KCC000016A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000016A_C01 KCC000016A_c01
cgccctctcccccgccgtcccctcCTCCGCCCTCGCCCCGCCCGCCTGCACCGCCGCCGA
CGCCCAACTGCGACTGCTCCAAGCTCGTCCGGGCGCCGGCCGGCGGCTGCGGCTCCGCCC
AGGCCATGGTCAGCTTCAAAGCCGGAGACCGCTACGACACCACCATTCCTTCCGTGGACA
TCTGCGTGCCCACGTTTGGATTTGATCCGGTGACCGGCATCTACAAGATTGCTTTCTGCT
GGAACACGGACTGCGAATCTCTGAGGGATCTGCAGGGCAAGCCCATCCGCGCCTACATTA
ACAACCTGGACACGACGCCCGGCACCGGCCCCGACGGCCTGGCCGGCACCAACGTGGTGC
TCACGGCGTTGGCGCCCGAGTGCGCTCGCAGCACCAACATCATCACGATCAAGGACACGG
GCGCCACCTACCGCTTCGGCGCCACCGAGCTGCTGGTCACGGTGCCCGCGCCCATCGCGA
CGCTGGACGTGGACGTTGCCATCAACAACACGGCGCAGTGCAACGACCACTGGGTGGTGA
CCGCGCTGGTGTCGGTGTCTGCGCCTCTGGGCACCACGCCGCCCATCCCGCCCGCCTCCT
GCCCCTGCTGGATGCGGACCACCAACGGCACCTGCCCCGGCATCAAGGTGCCCATCCTGC
TGGAGACCATCGACGACCTCGGCAACAACCGCGGCCAGTCCGTCATGCAGTGCATCGACC
CCGCCAACTTCGACATCTACACCGGCCGCATGGCCTACAGCTACTGCTGGCGCTACGACT
GCCTGCCGCCCGTGTTCGCCACCTCGCGCTTCAAGGCCACCTGCAGCAACCTGGAGCGCT
GGAACATTGCCAAGATGACCGGCAAGTTCCTTCTCAACATGCAGCACTCGGAGGGCATCT
ACATGAGCGTCACCGGCCACCCCAAGGACCCCACCCAGCAGCCCGTGATGTGGACCATCG
CCGACGACCAGCAGTGGATCGACCTGCCCGAGGGCGGTGTCGGCAACTTCACTTTCGAAT
ACATCATTCCACCTGGCCAGGACGATCTCTCGGCCGCTGTGGTTATGGACACCTCCCCGC
GCCCGCCGCCGCCGCCCGTGCCGCCTGGCCCGCCCGGCAGCAGTTGCTCCTGCCCGCTGA
CCCCGGAGGAGACCGTGGGCGGCGAGCCCGGCGTGTGCAACGGCACCTACGCCACCATGA
CAGTACGCCTGGAGAGCGACCCCACCGTCACCTACAAGCAGTGCGTGTCATGGCCCAACT
ACGATCTGATCATGCAGGAGATGGCGTGGAGCCACTGCTGGCGTTACGACCCCTGCCTGC
CCAAGGCCTTCTACGGCCAGGCCTACCGCGTGTCCATCAACGAGGTCAGCAAGCACAACA
TCCCGCTCATCCCGCCCGCCGGCTACGAGCTGCTGCACTTCGTGGCGCCGTTTGGCATGA
GTATTGAGACGACCTTCAAGTACGTCAACGGCGACGTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000016A_C01 KCC000016A_c01
         (1478 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_002448.1| mucin 2 [Homo sapiens] gi|2506877|sp|Q02817|MUC...   105  5e-22
pir||A43932 mucin 2 precursor, intestinal - human (fragments)         105  5e-22
gb|AAA59163.1| mucin                                                  105  5e-22
gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]                      106  1e-21
gb|AAA59875.1| mucin                                                  105  2e-21

>ref|NP_002448.1| mucin 2 [Homo sapiens] gi|2506877|sp|Q02817|MUC2_HUMAN Mucin 2
            precursor (Intestinal mucin 2) gi|454154|gb|AAB95295.1|
            mucin [Homo sapiens]
          Length = 5179

 Score =  105 bits (263), Expect = 2e-21
 Identities = 102/378 (26%), Positives = 144/378 (37%), Gaps = 1/378 (0%)
 Frame = +1

Query: 280  SPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTASAPPSCWS 459
            +PS P  TT T  P   P+    PT  +    P+   +P  + + T  P T  +PP   +
Sbjct: 1405 TPSPPPTTTTTLPPTTTPSP---PTTTTTTPPPTTTPSPPITTTTTPLPTTTPSPPISTT 1461

Query: 460  RCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPTAPAP 639
              P P+   T + P+TT    TTT   P             P    P+P    P T PA 
Sbjct: 1462 TTPPPTT--TPSPPTTTPSPPTTTPSPPTTT------TTTPPPTTTPSPPMTTPITPPAS 1513

Query: 640  ASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRASR- 816
             +  P    PS  + TT   P  +  +PPT+T  P   PT+T        P  PP  +  
Sbjct: 1514 TTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTT--PITPPTSTTTLPPTTTPSPPPTTTTT 1571

Query: 817  PPAATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTCPRA 996
            PP  T  +      P+    T +T   +T  SP T  T    P   PSP T++  T P +
Sbjct: 1572 PPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTS 1631

Query: 997  VSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPAC 1176
             +    + T      T + P     PP      P        +     P      +SP  
Sbjct: 1632 TTTLPPTTTPSPPPTTTTTP-----PPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPI- 1685

Query: 1177 ATAPTPP*QYAWRATPPSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARPTACP 1356
             T P+PP       T PSPT++     TT          T   TT   P P+T    +  
Sbjct: 1686 TTTPSPP---TTTMTTPSPTTTPSSPITTT--------TTPSSTTTPSPPPTTMTTPSPT 1734

Query: 1357 STRSASTTSRSSRPPATS 1410
            +T S  TT+ ++ PP T+
Sbjct: 1735 TTPSPPTTTMTTLPPTTT 1752

 Score =  102 bits (254), Expect(2) = 5e-22
 Identities = 91/325 (28%), Positives = 129/325 (39%), Gaps = 6/325 (1%)
 Frame = +1

Query: 67   TATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDL-IR*PASTRLLSAG 243
            T T P ++   P    P  P +   P T TT    P T+  P +   I  PAST  L   
Sbjct: 1461 TTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPMTTPITPPASTTTLPPT 1520

Query: 244  TRTANL*GICRASPSAPTLTTWT----RRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRS 411
            T           +PS PT TT T      P+P  T    P   +    P+   +P  + +
Sbjct: 1521 T-----------TPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTT 1569

Query: 412  RTRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSR 591
             T  P T  +PP+  +  P P+   T   P+TT    TTT   P             P  
Sbjct: 1570 TTPPPTTTPSPPTTTTPSP-PTITTTTPPPTTTPSPPTTTTTTP-------------PPT 1615

Query: 592  PPPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAG 771
              P+P    P T P   +  P    PS    TT   P  +  +PPT+T TP+   T T  
Sbjct: 1616 TTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTT-TPSPPITTTTT 1674

Query: 772  ATTACRPCSPPRAS-RPPAATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP* 948
                  P SP   +  PP  T +  +    P+S  +T +T  ++T  SP        SP 
Sbjct: 1675 PPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPT 1734

Query: 949  CGPSPTTSSGSTCPRAVSATSLSNT 1023
              PSP T++ +T P   +++ L+ T
Sbjct: 1735 TTPSPPTTTMTTLPPTTTSSPLTTT 1759

 Score =  101 bits (251), Expect = 4e-20
 Identities = 130/476 (27%), Positives = 168/476 (34%), Gaps = 4/476 (0%)
 Frame = +1

Query: 10   PRRPLLRPRPARLHRRRRPTATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSAC 189
            P  P   P P        P  T PS          PP   + S P T TT P LP T+  
Sbjct: 1399 PSPPTTTPSPPPTTTTTLPPTTTPSPP--TTTTTTPPPTTTPSPPITTTTTP-LPTTTPS 1455

Query: 190  PRLDLIR*PASTRLLSAGTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRR 369
            P +     P  T   S  T T +       +PS PT TT T    P PT  P+P   +  
Sbjct: 1456 PPISTTTTPPPTTTPSPPTTTPSP---PTTTPSPPTTTTTT----PPPTTTPSPPMTTPI 1508

Query: 370  WRPSALAAPTSSRSRTRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRW 549
              P+         S T  PPT +         P P    T T P TT  S  TT      
Sbjct: 1509 TPPA---------STTTLPPTTT---------PSPPTTTTTTPPPTTTPSPPTT------ 1544

Query: 550  CRCLRLWAPRRPSRPPPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSASTPPT 729
                       P  PP +     P T P+P         P TT  TT   P+ + S P T
Sbjct: 1545 ----------TPITPPTSTTTLPPTTTPSP---------PPTT--TTTPPPTTTPSPPTT 1583

Query: 730  STSTPAAWPTATAGATTACRPCSPPRASRPPAATWSAGTL-PR*PASSFSTCSTRRAST* 906
            +T +P    T T   TT   P +    + PP  T S  T  P  P +S +T       + 
Sbjct: 1584 TTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPS- 1642

Query: 907  ASPATPRTPPSSP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTISRPLWLW-TPPRA 1083
              P T  TPP  P   PSP T++  + P   + T    T      T S P+    +PP  
Sbjct: 1643 PPPTTTTTPP--PTTTPSPPTTTTPSPPITTTTTPPPTT------TPSSPITTTPSPPTT 1694

