KCC000017A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000017A_C01 KCC000017A_c01
tttttCATGTGCTAATCTTACAATGCTGTGTAGTTGTAGCACGGGGCCCGCTACCCTGCG
CTCAGCCAAGATCACAGCCACGCACTCAGCATCCTTCTTTTACTCTACAGTCCCCTGCGG
CTGCGTCGCCGCCCAGGTACAACAAAACTGCAATCGCTCAGCGGCCCTGCAACCAAAACT
GGAACACACCATACTCATCTGAGAATGCTACGCACAGCGTCTCGGGGCAACCCCTGCCTG
CCGCACGGCTACCTCACAATGCCGGTCAACACGATGACGTGCCAAAAATGTGGGACTGCA
GCGCAAGCCTCCGCGTCCCAATCACTCCCCACCTTCACCTCGTTCCAACAAGGAGGTGGC
TGCCTTAGGGCTCGTTCCAAAAACACATGGACGCTTCGTGCCCATGCATGAAGTGCCAGT
GAAGCCTCCCAACGCCTCTAGCCAACACAACCAACGCAACAACCCGCGTGCCGCCGGTGT
CTTCCCCGCGCACTCAGGCACGGAAGTCAGAAGGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000017A_C01 KCC000017A_c01
         (515 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_298619.1| hypothetical protein XP_298619 [Homo sapiens]         40  0.018
ref|XP_301872.1| similar to ENOD2 [Homo sapiens]                       39  0.039
ref|XP_310434.1| ENSANGP00000005649 [Anopheles gambiae] gi|21293...    37  0.11
pir||T43481 probable mucin DKFZp434C196.1 - human (fragment) gi|...    37  0.19
gb|AAD55980.2|AF159297_1 extensin-like protein [Zea mays]              28  0.25

>ref|XP_298619.1| hypothetical protein XP_298619 [Homo sapiens]
          Length = 186

 Score = 40.0 bits (92), Expect = 0.018
 Identities = 29/94 (30%), Positives = 42/94 (43%)
 Frame = +2

Query: 230 TPACRTATSQCRSTR*RAKNVGLQRKPPRPNHSPPSPRSNKEVAALGLVPKTHGRFVPMH 409
           +P C    S+ RS R  +   G  R+PP P       R +  +AA   VP+   R   + 
Sbjct: 9   SPGC----SRARSPRGPSTVQGRGRRPPSPGRPSDCARRDPALAAPSAVPRLGLRSQLLT 64

Query: 410 EVPVKPPNASSQHNQRNNPRAAGVFPAHSGTEVR 511
            VP + P +SS+  QR     A +   +SG E R
Sbjct: 65  PVPAREPGSSSRRGQR-----AALLAGYSGRETR 93

>ref|XP_301872.1| similar to ENOD2 [Homo sapiens]
          Length = 420

 Score = 38.9 bits (89), Expect = 0.039
 Identities = 33/114 (28%), Positives = 48/114 (41%), Gaps = 7/114 (6%)
 Frame = +3

Query: 183 NTPYSSENATHSVS--GQPLPAARLPHNAGQHDDVPKMWDCSASLRVPITPHLH---LVP 347
           +T +   + TH       PLP   +P +  QH  VP M  C   +  P++P  H   + P
Sbjct: 219 HTTHQCPHTTHQCPPHNTPLPPQNMPVSPAQHTSVPHM-TCQCPVHTPVSPTQHNTPVSP 277

Query: 348 TRRWLP*GSFQKHMDASCPCMKCQ*SLPTPLAN--TTNATTRVPPVSSPRTQAR 503
           TR      +   H    CP      ++P P  N   +  TTR  PV +P + AR
Sbjct: 278 TRH-----ASVPHTTRQCP----PHNMPLPPQNMPVSPRTTRQCPVYTPVSPAR 322

>ref|XP_310434.1| ENSANGP00000005649 [Anopheles gambiae] gi|21293904|gb|EAA06049.1|
           ENSANGP00000005649 [Anopheles gambiae str. PEST]
          Length = 327

