KCC000018A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000018A_C01 KCC000018A_c01
CCGGCCTTTTACTTATCATCTTACACACTGCCCTTGGGTAGTGATCAGCCTGTGATCCGG
AACAATGAGTGAGGCTGTGAACCCGAAGGCCTACCCGCTGGCGGATGCCCAGTTGACCAA
CACCATCCTGGACATCGTCCAGCAGGCGGCCAACTATAAGCAGCTGAAGAAGGGTGCCAA
CGAGGCGACGAAGACTCTGAACCGCGGCATTTCCGAGTTTGTCGTTATGGCCGCCGACAC
GGAGCCTATTGAGATTCTGCTGCACCTGCCCCTGTTGGCTGAGGACAAGAACGTGCCCTA
CGTGTTTGTCCCCAGCAAGGCGGCGCTGGGTCGCGCATGCGGCGTGTCGCGCCCGGTTAT
CGCGGCCTCCGTCACCACCAACGAGGGCAGCCAGCTGAAGCCCCAGATTCAGAACCTCAA
GGGTGCCATCGAGAAGCTGCTCATCTAGAGGGCTCAGCAGCCTGGACAGTGCCTGGGACG
TGCTGGCTGCAACGCCAGACCCCATCCCGCACTCGGGATCCCGGTCGCCAGTTTTCACTG
TTGCGGCGGACCCGTAATCCACTGTAACCCATACGACACCt


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000018A_C01 KCC000018A_c01
         (581 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM64816.1| Ribosomal protein L7Ae-like [Arabidopsis thaliana]     215  4e-55
ref|NP_197516.1| ribosomal protein L7Ae family [Arabidopsis thal...   213  1e-54
ref|NP_193969.1| Ribosomal protein L7Ae family [Arabidopsis thal...   213  2e-54
ref|NP_192997.1| ribosomal protein L7Ae family [Arabidopsis thal...   212  3e-54
gb|AAH46579.1| Similar to NHP2 non-histone chromosome protein 2-...   206  1e-52

>gb|AAM64816.1| Ribosomal protein L7Ae-like [Arabidopsis thaliana]
          Length = 128

 Score =  215 bits (547), Expect = 4e-55
 Identities = 109/125 (87%), Positives = 117/125 (93%)
 Frame = +2

Query: 71  EAVNPKAYPLADAQLTNTILDIVQQAANYKQLKKGANEATKTLNRGISEFVVMAADTEPI 250
           E VNPKAYPLAD+QL+ TILD+VQQA NYKQLKKGANEATKTLNRGISEF+VMAADTEP+
Sbjct: 4   EGVNPKAYPLADSQLSITILDLVQQATNYKQLKKGANEATKTLNRGISEFIVMAADTEPL 63

Query: 251 EILLHLPLLAEDKNVPYVFVPSKAALGRACGVSRPVIAASVTTNEGSQLKPQIQNLKGAI 430
           EILLHLPLLAEDKNVPYVFVPSK ALGRACGV+RPVIA SVT+NE SQLK QIQ+LK AI
Sbjct: 64  EILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKSQIQHLKDAI 123

Query: 431 EKLLI 445
           EKLLI
Sbjct: 124 EKLLI 128

>ref|NP_197516.1| ribosomal protein L7Ae family [Arabidopsis thaliana]
           gi|15081642|gb|AAK82476.1| AT5g20160/F5O24_50
           [Arabidopsis thaliana] gi|20334836|gb|AAM16174.1|
           AT5g20160/F5O24_50 [Arabidopsis thaliana]
           gi|21592608|gb|AAM64557.1| ribosomal protein L7Ae-like
           [Arabidopsis thaliana]
          Length = 128

 Score =  213 bits (543), Expect = 1e-54
 Identities = 109/125 (87%), Positives = 116/125 (92%)
 Frame = +2