Query: 1084 RRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATPPSPTSSACHGPTT 1263
                P     P++              +P+  T P+PP           PT+     PTT
Sbjct: 1695 TMTTPSPTTTPSSPITT--------TTTPSSTTTPSPP-----------PTTMTTPSPTT 1735

Query: 1264 I*SCRRWRGATAGVTTPACPRPST-ARPTACPSTRSASTTSRSSRPPATSC-CTSW 1425
              S       T   TT + P  +T   P+  P T S  +T+  + P    C  T W
Sbjct: 1736 TPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGW 1791

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 101/382 (26%), Positives = 143/382 (36%), Gaps = 2/382 (0%)
 Frame = +1

Query: 271  CRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTASAPPS 450
            C  +PS PT T     P+P PT        +    P+   +P ++ + T  P T  +PP 
Sbjct: 1395 CITTPSPPTTT-----PSPPPTT-------TTTLPPTTTPSPPTTTTTTPPPTTTPSPPI 1442

Query: 451  CWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPTA 630
              +  P P+     T PS    + TT                     PPP      P T 
Sbjct: 1443 TTTTTPLPT-----TTPSPPISTTTT---------------------PPPTTTPSPPTTT 1476

Query: 631  PAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRA 810
            P+P +  PS   P TT+ TT   P+ + S P T+  TP A  T T   TT   P +    
Sbjct: 1477 PSPPTTTPS---PPTTTTTTPP-PTTTPSPPMTTPITPPA-STTTLPPTTTPSPPTTTTT 1531

Query: 811  SRPPAATWSAGTL-PR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTC 987
            + PP  T S  T  P  P +S +T           P T  +PP +    P PTT+     
Sbjct: 1532 TPPPTTTPSPPTTTPITPPTSTTTLP---------PTTTPSPPPTTTTTPPPTTTPSPPT 1582

Query: 988  PRAVSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAAS 1167
                S  +++ T+     T S P    T P      P     P    P           +
Sbjct: 1583 TTTPSPPTITTTTPPPTTTPSPPTTTTTTPP-----PTTTPSPPTTTPI----------T 1627

Query: 1168 PACATAPTPP*QYAWRATP-PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARP 1344
            P  +T   PP       TP P PT++    PTT  S       +  +TT   P P+T   
Sbjct: 1628 PPTSTTTLPP-----TTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPS 1682

Query: 1345 TACPSTRSASTTSRSSRPPATS 1410
            +   +T S  TT+ ++  P T+
Sbjct: 1683 SPITTTPSPPTTTMTTPSPTTT 1704

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 115/501 (22%), Positives = 165/501 (31%), Gaps = 30/501 (5%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 2856 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 2903

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 2904 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 2953

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 2954 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 2992

Query: 601  APAGCGPPT------------APAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTP 744
             P G   PT             P P         P TT+ T   +P+      PT T TP
Sbjct: 2993 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT------PTGTQTP 3046

Query: 745  AAWPTATAGATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFSTCSTRRAST*ASPA 918
               P  T   TT   P   P  ++ P  T   +  T+   P  + +   T    T  +  
Sbjct: 3047 TTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3103

Query: 919  TPRTPPS---SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTIS---RPLWLWTPPR 1080
            TP   P+   +P   P  TT++ +  P      + + T      T++    P    TP  
Sbjct: 3104 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3163

Query: 1081 ARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATP--------PSPT 1236
                    +         + P   P   +      PTP        TP        P+PT
Sbjct: 3164 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3223

Query: 1237 SSACHGPTTI*SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSASTTSRSSRPPATSC 1413
             +    PTT          T   T    P P+ T  PT  P T + +T + +  P  T  
Sbjct: 3224 PTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPIT-TTTTVTPTPTPTGTQT 3275

Query: 1414 CTSWRRLA*VLRRPSSTSTAT 1476
             T+          P+ T T T
Sbjct: 3276 PTTTPITTTTTVTPTPTPTGT 3296

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 115/501 (22%), Positives = 165/501 (31%), Gaps = 30/501 (5%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 3569 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 3616

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 3617 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 3666

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 3667 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 3705

Query: 601  APAGCGPPT------------APAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTP 744
             P G   PT             P P         P TT+ T   +P+      PT T TP
Sbjct: 3706 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT------PTGTQTP 3759

Query: 745  AAWPTATAGATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFSTCSTRRAST*ASPA 918
               P  T   TT   P   P  ++ P  T   +  T+   P  + +   T    T  +  
Sbjct: 3760 TTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3816

Query: 919  TPRTPPS---SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTIS---RPLWLWTPPR 1080
            TP   P+   +P   P  TT++ +  P      + + T      T++    P    TP  
Sbjct: 3817 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3876

Query: 1081 ARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATP--------PSPT 1236
                    +         + P   P   +      PTP        TP        P+PT
Sbjct: 3877 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3936

Query: 1237 SSACHGPTTI*SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSASTTSRSSRPPATSC 1413
             +    PTT          T   T    P P+ T  PT  P T + +T + +  P  T  
Sbjct: 3937 PTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPIT-TTTTVTPTPTPTGTQT 3988

Query: 1414 CTSWRRLA*VLRRPSSTSTAT 1476
             T+          P+ T T T
Sbjct: 3989 PTTTPITTTTTVTPTPTPTGT 4009

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 115/501 (22%), Positives = 165/501 (31%), Gaps = 30/501 (5%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 2557 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 2604

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 2605 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 2654

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 2655 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 2693

Query: 601  APAGCGPPT------------APAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTP 744
             P G   PT             P P         P TT+ T   +P+      PT T TP
Sbjct: 2694 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT------PTGTQTP 2747

Query: 745  AAWPTATAGATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFSTCSTRRAST*ASPA 918
               P  T   TT   P   P  ++ P  T   +  T+   P  + +   T    T  +  
Sbjct: 2748 TTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2804

Query: 919  TPRTPPS---SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTIS---RPLWLWTPPR 1080
            TP   P+   +P   P  TT++ +  P      + + T      T++    P    TP  
Sbjct: 2805 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2864

Query: 1081 ARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATP--------PSPT 1236
                    +         + P   P   +      PTP        TP        P+PT
Sbjct: 2865 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2924

Query: 1237 SSACHGPTTI*SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSASTTSRSSRPPATSC 1413
             +    PTT          T   T    P P+ T  PT  P T + +T + +  P  T  
Sbjct: 2925 PTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPIT-TTTTVTPTPTPTGTQT 2976

Query: 1414 CTSWRRLA*VLRRPSSTSTAT 1476
             T+          P+ T T T
Sbjct: 2977 PTTTPITTTTTVTPTPTPTGT 2997

 Score = 75.9 bits (185), Expect(2) = 5e-13
 Identities = 115/501 (22%), Positives = 165/501 (31%), Gaps = 30/501 (5%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 1913 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 1960

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 1961 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 2010

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 2011 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 2049

Query: 601  APAGCGPPT------------APAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTP 744
             P G   PT             P P         P TT+ T   +P+      PT T TP
Sbjct: 2050 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT------PTGTQTP 2103

Query: 745  AAWPTATAGATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFSTCSTRRAST*ASPA 918
               P  T   TT   P   P  ++ P  T   +  T+   P  + +   T    T  +  
Sbjct: 2104 TTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2160

Query: 919  TPRTPPS---SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTIS---RPLWLWTPPR 1080
            TP   P+   +P   P  TT++ +  P      + + T      T++    P    TP  
Sbjct: 2161 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2220

Query: 1081 ARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATP--------PSPT 1236
                    +         + P   P   +      PTP        TP        P+PT
Sbjct: 2221 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2280

Query: 1237 SSACHGPTTI*SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSASTTSRSSRPPATSC 1413
             +    PTT          T   T    P P+ T  PT  P T + +T + +  P  T  
Sbjct: 2281 PTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPIT-TTTTVTPTPTPTGTQT 2332

Query: 1414 CTSWRRLA*VLRRPSSTSTAT 1476
             T+          P+ T T T
Sbjct: 2333 PTTTPITTTTTVTPTPTPTGT 2353

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 117/491 (23%), Positives = 169/491 (33%), Gaps = 40/491 (8%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 3914 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 3961

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 3962 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 4011

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 4012 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 4050

Query: 601  APAGCGPPTA------------PAPASRCPSCWRPSTTSATTAASPSCSAS-----TPPT 729
             P G   PT             P P         P TT+ T   +P+ + +     TP T
Sbjct: 4051 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 4110

Query: 730  STSTPAAWPTATA---------GATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFS 876
            +T+T    PT T            TT   P   P  ++ P  T   +  T+   P  + +
Sbjct: 4111 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 4170

Query: 877  TCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTISRP 1056
               T    T  +  TP   P+    GP   TS+        S     +++   +R+ S P
Sbjct: 4171 QTPTTTPITTTTTVTPTPTPTGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSP 4230

Query: 1057 LWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATPPSPT 1236
            L   T   +          P A+            A P+  TAPT        + PPS T
Sbjct: 4231 LTESTTLLS--------TLPPAIEMTS-------TAPPSTPTAPTTTSGGHTLSPPPSTT 4275

Query: 1237 SSACHGPTTI*SCRRWRGATAGVTTPACPRPSTAR--------PTACPSTRSASTTSRSS 1392
            +S    PT        RG T G  + + P PST +        PT  P +  +   +   
Sbjct: 4276 TSPPGTPT--------RGTTTG--SSSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGL 4325