 Score = 37.4 bits (85), Expect = 0.11
 Identities = 34/132 (25%), Positives = 50/132 (37%), Gaps = 13/132 (9%)
 Frame = +1

Query: 115 LRLRRRPGTTKLQSLSGPATKTGTHHTHLRMLRT-ASRGNPCLPHGYLTMPVNTMTCQKC 291
           +R R     T   ++   AT+     T  R L + +S G  C    ++     + T   C
Sbjct: 163 IRARTARAWTASATIRASATRASKGRTARRTLTSVSSTGRACTARAWMAATTTSATATGC 222

Query: 292 GTAAQAS-ASQSLPT---------FTSFQQGGGCLRARSKNT--WTLRAHA*SASEASQR 435
           G A  A   S +LP           TS   G GC RARS+++   T    A     ++ R
Sbjct: 223 GAARTARPTSNTLPAPCRASSAAWRTSSSTGSGCCRARSRSSPPCTTSTRAAPGRRSASR 282

Query: 436 L*PTQPTQQPAC 471
              T+    P C
Sbjct: 283 TRATRTATVPIC 294

>pir||T43481 probable mucin DKFZp434C196.1 - human (fragment)
           gi|6599134|emb|CAB63715.1| hypothetical protein [Homo
           sapiens]
          Length = 580

 Score = 36.6 bits (83), Expect = 0.19
 Identities = 46/168 (27%), Positives = 64/168 (37%), Gaps = 12/168 (7%)
 Frame = +3

Query: 42  RGPLPCAQPRSQPRTQHPSFTLQSPAAASP----PRYNKTAIAQR--PCNQNWNTPYSSE 203
           R  L    PR+ P  + P  + ++P+ ASP    PR +      R  P         +  
Sbjct: 75  RASLMRTPPRASPTRKPPRASPRTPSRASPTRRLPRASPMGSPHRASPMRTPPRASPTGT 134

Query: 204 NATHSVSGQPLPAA--RLPHNAGQHDDVPKMWDCSASLRVPITPHLHLVPTR----RWLP 365
            +T S +G P  A+    P  A      P+ W    + R P T  L   P+R    RW P
Sbjct: 135 PSTASPTGTPSSASPTGTPPRASPTGTPPRAW----ATRSPSTASLTRTPSRASLTRWPP 190

Query: 366 *GSFQKHMDASCPCMKCQ*SLPTPLANTTNATTRVPPVSSPRTQARKS 509
             S  +      P M  + S PT      + T R P  S  RT  R+S
Sbjct: 191 RASPTRTPPRESPRMSHRAS-PTRTPPRASPTRRPPRASPTRTPPRES 237

>gb|AAD55980.2|AF159297_1 extensin-like protein [Zea mays]
          Length = 1016

 Score = 28.5 bits (62), Expect(2) = 0.25
 Identities = 22/69 (31%), Positives = 32/69 (45%)
 Frame = +3

Query: 48  PLPCAQPRSQPRTQHPSFTLQSPAAASPPRYNKTAIAQRPCNQNWNTPYSSENATHSVSG 227
           P P + P S+P    P  TL  P+ +SPP    ++  Q P + +   P SS     S S 
Sbjct: 704 PTPPSTP-SKPPPPSPVETLPPPSKSSPPEEPVSSPPQAPKSSSPPAPVSSPPPLKS-SP 761

Query: 228 QPLPAARLP 254
            P+P +  P
Sbjct: 762 PPVPESSPP 770

 Score = 26.6 bits (57), Expect(2) = 0.25
 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%)
 Frame = +2

Query: 308 PPRPNHSPP-SPRSNKEVAALGLVPKTHGRFVPMHEVPVKPPNASS 442
           PP P  SPP +P+S+  +A +   P+      P   V   PP   S
Sbjct: 762 PPVPESSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKS 807



EST assemble image


clone accession position
1 MX209a02_r BP089517 1 234
2 CL01d04_r AV393312 6 520
3 MXL085e11_r BP098028 11 300




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research