Query: 71  EAVNPKAYPLADAQLTNTILDIVQQAANYKQLKKGANEATKTLNRGISEFVVMAADTEPI 250
           E VNPKAYPLAD+QL+ TILD+VQQA NYKQLKKGANEATKTLNRGISEFVVMAAD EP+
Sbjct: 4   EVVNPKAYPLADSQLSITILDLVQQATNYKQLKKGANEATKTLNRGISEFVVMAADAEPL 63

Query: 251 EILLHLPLLAEDKNVPYVFVPSKAALGRACGVSRPVIAASVTTNEGSQLKPQIQNLKGAI 430
           EILLHLPLLAEDKNVPYVFVPSK ALGRACGV+RPVIA SVT+NE SQLK QIQ+LK AI
Sbjct: 64  EILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKSQIQHLKDAI 123

Query: 431 EKLLI 445
           EKLLI
Sbjct: 124 EKLLI 128

>ref|NP_193969.1| Ribosomal protein L7Ae family [Arabidopsis thaliana]
           gi|21554922|gb|AAM63731.1| Ribosomal protein L7Ae-like
           [Arabidopsis thaliana]
          Length = 128

 Score =  213 bits (541), Expect = 2e-54
 Identities = 108/125 (86%), Positives = 116/125 (92%)
 Frame = +2

Query: 71  EAVNPKAYPLADAQLTNTILDIVQQAANYKQLKKGANEATKTLNRGISEFVVMAADTEPI 250
           E VNPKAYPLAD+QL+ TI+D+VQQA NYKQLKKGANEATKTLNRGISEFVVMAAD EP+
Sbjct: 4   EVVNPKAYPLADSQLSITIMDLVQQATNYKQLKKGANEATKTLNRGISEFVVMAADAEPL 63

Query: 251 EILLHLPLLAEDKNVPYVFVPSKAALGRACGVSRPVIAASVTTNEGSQLKPQIQNLKGAI 430
           EILLHLPLLAEDKNVPYVFVPSK ALGRACGV+RPVIA SVT+NE SQLK QIQ+LK AI
Sbjct: 64  EILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKSQIQHLKDAI 123

Query: 431 EKLLI 445
           EKLLI
Sbjct: 124 EKLLI 128

>ref|NP_192997.1| ribosomal protein L7Ae family [Arabidopsis thaliana]
           gi|25295060|pir||C85135 Ribosomal protein L7Ae-like
           [imported] - Arabidopsis thaliana
           gi|5823571|emb|CAB53753.1| Ribosomal protein L7Ae-like
           [Arabidopsis thaliana] gi|7267962|emb|CAB78303.1|
           Ribosomal protein L7Ae-like [Arabidopsis thaliana]
           gi|13605585|gb|AAK32786.1|AF361618_1 AT4g12600/T1P17_190
           [Arabidopsis thaliana] gi|15777869|gb|AAL05895.1|
           AT4g12600/T1P17_190 [Arabidopsis thaliana]
          Length = 128

 Score =  212 bits (540), Expect = 3e-54
 Identities = 108/125 (86%), Positives = 116/125 (92%)
 Frame = +2

Query: 71  EAVNPKAYPLADAQLTNTILDIVQQAANYKQLKKGANEATKTLNRGISEFVVMAADTEPI 250
           E VNPKAYPLAD+QL+ TILD+VQQA NYKQLKKGANEATKTLNRGISEF+VMAADTEP+
Sbjct: 4   EGVNPKAYPLADSQLSITILDLVQQATNYKQLKKGANEATKTLNRGISEFIVMAADTEPL 63

Query: 251 EILLHLPLLAEDKNVPYVFVPSKAALGRACGVSRPVIAASVTTNEGSQLKPQIQNLKGAI 430
           EILLHLPLLAEDKNVPYVFVPSK ALGRAC V+RPVIA SVT+NE SQLK QIQ+LK AI
Sbjct: 64  EILLHLPLLAEDKNVPYVFVPSKQALGRACDVTRPVIACSVTSNEASQLKSQIQHLKDAI 123