Query: 1393 RPPATS---CC 1416
            RP  +S   CC
Sbjct: 4326 RPYPSSVLICC 4336

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 116/515 (22%), Positives = 170/515 (32%), Gaps = 44/515 (8%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 2074 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 2121

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 2122 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 2171

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 2172 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 2210

Query: 601  APAGCGPPTA------------PAPASRCPSCWRPSTTSATTAASPSCSAS-----TPPT 729
             P G   PT             P P         P TT+ T   +P+ + +     TP T
Sbjct: 2211 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2270

Query: 730  STSTPAAWPTATA---------GATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFS 876
            +T+T    PT T            TT   P   P  ++ P  T   +  T+   P  + +
Sbjct: 2271 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2330

Query: 877  TCSTRRAST*ASPATPRTPPS---SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTI 1047
               T    T  +  TP   P+   +P   P  TT++ +  P      + + T      T+
Sbjct: 2331 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2390

Query: 1048 S---RPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRA 1218
            +    P    TP          +         + P   P   +      PTP        
Sbjct: 2391 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2450

Query: 1219 TP--------PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSA 1371
            TP        P+PT +    PTT          T   T    P P+ T  PT  P T + 
Sbjct: 2451 TPITTTTTVTPTPTPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPIT-TT 2502

Query: 1372 STTSRSSRPPATSCCTSWRRLA*VLRRPSSTSTAT 1476
            +T + +  P  T   T+          P+ T T T
Sbjct: 2503 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2537

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 116/515 (22%), Positives = 170/515 (32%), Gaps = 44/515 (8%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 3270 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 3317

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 3318 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 3367

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 3368 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 3406

Query: 601  APAGCGPPTA------------PAPASRCPSCWRPSTTSATTAASPSCSAS-----TPPT 729
             P G   PT             P P         P TT+ T   +P+ + +     TP T
Sbjct: 3407 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3466

Query: 730  STSTPAAWPTATA---------GATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFS 876
            +T+T    PT T            TT   P   P  ++ P  T   +  T+   P  + +
Sbjct: 3467 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3526

Query: 877  TCSTRRAST*ASPATPRTPPS---SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTI 1047
               T    T  +  TP   P+   +P   P  TT++ +  P      + + T      T+
Sbjct: 3527 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3586

Query: 1048 S---RPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRA 1218
            +    P    TP          +         + P   P   +      PTP        
Sbjct: 3587 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3646

Query: 1219 TP--------PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSA 1371
            TP        P+PT +    PTT          T   T    P P+ T  PT  P T + 
Sbjct: 3647 TPITTTTTVTPTPTPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPIT-TT 3698

Query: 1372 STTSRSSRPPATSCCTSWRRLA*VLRRPSSTSTAT 1476
            +T + +  P  T   T+          P+ T T T
Sbjct: 3699 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3733

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 116/515 (22%), Positives = 170/515 (32%), Gaps = 44/515 (8%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 3086 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 3133

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 3134 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 3183

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 3184 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 3222

Query: 601  APAGCGPPTA------------PAPASRCPSCWRPSTTSATTAASPSCSAS-----TPPT 729
             P G   PT             P P         P TT+ T   +P+ + +     TP T
Sbjct: 3223 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3282

Query: 730  STSTPAAWPTATA---------GATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFS 876
            +T+T    PT T            TT   P   P  ++ P  T   +  T+   P  + +
Sbjct: 3283 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3342

Query: 877  TCSTRRAST*ASPATPRTPPS---SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTI 1047
               T    T  +  TP   P+   +P   P  TT++ +  P      + + T      T+
Sbjct: 3343 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3402

Query: 1048 S---RPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRA 1218
            +    P    TP          +         + P   P   +      PTP        
Sbjct: 3403 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3462

Query: 1219 TP--------PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSA 1371
            TP        P+PT +    PTT          T   T    P P+ T  PT  P T + 
Sbjct: 3463 TPITTTTTVTPTPTPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPIT-TT 3514

Query: 1372 STTSRSSRPPATSCCTSWRRLA*VLRRPSSTSTAT 1476
            +T + +  P  T   T+          P+ T T T
Sbjct: 3515 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3549

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 116/515 (22%), Positives = 170/515 (32%), Gaps = 44/515 (8%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 3730 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 3777

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 3778 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 3827

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 3828 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 3866

Query: 601  APAGCGPPTA------------PAPASRCPSCWRPSTTSATTAASPSCSAS-----TPPT 729
             P G   PT             P P         P TT+ T   +P+ + +     TP T
Sbjct: 3867 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3926

Query: 730  STSTPAAWPTATA---------GATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFS 876
            +T+T    PT T            TT   P   P  ++ P  T   +  T+   P  + +
Sbjct: 3927 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3986

Query: 877  TCSTRRAST*ASPATPRTPPS---SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTI 1047
               T    T  +  TP   P+   +P   P  TT++ +  P      + + T      T+
Sbjct: 3987 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4046

Query: 1048 S---RPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRA 1218
            +    P    TP          +         + P   P   +      PTP        
Sbjct: 4047 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4106

Query: 1219 TP--------PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSA 1371
            TP        P+PT +    PTT          T   T    P P+ T  PT  P T + 
Sbjct: 4107 TPITTTTTVTPTPTPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPIT-TT 4158

Query: 1372 STTSRSSRPPATSCCTSWRRLA*VLRRPSSTSTAT 1476
            +T + +  P  T   T+          P+ T T T
Sbjct: 4159 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 4193

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 98/426 (23%), Positives = 140/426 (32%), Gaps = 29/426 (6%)
 Frame = +1

Query: 286  SAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTASAPPSCWSRC 465
            + P  TT T  P P PT    PT        +    PT + ++T   PT +   +  +  
Sbjct: 1898 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT---PTTTPITTTTTVT 1954

Query: 466  PRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPT------ 627
            P P+   T T P+TT  + TTT                    P P P G   PT      
Sbjct: 1955 PTPTPTGTQT-PTTTPITTTTT------------------VTPTPTPTGTQTPTTTPITT 1995

Query: 628  ------APAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACR 789
                   P P         P TT+ T   +P+      PT T TP   P  T   TT   
Sbjct: 1996 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT------PTGTQTPTTTPITT---TTTVT 2046

Query: 790  PCSPPRASRPPAAT--WSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPS---SP*CG 954
            P   P  ++ P  T   +  T+   P  + +   T    T  +  TP   P+   +P   
Sbjct: 2047 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2106

Query: 955  PSPTTSSGSTCPRAVSATSLSNTSFHLARTIS---RPLWLWTPPRARRRRPCRLARPAAV 1125
            P  TT++ +  P      + + T      T++    P    TP          +      
Sbjct: 2107 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2166

Query: 1126 APAR*PRRRPWAASPACATAPTPP*QYAWRATP--------PSPTSSACHGPTTI*SCRR 1281
               + P   P   +      PTP        TP        P+PT +    PTT      
Sbjct: 2167 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT------ 2220

Query: 1282 WRGATAGVTTPACPRPS-TARPTACPSTRSASTTSRSSRPPATSCCTSWRRLA*VLRRPS 1458
                T   T    P P+ T  PT  P T + +T + +  P  T   T+          P+
Sbjct: 2221 -TPITTTTTVTPTPTPTGTQTPTTTPIT-TTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2278

Query: 1459 STSTAT 1476
             T T T
Sbjct: 2279 PTPTGT 2284

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 116/515 (22%), Positives = 170/515 (32%), Gaps = 44/515 (8%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 2258 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 2305

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 2306 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 2355

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 2356 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 2394

Query: 601  APAGCGPPTA------------PAPASRCPSCWRPSTTSATTAASPSCSAS-----TPPT 729
             P G   PT             P P         P TT+ T   +P+ + +     TP T
Sbjct: 2395 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2454

Query: 730  STSTPAAWPTATA---------GATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFS 876
            +T+T    PT T            TT   P   P  ++ P  T   +  T+   P  + +
Sbjct: 2455 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2514

Query: 877  TCSTRRAST*ASPATPRTPPS---SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTI 1047
               T    T  +  TP   P+   +P   P  TT++ +  P      + + T      T+
Sbjct: 2515 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2574

Query: 1048 S---RPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRA 1218
            +    P    TP          +         + P   P   +      PTP        
Sbjct: 2575 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2634

Query: 1219 TP--------PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSA 1371
            TP        P+PT +    PTT          T   T    P P+ T  PT  P T + 
Sbjct: 2635 TPITTTTTVTPTPTPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPIT-TT 2686

Query: 1372 STTSRSSRPPATSCCTSWRRLA*VLRRPSSTSTAT 1476
            +T + +  P  T   T+          P+ T T T
Sbjct: 2687 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2721

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 75/261 (28%), Positives = 104/261 (39%), Gaps = 6/261 (2%)
 Frame = +1

Query: 646  RCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRASRPPA 825
            R   CW P     TT + P+ + S PP +T+T    PT T    T      PP  +  P 
Sbjct: 1385 RVNCCW-PMDKCITTPSPPTTTPS-PPPTTTTTLP-PTTTPSPPTTTTTTPPPTTTPSPP 1441

Query: 826  ATWSAGTLP-R*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTCPRAVS 1002
             T +   LP   P+   ST +T   +T  +P+ P T PS P   PSP T++ +T P   +
Sbjct: 1442 ITTTTTPLPTTTPSPPISTTTTPPPTT--TPSPPTTTPSPPTTTPSPPTTTTTTPPPTTT 1499

