEAPNTSRGMHPPRPAEQEISS 403
           KG+A+VK+ ++S A  AME ++G  L       +KV +A+  + S G H  R  E E   
Sbjct: 66  KGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQ--SRSSGSH--RDVEDE--- 118

Query: 404 DPDNIPPRSRLFIVVPKQAEPQQINDAIAIYDGLEYC---KTDLVA-AKGVVFCKFTKAS 571
                   +R+F+++PK    + + +   +Y  +EYC   K  +   +KG+ + ++ K S
Sbjct: 119 ------ELTRIFVMIPKSYTEEDLREKFKVYGDIEYCSVIKNKVTGESKGLGYVRYLKPS 172

Query: 572 FALRALEDVTGRGTVGPYKVKCMLAEPKTKRGRGDGSPQDMFSPLTQAT 718
            A +A+E+            + +LAEPK K    +   QD +S + Q T
Sbjct: 173 QAAQAIENC-------DRSFRALLAEPKNK--VLESPEQDYYSSVRQET 212

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 33/85 (38%), Positives = 49/85 (56%), Gaps = 1/85 (1%)
 Frame = +2

Query: 98  AEVDSPPGSRLFIVCGKN-VEAETLQVAFRPFGNVQNVKVIREKGVAYVKYDKASSAALA 274
           A  ++P   RLFIV   + +  + L+  F  FGN+  V ++  K V YVKY    SA  A
Sbjct: 384 APPETPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIEVYLVSGKNVGYVKYADRMSANDA 443

Query: 275 MENLNGAVLNNGRGPKLKVLLAEAP 349
           +  L+G +LN   G +LKV+LA++P
Sbjct: 444 ITTLHGKILN---GVRLKVMLADSP 465

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 22/57 (38%), Positives = 34/57 (59%)
 Frame = +2

Query: 1022 RLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSKGFCFVNYSTPEAAAAAI 1192
            R+FV++ K+  ++ L   F+ +  +EYC + K+  TG SKG  +V Y  P  AA AI
Sbjct: 122  RIFVMIPKSYTEEDLREKFKVYGDIEYCSVIKNKVTGESKGLGYVRYLKPSQAAQAI 178

 Score = 38.9 bits (89), Expect = 0.19
 Identities = 20/71 (28%), Positives = 37/71 (51%)
 Frame = +2

Query: 1022 RLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSKGFCFVNYSTPEAAAAAIAQL 1201
            R+F+V+ K  ++ VL   F  F  ++   + +D  T  SKG  FV ++    A  A+ ++
Sbjct: 27   RIFLVISKYTSESVLREHFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEM 86

Query: 1202 NGIELPPHSNQ 1234
            +G  L P+  +
Sbjct: 87   HGQCLGPNDTK 97

 Score = 33.9 bits (76), Expect = 6.0
 Identities = 20/68 (29%), Positives = 32/68 (46%)
 Frame = +2

Query: 1019 QRLFVVVHKTVNQDVLARLFRKFNGMEYCDLKKDPATGRSKGFCFVNYSTPEAAAAAIAQ 1198
            +RL V       ++ L  +F    G+EYC++ +DP      G   V Y    +A  A  +
Sbjct: 248  KRLSVASRVPFTEEQLFSIFDIVPGLEYCEVHRDPYLNYGHG--VVQYFNVASAVYAQYK 305

Query: 1199 LNGIELPP 1222
            L+G + PP
Sbjct: 306  LHGFQYPP 313



EST assemble image


clone accession position
1 LCL042a09_r AV628447 1 482
2 LCL088a08_r AV631043 6 418
3 MXL053h07_r BP096166 20 372
4 MXL083e03_r BP097915 27 421
5 CL53f03_r AV395952 71 665
6 LCL023c11_r AV627235 88 265
7 MXL025a05_r BP094563 217 717
8 LCL025g09_r AV627372 410 917
9 LC027g01_r AV620854 500 888
10 CL01d10_r AV393296 503 991
11 LCL050h06_r AV629046 798 1159
12 LCL019a12_r AV626968 1053 1236




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research