Query: 431 EKLLI 445
           EKLLI
Sbjct: 124 EKLLI 128

>gb|AAH46579.1| Similar to NHP2 non-histone chromosome protein 2-like 1 (S.
           cerevisiae) [Xenopus laevis]
          Length = 128

 Score =  206 bits (525), Expect = 1e-52
 Identities = 102/123 (82%), Positives = 114/123 (91%)
 Frame = +2

Query: 77  VNPKAYPLADAQLTNTILDIVQQAANYKQLKKGANEATKTLNRGISEFVVMAADTEPIEI 256
           VNPKAYPLADAQLT T+LD+VQQAANYKQL+KGANEATKTLNRGISEF+VMAAD EP+EI
Sbjct: 6   VNPKAYPLADAQLTKTLLDLVQQAANYKQLRKGANEATKTLNRGISEFIVMAADAEPLEI 65

Query: 257 LLHLPLLAEDKNVPYVFVPSKAALGRACGVSRPVIAASVTTNEGSQLKPQIQNLKGAIEK 436
           +LHLPLL EDKNVPYVFV SK ALGRACGVSRPVI+ SVT  EGSQLKPQIQ+++ AIE+
Sbjct: 66  ILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVISCSVTIKEGSQLKPQIQSVQQAIER 125

Query: 437 LLI 445
           LL+
Sbjct: 126 LLV 128



EST assemble image


clone accession position
1 CL47h08_r AV395705 1 551
2 CL10g01_r AV393673 2 603
3 CL79b02_r AV397169 22 560
4 MX235e07_r BP091218 46 598
5 CM076e02_r AV391726 73 670
6 LCL007b07_r AV626333 83 361
7 CL70g04_r AV396825 84 590
8 MX253d03_r BP092376 87 518
9 CL70g05_r AV396861 93 681
10 CL41a10_r AV395411 99 534
11 CL06f05_r AV393644 99 485
12 CL13g02_r AV393909 99 611
13 CL33g05_r AV394971 99 492
14 CL15g11_r AV393978 99 500
15 HC081f07_r AV638078 99 533
16 CL65d01_r AV396554 99 612
17 CL16c02_r AV394027 99 620
18 CL09f11_r AV393705 99 626
19 CL26e02_r AV394572 99 633
20 HC094d03_r AV639049 99 589
21 MXL023e06_r BP094466 99 586
22 MXL032c08_r BP094912 99 573
23 CL52f02_r AV395854 99 572
24 CL17h02_r AV394146 99 569
25 CM087c08_r AV392429 99 644
26 CL57d11_r AV396272 99 664
27 CL09e01_r AV393708 99 567
28 MX050h05_r BP088073 99 428
29 MXL080e08_r BP097736 99 482
30 CM070e07_r AV391311 99 612
31 CL01d05_r AV393316 99 514
32 CL80h01_r AV397300 99 613
33 CL79a02_r AV397168 99 618
34 HCL061d06_r AV642968 99 429
35 CL75f07_r AV397045 109 619
36 MXL096f12_r BP098636 119 589
37 CL74c12_r AV396498 138 673
38 CL19h07_r AV394191 139 646
39 CL62b05_r AV396430 139 662
40 CM001d12_r AV386490 139 681
41 CM052b03_r AV390539 142 687
42 MXL041g09_r BP095437 149 539
43 CL11g08_r AV393780 159 681
44 CL49h10_r AV397730 166 662
45 CL65g03_r AV396587 173 681
46 CL52g08_r AV395887 179 681
47 CL47d06_r AV395715 206 682
48 CL72b09_r AV397004 216 681
49 CM085b09_r AV392369 247 602
50 CL34e02_r AV394886 283 682
51 CL46h03_r AV395655 314 633
52 HCL002c08_r AV639640 342 681
53 HC011h04_r AV632727 448 682




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research