Query: 1003 ATSLSNTSF--HLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPAC 1176
             +    T      + T   P    +PP      P     P    P+  P   P   +P  
Sbjct: 1500 PSPPMTTPITPPASTTTLPPTTTPSPPTTTTTTP-----PPTTTPSP-PTTTP--ITPPT 1551

Query: 1177 ATAPTPP*QYAWRATP-PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARPTAC 1353
            +T   PP       TP P PT++    PTT          T    T   P P T   T  
Sbjct: 1552 STTTLPP-----TTTPSPPPTTTTTPPPTT----------TPSPPTTTTPSPPTITTTTP 1596

Query: 1354 PSTRSAS--TTSRSSRPPATS 1410
            P T + S  TT+ ++ PP T+
Sbjct: 1597 PPTTTPSPPTTTTTTPPPTTT 1617

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 101/431 (23%), Positives = 143/431 (32%), Gaps = 29/431 (6%)
 Frame = +1

Query: 271  CRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTASAPPS 450
            C   P+  T TT T  P P PT  P  T  +    P+    PT +++ T  P T +   +
Sbjct: 1878 CVTQPTTMTTTT-TENPTP-PTTTPITTTTTVTPTPT----PTGTQTPTTTPITTTTTVT 1931

Query: 451  CWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPT- 627
                 P P+   T T P+TT  + TTT                    P P P G   PT 
Sbjct: 1932 -----PTPTPTGTQT-PTTTPITTTTT------------------VTPTPTPTGTQTPTT 1967

Query: 628  -----------APAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGA 774
                        P P         P TT+ T   +P+      PT T TP   P  T   
Sbjct: 1968 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT------PTGTQTPTTTPITT--- 2018

Query: 775  TTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPS--- 939
            TT   P   P  ++ P  T   +  T+   P  + +   T    T  +  TP   P+   
Sbjct: 2019 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2078

Query: 940  SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTIS---RPLWLWTPPRARRRRPCRLA 1110
            +P   P  TT++ +  P      + + T      T++    P    TP          + 
Sbjct: 2079 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2138

Query: 1111 RPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATP--------PSPTSSACHGPTTI 1266
                    + P   P   +      PTP        TP        P+PT +    PTT 
Sbjct: 2139 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT- 2197

Query: 1267 *SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSASTTSRSSRPPATSCCTSWRRLA*V 1443
                     T   T    P P+ T  PT  P T + +T + +  P  T   T+       
Sbjct: 2198 ------TPITTTTTVTPTPTPTGTQTPTTTPIT-TTTTVTPTPTPTGTQTPTTTPITTTT 2250

Query: 1444 LRRPSSTSTAT 1476
               P+ T T T
Sbjct: 2251 TVTPTPTPTGT 2261

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 126/568 (22%), Positives = 181/568 (31%), Gaps = 82/568 (14%)
 Frame = +1

Query: 19   PLLRPRPARLHRRRRPTATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRL 198
            P   P P        P  T PS          PP   + S P T TT P    T + P  
Sbjct: 1637 PTTTPSPPPTTTTTPPPTTTPS----------PPTTTTPSPPITTTTTPPPTTTPSSPIT 1686

Query: 199  DLIR*PASTRLLSAGTRTANL*GICRASPSAPTLTTWT----RRPAPAPTAWPAPTWCSR 366
                 P +T    + T T          PS+P  TT T      P+P PT    P+    
Sbjct: 1687 TTPSPPTTTMTTPSPTTT----------PSSPITTTTTPSSTTTPSPPPTTMTTPS---- 1732

Query: 367  RWRPSALAAPTSSRSRTRAPPTASAP----PSCWSRCPRPSRRWTWTLPSTTRRSATT-T 531
               P+   +P ++   T  P T S+P    P   S  P     ++ T P+T        T
Sbjct: 1733 ---PTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWT 1789

Query: 532  GW*----PRWCR-----------CLRLWAPR---RPSRPPPAPAGCGPPTAPAPAS---- 645
            GW     P + +           C   WA     R +  P  P G    T     S    
Sbjct: 1790 GWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLI 1849

Query: 646  ------------------------RCPSC-WRPSTTSATTAASPSCSASTPPTSTSTPAA 750
                                    +C  C  +P+T + TT  +P+   +TP T+T+T   
Sbjct: 1850 CKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTP 1909

Query: 751  WPTATA---------GATTACRPCSPPRASRPPAAT--WSAGTLPR*PASSFSTCSTRRA 897
             PT T            TT   P   P  ++ P  T   +  T+   P  + +   T   
Sbjct: 1910 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 1969

Query: 898  ST*ASPATPRTPPS---SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTIS---RPL 1059
             T  +  TP   P+   +P   P  TT++ +  P      + + T      T++    P 
Sbjct: 1970 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2029

Query: 1060 WLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATP----- 1224
               TP          +         + P   P   +      PTP        TP     
Sbjct: 2030 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2089

Query: 1225 ---PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPS-TARPTACPSTRSASTTSRSS 1392
               P+PT +    PTT          T   T    P P+ T  PT  P T + +T + + 
Sbjct: 2090 TVTPTPTPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPIT-TTTTVTPTP 2141

Query: 1393 RPPATSCCTSWRRLA*VLRRPSSTSTAT 1476
             P  T   T+          P+ T T T
Sbjct: 2142 TPTGTQTPTTTPITTTTTVTPTPTPTGT 2169

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 112/468 (23%), Positives = 167/468 (34%), Gaps = 22/468 (4%)
 Frame = +1

Query: 64   PTAT-APSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSA 240
            PT T  P+++         P P + +  +T TT P    T+  P       P  T     
Sbjct: 4029 PTGTQTPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT------PTPT----- 4076

Query: 241  GTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTR 420
            GT+T           + P  TT T  P P PT    PT        +    PT + ++T 
Sbjct: 4077 GTQTPT---------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT- 4126

Query: 421  APPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPP 600
              PT +   +  +  P P+   T T P+TT  + TTT                    P P
Sbjct: 4127 --PTTTPITTTTTVTPTPTPTGTQT-PTTTPITTTTT------------------VTPTP 4165

Query: 601  APAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATT 780
             P G   PT   P +        +TT+ T   +P+ + + PPT TST    P A    + 
Sbjct: 4166 TPTGTQTPTT-TPIT--------TTTTVTPTPTPTGTQTGPPTHTSTA---PIAELTTSN 4213

Query: 781  ACRPCSPPRASR----------------PPAATWSAGTLPR*PASSFSTCSTRRAST*AS 912
                 S P+ SR                PPA   ++   P  P +  +T      S    
Sbjct: 4214 PPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSP--P 4271

Query: 913  PATPRTPPSSP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTISRPLWLWTPPRARRR 1092
            P+T  +PP +P  G +  +SS  T P  V  T+ S                WTP      
Sbjct: 4272 PSTTTSPPGTPTRGTTTGSSSAPT-PSTVQTTTTS---------------AWTPT----- 4310

Query: 1093 RPCRLARPAAVAPAR*PRRRPWAASP--ACATAPT--PP*QYAWRATPPSPTSSACHGPT 1260
             P  L+ P+ +   R    RP+ +S    C    T   P +  +  T        C+   
Sbjct: 4311 -PTPLSTPSII---RTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGT----YGDTCYFVN 4362

Query: 1261 TI*SCRRWRGATAGVTTPA-CPRPSTARPTACPSTRSASTTSRSSRPP 1401
               SC       +  +TP+  P PS + PT    + + S  +  ++PP
Sbjct: 4363 CSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPP 4410

 Score = 25.8 bits (55), Expect(2) = 5e-22
 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 5/26 (19%)
 Frame = +3

Query: 3    PSPP---PSPPPPSPR--PPAPPPTP 65
            PSPP   PSPPP +    PP   P+P
Sbjct: 1399 PSPPTTTPSPPPTTTTTLPPTTTPSP 1424

 Score = 21.9 bits (45), Expect(2) = 5e-13
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +3

Query: 3    PSPPPSPPPPSPRPPAPPPTP 65
            P+PP + P  +     P PTP
Sbjct: 1893 PTPPTTTPITTTTTVTPTPTP 1913

>pir||A43932 mucin 2 precursor, intestinal - human (fragments)
          Length = 3020

 Score =  105 bits (263), Expect = 2e-21
 Identities = 102/378 (26%), Positives = 144/378 (37%), Gaps = 1/378 (0%)
 Frame = +1

Query: 280  SPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTASAPPSCWS 459
            +PS P  TT T  P   P+    PT  +    P+   +P  + + T  P T  +PP   +
Sbjct: 1405 TPSPPPTTTTTLPPTTTPSP---PTTTTTTPPPTTTPSPPITTTTTPLPTTTPSPPISTT 1461

Query: 460  RCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPTAPAP 639
              P P+   T + P+TT    TTT   P             P    P+P    P T PA 
Sbjct: 1462 TTPPPTT--TPSPPTTTPSPPTTTPSPPTTT------TTTPPPTTTPSPPMTTPITPPAS 1513

Query: 640  ASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRASR- 816
             +  P    PS  + TT   P  +  +PPT+T  P   PT+T        P  PP  +  
Sbjct: 1514 TTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTT--PITPPTSTTTLPPTTTPSPPPTTTTT 1571

Query: 817  PPAATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTCPRA 996
            PP  T  +      P+    T +T   +T  SP T  T    P   PSP T++  T P +
Sbjct: 1572 PPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTS 1631

Query: 997  VSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPAC 1176
             +    + T      T + P     PP      P        +     P      +SP  
Sbjct: 1632 TTTLPPTTTPSPPPTTTTTP-----PPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPI- 1685

Query: 1177 ATAPTPP*QYAWRATPPSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARPTACP 1356
             T P+PP       T PSPT++     TT          T   TT   P P+T    +  
Sbjct: 1686 TTTPSPP---TTTMTTPSPTTTPSSPITTT--------TTPSSTTTPSPPPTTMTTPSPT 1734

Query: 1357 STRSASTTSRSSRPPATS 1410
            +T S  TT+ ++ PP T+
Sbjct: 1735 TTPSPPTTTMTTLPPTTT 1752

 Score =  102 bits (254), Expect(2) = 5e-22
 Identities = 91/325 (28%), Positives = 129/325 (39%), Gaps = 6/325 (1%)
 Frame = +1

Query: 67   TATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDL-IR*PASTRLLSAG 243
            T T P ++   P    P  P +   P T TT    P T+  P +   I  PAST  L   
Sbjct: 1461 TTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPMTTPITPPASTTTLPPT 1520

Query: 244  TRTANL*GICRASPSAPTLTTWT----RRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRS 411
            T           +PS PT TT T      P+P  T    P   +    P+   +P  + +
Sbjct: 1521 T-----------TPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTT 1569

Query: 412  RTRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSR 591
             T  P T  +PP+  +  P P+   T   P+TT    TTT   P             P  
Sbjct: 1570 TTPPPTTTPSPPTTTTPSP-PTITTTTPPPTTTPSPPTTTTTTP-------------PPT 1615

Query: 592  PPPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAG 771
              P+P    P T P   +  P    PS    TT   P  +  +PPT+T TP+   T T  
Sbjct: 1616 TTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTT-TPSPPITTTTT 1674

Query: 772  ATTACRPCSPPRAS-RPPAATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP* 948
                  P SP   +  PP  T +  +    P+S  +T +T  ++T  SP        SP 
Sbjct: 1675 PPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPT 1734

Query: 949  CGPSPTTSSGSTCPRAVSATSLSNT 1023
              PSP T++ +T P   +++ L+ T
Sbjct: 1735 TTPSPPTTTMTTLPPTTTSSPLTTT 1759

 Score =  101 bits (251), Expect = 4e-20
 Identities = 130/476 (27%), Positives = 168/476 (34%), Gaps = 4/476 (0%)
 Frame = +1

Query: 10   PRRPLLRPRPARLHRRRRPTATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSAC 189
            P  P   P P        P  T PS          PP   + S P T TT P LP T+  
Sbjct: 1399 PSPPTTTPSPPPTTTTTLPPTTTPSPP--TTTTTTPPPTTTPSPPITTTTTP-LPTTTPS 1455

Query: 190  PRLDLIR*PASTRLLSAGTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRR 369
            P +     P  T   S  T T +       +PS PT TT T    P PT  P+P   +  
Sbjct: 1456 PPISTTTTPPPTTTPSPPTTTPSP---PTTTPSPPTTTTTT----PPPTTTPSPPMTTPI 1508

Query: 370  WRPSALAAPTSSRSRTRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRW 549
              P+         S T  PPT +         P P    T T P TT  S  TT      
Sbjct: 1509 TPPA---------STTTLPPTTT---------PSPPTTTTTTPPPTTTPSPPTT------ 1544

Query: 550  CRCLRLWAPRRPSRPPPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSASTPPT 729
                       P  PP +     P T P+P         P TT  TT   P+ + S P T
Sbjct: 1545 ----------TPITPPTSTTTLPPTTTPSP---------PPTT--TTTPPPTTTPSPPTT 1583

Query: 730  STSTPAAWPTATAGATTACRPCSPPRASRPPAATWSAGTL-PR*PASSFSTCSTRRAST* 906
            +T +P    T T   TT   P +    + PP  T S  T  P  P +S +T       + 
Sbjct: 1584 TTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPS- 1642

Query: 907  ASPATPRTPPSSP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTISRPLWLW-TPPRA 1083
              P T  TPP  P   PSP T++  + P   + T    T      T S P+    +PP  
Sbjct: 1643 PPPTTTTTPP--PTTTPSPPTTTTPSPPITTTTTPPPTT------TPSSPITTTPSPPTT 1694

Query: 1084 RRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATPPSPTSSACHGPTT 1263
                P     P++              +P+  T P+PP           PT+     PTT
Sbjct: 1695 TMTTPSPTTTPSSPITT--------TTTPSSTTTPSPP-----------PTTMTTPSPTT 1735

Query: 1264 I*SCRRWRGATAGVTTPACPRPST-ARPTACPSTRSASTTSRSSRPPATSC-CTSW 1425
              S       T   TT + P  +T   P+  P T S  +T+  + P    C  T W
Sbjct: 1736 TPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGW 1791

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 101/382 (26%), Positives = 143/382 (36%), Gaps = 2/382 (0%)
 Frame = +1

Query: 271  CRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTASAPPS 450
            C  +PS PT T     P+P PT        +    P+   +P ++ + T  P T  +PP 
Sbjct: 1395 CITTPSPPTTT-----PSPPPTT-------TTTLPPTTTPSPPTTTTTTPPPTTTPSPPI 1442

Query: 451  CWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPTA 630
              +  P P+     T PS    + TT                     PPP      P T 
Sbjct: 1443 TTTTTPLPT-----TTPSPPISTTTT---------------------PPPTTTPSPPTTT 1476

Query: 631  PAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRA 810
            P+P +  PS   P TT+ TT   P+ + S P T+  TP A  T T   TT   P +    
Sbjct: 1477 PSPPTTTPS---PPTTTTTTPP-PTTTPSPPMTTPITPPA-STTTLPPTTTPSPPTTTTT 1531

Query: 811  SRPPAATWSAGTL-PR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTC 987
            + PP  T S  T  P  P +S +T           P T  +PP +    P PTT+     
Sbjct: 1532 TPPPTTTPSPPTTTPITPPTSTTTLP---------PTTTPSPPPTTTTTPPPTTTPSPPT 1582

Query: 988  PRAVSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAAS 1167
                S  +++ T+     T S P    T P      P     P    P           +
Sbjct: 1583 TTTPSPPTITTTTPPPTTTPSPPTTTTTTPP-----PTTTPSPPTTTPI----------T 1627

Query: 1168 PACATAPTPP*QYAWRATP-PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARP 1344
            P  +T   PP       TP P PT++    PTT  S       +  +TT   P P+T   
Sbjct: 1628 PPTSTTTLPP-----TTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPS 1682

Query: 1345 TACPSTRSASTTSRSSRPPATS 1410
            +   +T S  TT+ ++  P T+
Sbjct: 1683 SPITTTPSPPTTTMTTPSPTTT 1704

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 75/261 (28%), Positives = 104/261 (39%), Gaps = 6/261 (2%)
 Frame = +1

Query: 646  RCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRASRPPA 825
            R   CW P     TT + P+ + S PP +T+T    PT T    T      PP  +  P 
Sbjct: 1385 RVNCCW-PMDKCITTPSPPTTTPS-PPPTTTTTLP-PTTTPSPPTTTTTTPPPTTTPSPP 1441

Query: 826  ATWSAGTLP-R*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTCPRAVS 1002
             T +   LP   P+   ST +T   +T  +P+ P T PS P   PSP T++ +T P   +
Sbjct: 1442 ITTTTTPLPTTTPSPPISTTTTPPPTT--TPSPPTTTPSPPTTTPSPPTTTTTTPPPTTT 1499

Query: 1003 ATSLSNTSF--HLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPAC 1176
             +    T      + T   P    +PP      P     P    P+  P   P   +P  
Sbjct: 1500 PSPPMTTPITPPASTTTLPPTTTPSPPTTTTTTP-----PPTTTPSP-PTTTP--ITPPT 1551

Query: 1177 ATAPTPP*QYAWRATP-PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARPTAC 1353
            +T   PP       TP P PT++    PTT          T    T   P P T   T  
Sbjct: 1552 STTTLPP-----TTTPSPPPTTTTTPPPTT----------TPSPPTTTTPSPPTITTTTP 1596

Query: 1354 PSTRSAS--TTSRSSRPPATS 1410
            P T + S  TT+ ++ PP T+
Sbjct: 1597 PPTTTPSPPTTTTTTPPPTTT 1617

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 111/425 (26%), Positives = 154/425 (36%), Gaps = 48/425 (11%)
 Frame = +1

Query: 271  CRASPSAPTLTTWTRRPAPAP-----TAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTA 435
            C   P+  T TT T  P P P     T  P PT  S +  P+ L APT +   T    T 
Sbjct: 1878 CVTQPTTMTTTT-TENPTPTPITTTTTVTPTPTPTSTQ-SPNGLQAPTPTPISTTTTVT- 1934

Query: 436  SAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGC 615
                      P P+   T T P+TT  + TTT                    P P P G 
Sbjct: 1935 ----------PTPTPTGTQT-PTTTPITTTTT------------------VTPTPTPTGT 1965

Query: 616  GPPTA------------PAPASRCPSCWRPSTTSATTAASPSCSASTPPT-----STSTP 744
              PT             P P S   +   P TT+ T  A+P+ + +  PT     +T+T 
Sbjct: 1966 QTPTTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTV 2025

Query: 745  AAWPTATAGAT-----TACRPCSPPRASRPPAATWSAGTLPR*PASSFSTCSTRRAST*- 906
               PT T G+T     T+  P +    S PP  + +  T      SS  T ST   ST  
Sbjct: 2026 TPTPTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRS--TSSPLTESTTLLSTLP 2083

Query: 907  --------ASPATPRTPPS-------SP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLAR 1041
                    A P+TP  P +       SP   PS TTS   T  R  +  S S  +    +
Sbjct: 2084 PAIEMTSTAPPSTPTAPTTTSGGHTLSP--PPSTTTSPPGTPTRGTTTGSSSAPTPSTVQ 2141

Query: 1042 TISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASP--ACATAPT--PP*QYA 1209
            T +   W  TP          L+ P+ +   R    RP+ +S    C    T   P +  
Sbjct: 2142 TTTTSAWTPTPTP--------LSTPSII---RTTGLRPYPSSVLICCVLNDTYYAPGEEV 2190

Query: 1210 WRATPPSPTSSACHGPTTI*SCRRWRGATAGVTTPA-CPRPSTARPTACPSTRSASTTSR 1386
            +  T        C+      SC       +  +TP+  P PS + PT    + + S  + 
Sbjct: 2191 YNGT----YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP 2246

Query: 1387 SSRPP 1401
             ++PP
Sbjct: 2247 GTKPP 2251

 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 126/550 (22%), Positives = 177/550 (31%), Gaps = 65/550 (11%)
 Frame = +1

Query: 19   PLLRPRPARLHRRRRPTATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRL 198
            P   P P        P  T PS          PP   + S P T TT P    T + P  
Sbjct: 1637 PTTTPSPPPTTTTTPPPTTTPS----------PPTTTTPSPPITTTTTPPPTTTPSSPIT 1686

Query: 199  DLIR*PASTRLLSAGTRTANL*GICRASPSAPTLTTWT----RRPAPAPTAWPAPTWCSR 366
                 P +T    + T T          PS+P  TT T      P+P PT    P+    
Sbjct: 1687 TTPSPPTTTMTTPSPTTT----------PSSPITTTTTPSSTTTPSPPPTTMTTPS---- 1732

Query: 367  RWRPSALAAPTSSRSRTRAPPTASAP----PSCWSRCPRPSRRWTWTLPSTTRRSATT-T 531
               P+   +P ++   T  P T S+P    P   S  P     ++ T P+T        T
Sbjct: 1733 ---PTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWT 1789

Query: 532  GW*----PRWCR-----------CLRLWAPR---RPSRPPPAPAGCGPPTAPAPAS---- 645
            GW     P + +           C   WA     R +  P  P G    T     S    
Sbjct: 1790 GWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLI 1849

Query: 646  ------------------------RCPSC-WRPSTTSATTAASPSCSASTPPTSTSTPAA 750
                                    +C  C  +P+T + TT  +P+ +  T  T+T TP  
Sbjct: 1850 CKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPTPITT-TTTVTPTP 1908

Query: 751  WPTATAGATTACRPCSPPRASRPPAATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRT 930
             PT+T            P   + P  T         P S+ +T +     T     TP T
Sbjct: 1909 TPTST----------QSPNGLQAPTPT---------PISTTTTVTPTPTPT--GTQTPTT 1947

Query: 931  PPSSP*CGPSPT-TSSGSTCPRAVSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRL 1107
             P +     +PT T +G+  P  V  T+          T   P    T  ++    P   
Sbjct: 1948 TPITTTTTVTPTPTPTGTQTPTTVLITT---------TTTMTPTPTPTSTKSTTVTPITT 1998

Query: 1108 ARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATPPSPTSSACHGPTTI*SCRRWR 1287
                   P     + P     +  T  TP          P+PT+ +  GP T  S     
Sbjct: 1999 TTTVTATPTPTGTQTPTMIPISTTTTVTP---------TPTPTTGST-GPPTHTSTAPIA 2048

Query: 1288 GATAGVTTPACPRPSTARPTACPSTRSASTTS--------RSSRPPATSCCTSWRRLA*V 1443
              T     P    P T+R T+ P T S +  S         S+ PP+T    +       
Sbjct: 2049 ELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHT 2108

Query: 1444 LRRPSSTSTA 1473
            L  P ST+T+
Sbjct: 2109 LSPPPSTTTS 2118

 Score = 50.4 bits (119), Expect = 8e-05
 Identities = 78/334 (23%), Positives = 116/334 (34%), Gaps = 12/334 (3%)
 Frame = +1

Query: 451  CWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPTA 630
            C     +P+   T T  + T    TTT             +P     P P P        
Sbjct: 1875 CCECVTQPTTMTTTTTENPTPTPITTTTTVTPTPTPTSTQSPNGLQAPTPTPISTTTTVT 1934

Query: 631  PAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRA 810
            P P         P+TT  TT  + + + +  PT T TP    T     TT   P   P +
Sbjct: 1935 PTPTPT--GTQTPTTTPITT--TTTVTPTPTPTGTQTPT---TVLITTTTTMTPTPTPTS 1987

Query: 811  SRPPAATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTCP 990
            ++    T         P ++ +T +     T     T     ++    P+PT ++GST P
Sbjct: 1988 TKSTTVT---------PITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPTPTTGSTGP 2038

Query: 991  RAVSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PR-RRPWAAS 1167
                  + ++T+     T S P    + P+  R     L     +     P       A 
Sbjct: 2039 -----PTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAP 2093

Query: 1168 PACATAPTPP*QYAWRATPPSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTAR-- 1341
            P+  TAPT        + PPS T+S    PT        RG T G  + + P PST +  
Sbjct: 2094 PSTPTAPTTTSGGHTLSPPPSTTTSPPGTPT--------RGTTTG--SSSAPTPSTVQTT 2143

Query: 1342 ------PTACPSTRSASTTSRSSRPPATS---CC 1416
                  PT  P +  +   +   RP  +S   CC
Sbjct: 2144 TTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICC 2177

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 75/299 (25%), Positives = 104/299 (34%), Gaps = 13/299 (4%)
 Frame = +1

Query: 31   PRPARLHRRRRPTATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR 210
            P P  +      T T   +S + P     P P   S   T T  P    T          
Sbjct: 1893 PTPTPITTTTTVTPTPTPTSTQSPNGLQAPTPTPISTTTTVTPTPTPTGTQT-------- 1944

Query: 211  *PASTRLLSAGTRTANL*GICRASPSAPTLTTWTRR-PAPAPTAWPAPTWCSRRWRPSAL 387
             P +T + +  T T         +P+   +TT T   P P PT+  + T        +  
Sbjct: 1945 -PTTTPITTTTTVTPTPTPTGTQTPTTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVT 2003

Query: 388  AAPTSSRSRTRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSA-----TTTGW*PRWC 552
            A PT + ++T   PT     +  +  P P+     T P T   +A     TT+       
Sbjct: 2004 ATPTPTGTQT---PTMIPISTTTTVTPTPTPTTGSTGPPTHTSTAPIAELTTSN------ 2054

Query: 553  RCLRLWAPRRPSRPPPAPAGCGPPTAPA-------PASRCPSCWRPSTTSATTAASPSCS 711
                   P   S P  + +   P T          PA    S   PST +A T  S   +
Sbjct: 2055 ------PPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHT 2108

Query: 712  ASTPPTSTSTPAAWPTATAGATTACRPCSPPRASRPPAATWSAGTLPR*PASSFSTCST 888
             S PP++T++P   P  T G TT     S P  S     T SA T    P S+ S   T
Sbjct: 2109 LSPPPSTTTSPPGTP--TRGTTTG--SSSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRT 2163

 Score = 25.8 bits (55), Expect(2) = 5e-22
 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 5/26 (19%)
 Frame = +3

Query: 3    PSPP---PSPPPPSPR--PPAPPPTP 65
            PSPP   PSPPP +    PP   P+P
Sbjct: 1399 PSPPTTTPSPPPTTTTTLPPTTTPSP 1424

>gb|AAA59163.1| mucin
          Length = 1270

 Score =  105 bits (263), Expect = 2e-21
 Identities = 102/378 (26%), Positives = 144/378 (37%), Gaps = 1/378 (0%)
 Frame = +1

Query: 280  SPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTASAPPSCWS 459
            +PS P  TT T  P   P+    PT  +    P+   +P  + + T  P T  +PP   +
Sbjct: 780  TPSPPPTTTTTLPPTTTPSP---PTTTTTTPPPTTTPSPPITTTTTPLPTTTPSPPISTT 836

Query: 460  RCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPTAPAP 639
              P P+   T + P+TT    TTT   P             P    P+P    P T PA 
Sbjct: 837  TTPPPTT--TPSPPTTTPSPPTTTPSPPTTT------TTTPPPTTTPSPPMTTPITPPAS 888

Query: 640  ASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRASR- 816
             +  P    PS  + TT   P  +  +PPT+T  P   PT+T        P  PP  +  
Sbjct: 889  TTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTT--PITPPTSTTTLPPTTTPSPPPTTTTT 946

Query: 817  PPAATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTCPRA 996
            PP  T  +      P+    T +T   +T  SP T  T    P   PSP T++  T P +
Sbjct: 947  PPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTS 1006

Query: 997  VSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPAC 1176
             +    + T      T + P     PP      P        +     P      +SP  
Sbjct: 1007 TTTLPPTTTPSPPPTTTTTP-----PPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPI- 1060

Query: 1177 ATAPTPP*QYAWRATPPSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARPTACP 1356
             T P+PP       T PSPT++     TT          T   TT   P P+T    +  
Sbjct: 1061 TTTPSPP---TTTMTTPSPTTTPSSPITTT--------TTPSSTTTPSPPPTTMTTPSPT 1109

Query: 1357 STRSASTTSRSSRPPATS 1410
            +T S  TT+ ++ PP T+
Sbjct: 1110 TTPSPPTTTMTTLPPTTT 1127

 Score =  102 bits (254), Expect(2) = 5e-22
 Identities = 91/325 (28%), Positives = 129/325 (39%), Gaps = 6/325 (1%)
 Frame = +1

Query: 67   TATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDL-IR*PASTRLLSAG 243
            T T P ++   P    P  P +   P T TT    P T+  P +   I  PAST  L   
Sbjct: 836  TTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPMTTPITPPASTTTLPPT 895

Query: 244  TRTANL*GICRASPSAPTLTTWT----RRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRS 411
            T           +PS PT TT T      P+P  T    P   +    P+   +P  + +
Sbjct: 896  T-----------TPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTT 944

Query: 412  RTRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSR 591
             T  P T  +PP+  +  P P+   T   P+TT    TTT   P             P  
Sbjct: 945  TTPPPTTTPSPPTTTTPSP-PTITTTTPPPTTTPSPPTTTTTTP-------------PPT 990

Query: 592  PPPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAG 771
              P+P    P T P   +  P    PS    TT   P  +  +PPT+T TP+   T T  
Sbjct: 991  TTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTT-TPSPPITTTTT 1049

Query: 772  ATTACRPCSPPRAS-RPPAATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP* 948
                  P SP   +  PP  T +  +    P+S  +T +T  ++T  SP        SP 
Sbjct: 1050 PPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPT 1109

Query: 949  CGPSPTTSSGSTCPRAVSATSLSNT 1023
              PSP T++ +T P   +++ L+ T
Sbjct: 1110 TTPSPPTTTMTTLPPTTTSSPLTTT 1134

 Score =  101 bits (251), Expect = 4e-20
 Identities = 130/476 (27%), Positives = 168/476 (34%), Gaps = 4/476 (0%)
 Frame = +1

Query: 10   PRRPLLRPRPARLHRRRRPTATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSAC 189
            P  P   P P        P  T PS          PP   + S P T TT P LP T+  
Sbjct: 774  PSPPTTTPSPPPTTTTTLPPTTTPSPP--TTTTTTPPPTTTPSPPITTTTTP-LPTTTPS 830

Query: 190  PRLDLIR*PASTRLLSAGTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRR 369
            P +     P  T   S  T T +       +PS PT TT T    P PT  P+P   +  
Sbjct: 831  PPISTTTTPPPTTTPSPPTTTPSP---PTTTPSPPTTTTTT----PPPTTTPSPPMTTPI 883

Query: 370  WRPSALAAPTSSRSRTRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRW 549
              P+         S T  PPT +         P P    T T P TT  S  TT      
Sbjct: 884  TPPA---------STTTLPPTTT---------PSPPTTTTTTPPPTTTPSPPTT------ 919

Query: 550  CRCLRLWAPRRPSRPPPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSASTPPT 729
                       P  PP +     P T P+P         P TT  TT   P+ + S P T
Sbjct: 920  ----------TPITPPTSTTTLPPTTTPSP---------PPTT--TTTPPPTTTPSPPTT 958

Query: 730  STSTPAAWPTATAGATTACRPCSPPRASRPPAATWSAGTL-PR*PASSFSTCSTRRAST* 906
            +T +P    T T   TT   P +    + PP  T S  T  P  P +S +T       + 
Sbjct: 959  TTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPS- 1017

Query: 907  ASPATPRTPPSSP*CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTISRPLWLW-TPPRA 1083
              P T  TPP  P   PSP T++  + P   + T    T      T S P+    +PP  
Sbjct: 1018 PPPTTTTTPP--PTTTPSPPTTTTPSPPITTTTTPPPTT------TPSSPITTTPSPPTT 1069

Query: 1084 RRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATPPSPTSSACHGPTT 1263
                P     P++              +P+  T P+PP           PT+     PTT
Sbjct: 1070 TMTTPSPTTTPSSPITT--------TTTPSSTTTPSPP-----------PTTMTTPSPTT 1110

Query: 1264 I*SCRRWRGATAGVTTPACPRPST-ARPTACPSTRSASTTSRSSRPPATSC-CTSW 1425
              S       T   TT + P  +T   P+  P T S  +T+  + P    C  T W
Sbjct: 1111 TPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGW 1166

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 101/382 (26%), Positives = 143/382 (36%), Gaps = 2/382 (0%)
 Frame = +1

Query: 271  CRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTASAPPS 450
            C  +PS PT T     P+P PT        +    P+   +P ++ + T  P T  +PP 
Sbjct: 770  CITTPSPPTTT-----PSPPPTT-------TTTLPPTTTPSPPTTTTTTPPPTTTPSPPI 817

Query: 451  CWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPTA 630
              +  P P+     T PS    + TT                     PPP      P T 
Sbjct: 818  TTTTTPLPT-----TTPSPPISTTTT---------------------PPPTTTPSPPTTT 851

Query: 631  PAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRA 810
            P+P +  PS   P TT+ TT   P+ + S P T+  TP A  T T   TT   P +    
Sbjct: 852  PSPPTTTPS---PPTTTTTTPP-PTTTPSPPMTTPITPPA-STTTLPPTTTPSPPTTTTT 906

Query: 811  SRPPAATWSAGTL-PR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTC 987
            + PP  T S  T  P  P +S +T           P T  +PP +    P PTT+     
Sbjct: 907  TPPPTTTPSPPTTTPITPPTSTTTLP---------PTTTPSPPPTTTTTPPPTTTPSPPT 957

Query: 988  PRAVSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAAS 1167
                S  +++ T+     T S P    T P      P     P    P           +
Sbjct: 958  TTTPSPPTITTTTPPPTTTPSPPTTTTTTPP-----PTTTPSPPTTTPI----------T 1002

Query: 1168 PACATAPTPP*QYAWRATP-PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARP 1344
            P  +T   PP       TP P PT++    PTT  S       +  +TT   P P+T   
Sbjct: 1003 PPTSTTTLPP-----TTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPS 1057

Query: 1345 TACPSTRSASTTSRSSRPPATS 1410
            +   +T S  TT+ ++  P T+
Sbjct: 1058 SPITTTPSPPTTTMTTPSPTTT 1079

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 75/261 (28%), Positives = 104/261 (39%), Gaps = 6/261 (2%)
 Frame = +1

Query: 646  RCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRASRPPA 825
            R   CW P     TT + P+ + S PP +T+T    PT T    T      PP  +  P 
Sbjct: 760  RVNCCW-PMDKCITTPSPPTTTPS-PPPTTTTTLP-PTTTPSPPTTTTTTPPPTTTPSPP 816

Query: 826  ATWSAGTLP-R*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTCPRAVS 1002
             T +   LP   P+   ST +T   +T  +P+ P T PS P   PSP T++ +T P   +
Sbjct: 817  ITTTTTPLPTTTPSPPISTTTTPPPTT--TPSPPTTTPSPPTTTPSPPTTTTTTPPPTTT 874

Query: 1003 ATSLSNTSF--HLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPAC 1176
             +    T      + T   P    +PP      P     P    P+  P   P   +P  
Sbjct: 875  PSPPMTTPITPPASTTTLPPTTTPSPPTTTTTTP-----PPTTTPSP-PTTTP--ITPPT 926

Query: 1177 ATAPTPP*QYAWRATP-PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARPTAC 1353
            +T   PP       TP P PT++    PTT          T    T   P P T   T  
Sbjct: 927  STTTLPP-----TTTPSPPPTTTTTPPPTT----------TPSPPTTTTPSPPTITTTTP 971

Query: 1354 PSTRSAS--TTSRSSRPPATS 1410
            P T + S  TT+ ++ PP T+
Sbjct: 972  PPTTTPSPPTTTTTTPPPTTT 992

 Score = 25.8 bits (55), Expect(2) = 5e-22
 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 5/26 (19%)
 Frame = +3

Query: 3   PSPP---PSPPPPSPR--PPAPPPTP 65
           PSPP   PSPPP +    PP   P+P
Sbjct: 774 PSPPTTTPSPPPTTTTTLPPTTTPSP 799

>gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]
          Length = 1325

 Score =  106 bits (264), Expect = 1e-21
 Identities = 111/456 (24%), Positives = 214/456 (46%), Gaps = 4/456 (0%)
 Frame = +1

Query: 67   TATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLLSAGT 246
            +++APSSS   P+A++   P S+S   +A++      +S+ P       P+S    S+  
Sbjct: 690  SSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS----SSSA 745

Query: 247  RTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAP 426
             +A+      +S SAP+ ++ +   AP+ ++  AP+  S     S+ +AP++S S   + 
Sbjct: 746  PSASSSSAPSSSSSAPSASSSS---APSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 802

Query: 427  PTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAP 606
             ++SAP +  S  P  S     + PS +  SA ++             AP   S   P+ 
Sbjct: 803  SSSSAPSASSSSAPSSSS----SAPSASSSSAPSSS----------SSAPSASSSSAPSS 848

Query: 607  AGCGP----PTAPAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGA 774
            +   P     +AP+ +S  PS    S  S++++A PS S+S+ P+S+S+ A  P+A++ +
Sbjct: 849  SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA-PSASSSSAPSSSSSSA--PSASSSS 905

Query: 775  TTACRPCSPPRASRPPAATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CG 954
              +    S P AS   A + S+ + P   +SS  + S+  A + +S + P +  S+P   
Sbjct: 906  APSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSAS 965

Query: 955  PSPTTSSGSTCPRAVSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRLARPAAVAPA 1134
             S   SS S+ P A S+++ S++S       S      + P +    P   +  A  + +
Sbjct: 966  SSSAPSSSSSAPSASSSSAPSSSSSSAPSASSS-----SAPSSSSSAPSASSSSAPSSSS 1020

Query: 1135 R*PRRRPWAASPACATAPTPP*QYAWRATPPSPTSSACHGPTTI*SCRRWRGATAGVTTP 1314
              P     +A  + ++AP+     A  ++  +P++S+   P++  S      +    ++ 
Sbjct: 1021 SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS------SAPSASSS 1074

Query: 1315 ACPRPSTARPTACPSTRSASTTSRSSRPPATSCCTS 1422
            + P  S++ P+A  S+  +S++S  S   +   C S
Sbjct: 1075 SAPSSSSSAPSASSSSAPSSSSSFLSGSGSDGGCHS 1110

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 100/405 (24%), Positives = 185/405 (44%), Gaps = 17/405 (4%)
 Frame = +1

Query: 310  TRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTASAPPSCWSRCPRPSR--- 480
            T   + AP+A  +    S    PSA ++   S S +    ++S+ PS  S  P  S    
Sbjct: 664  TESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSA 723

Query: 481  -RWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPTAPAPASRCPS 657
               + + PS +  SA ++             AP   S  P A +   P ++ + A    S
Sbjct: 724  PSSSSSAPSASSSSAPSSS--SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASS 781

Query: 658  CWRPSTT----SATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRASRPPA 825
               PS++    SA+++++PS S+S+ P+++S+ A  P++++ A +A    +P  +S  P+
Sbjct: 782  SSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSA--PSSSSSAPSASSSSAPSSSSSAPS 839

Query: 826  ATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPT-----TSSGSTCP 990
            A+ S+       A S S+ S   +S+ A  A+  + PSS    PS +     +SS S+ P
Sbjct: 840  ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAP 899

Query: 991  RAVSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASP 1170
             A S+++ S++S       S       P  +    P   +  ++ AP+      P A+S 
Sbjct: 900  SASSSSAPSSSSSSAPSASSSS----APSSSSSSAP---SASSSSAPSSSSSSAPSASSS 952

Query: 1171 AC----ATAPTPP*QYAWRATPPSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTA 1338
            +     ++AP+     A  ++  +P++S+   P++  S      +++   + +   PS +
Sbjct: 953  SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS-SSSAPSASSSSAPSSSSSAPSAS 1011

Query: 1339 RPTACPSTRSASTTSRSSRPPATSCCTSWRRLA*VLRRPSSTSTA 1473
              +A  S+ SA + S SS P ++S   S    A     PSS+S+A
Sbjct: 1012 SSSAPSSSSSAPSASSSSAPSSSSSAPS----ASSSSAPSSSSSA 1052

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 71/301 (23%), Positives = 141/301 (46%), Gaps = 12/301 (3%)
 Frame = +1

Query: 544  RWCRCL-RLWAPRR------PSRPPPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASP 702
            R+C CL   WA +        ++P    + C    A  P +        S++SA +A+S 
Sbjct: 624  RFCGCLPSTWADKNGVSMMITAQPELLASDCATENACKPETE-------SSSSAPSASSS 676

Query: 703  SCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRASRPPAATWSAGTLPR*PASSFSTC 882
            S S+S+    +++ ++ P++++ A +A    +P  +S  P+A+ S+       A S S+ 
Sbjct: 677  SASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS 736

Query: 883  STRRAST*ASPATPRTPPSSP*CGPSPT-----TSSGSTCPRAVSATSLSNTSFHLARTI 1047
            S   +S+ A  A+  + PSS    PS +     +SS S+ P A S+++ S++S   + + 
Sbjct: 737  SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS 796

Query: 1048 SRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPACATAPTPP*QYAWRATPP 1227
            S       P  +    P   +  A  + +  P     +A  + ++AP+     A  ++  
Sbjct: 797  SS-----APSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 851

Query: 1228 SPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARPTACPSTRSASTTSRSSRPPAT 1407
            +P++S+   P++         +    ++ + P  S++ P+A  S+ SA ++S SS P A+
Sbjct: 852  APSASSSSAPSS-------SSSAPSASSSSAPSSSSSAPSA--SSSSAPSSSSSSAPSAS 902

Query: 1408 S 1410
            S
Sbjct: 903  S 903

 Score = 40.8 bits (94), Expect = 0.063
 Identities = 52/226 (23%), Positives = 98/226 (43%), Gaps = 7/226 (3%)
 Frame = +1

Query: 67   TATAPSSSGRRPAAAAP---PRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLL- 234
            +++APSSS     +A+    P   S+S P  +++      +S+ P       P+S+    
Sbjct: 903  SSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAP 962

Query: 235  SAGTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSR 414
            SA + +A        S S+ +  + +   AP+ ++  AP+  S     S+ +AP+SS S 
Sbjct: 963  SASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA 1022

Query: 415  TRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRP 594
              A  ++S+ PS  S  P  S     +  S+   +++++             AP   S  
Sbjct: 1023 PSA--SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS-------------APSSSSSS 1067

Query: 595  PPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPS---CSASTP 723
             P+ +    P++ + A    S   PS++S+  + S S   C +  P
Sbjct: 1068 APSASSSSAPSSSSSAPSASSSSAPSSSSSFLSGSGSDGGCHSDVP 1113

>gb|AAA59875.1| mucin
          Length = 573

 Score =  105 bits (263), Expect = 2e-21
 Identities = 103/389 (26%), Positives = 149/389 (37%), Gaps = 9/389 (2%)
 Frame = +1

Query: 271  CRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSRTRAPPTASAPPS 450
            C  +PS PT T     P+P PT+       +    P+   +P ++ + T  P T  +PP 
Sbjct: 53   CITTPSPPTTT-----PSPPPTS-------TTTLPPTTTPSPPTTTTTTPPPTTTPSPPI 100

Query: 451  CWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSR-----PP---PAP 606
              +  P P+   +  + +TT    TTT   P          P  P+      PP   P+P
Sbjct: 101  TTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSP 160

Query: 607  AGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTAC 786
                P T PA  +  P    PS  + TT   P  +  +PPT+T  P   PT+T       
Sbjct: 161  PTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTT--PITPPTSTTTLPPTT 218

Query: 787  RPCSPPRASR-PPAATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSP 963
             P  PP  +  PP  T  +      P+    T +T   +T  SP T  T    P   PSP
Sbjct: 219  TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSP 278

Query: 964  TTSSGSTCPRAVSATSLSNTSFHLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*P 1143
             T++  T P + +    + T      T + P     PP      P        +     P
Sbjct: 279  PTTTPITPPTSTTTLPPTTTPSPPPTTTTTP-----PPTTTPSPPTTTTPSPPITTTTTP 333

Query: 1144 RRRPWAASPACATAPTPP*QYAWRATPPSPTSSACHGPTTI*SCRRWRGATAGVTTPACP 1323
                  +SP   T P+PP       T PSPT++     TT          T   TT   P
Sbjct: 334  PPTTTPSSPI-TTTPSPP---TTTMTTPSPTTTPSSPITTT--------TTPSSTTTPSP 381

Query: 1324 RPSTARPTACPSTRSASTTSRSSRPPATS 1410
             P+T    +  +T S  TT+ ++ PP T+
Sbjct: 382  PPTTMTTPSPTTTPSPPTTTMTTLPPTTT 410

 Score =  102 bits (253), Expect = 2e-20
 Identities = 95/340 (27%), Positives = 130/340 (37%), Gaps = 5/340 (1%)
 Frame = +1

Query: 19   PLLRPRPARLHRRRRPTATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRL 198
            P   P P        P  T PS     P     P   + S P T TT P    T + P  
Sbjct: 108  PTTTPSPPISTTTTPPPTTTPSP----PTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPTT 163

Query: 199  DLIR*PASTRLLSAGTRTANL*GICRASPSAPTLTTWT----RRPAPAPTAWPAPTWCSR 366
              I  PAST  L   T           +PS PT TT T      P+P  T    P   + 
Sbjct: 164  TPITPPASTTTLPPTT-----------TPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTT 212

Query: 367  RWRPSALAAPTSSRSRTRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PR 546
               P+   +P  + + T  P T  +PP+  +  P P+   T   P+TT    TTT   P 
Sbjct: 213  TLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSP-PTITTTTPPPTTTPSPPTTTTTTP- 270

Query: 547  WCRCLRLWAPRRPSRPPPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSASTPP 726
                        P    P+P    P T P   +  P    PS    TT   P  +  +PP
Sbjct: 271  ------------PPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPP 318

Query: 727  TSTSTPAAWPTATAGATTACRPCSPPRAS-RPPAATWSAGTLPR*PASSFSTCSTRRAST 903
            T+T TP+   T T        P SP   +  PP  T +  +    P+S  +T +T  ++T
Sbjct: 319  TTT-TPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTT 377

Query: 904  *ASPATPRTPPSSP*CGPSPTTSSGSTCPRAVSATSLSNT 1023
              SP        SP   PSP T++ +T P   +++ L+ T
Sbjct: 378  TPSPPPTTMTTPSPTTTPSPPTTTMTTLPPTTTSSPLTTT 417

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 123/462 (26%), Positives = 168/462 (35%), Gaps = 8/462 (1%)
 Frame = +1

Query: 64   PTATA---PSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSACPRLDLIR*PASTRLL 234
            PT T    P+S+   P    P  P +     T TTPP  P T+  P +     P  T   
Sbjct: 60   PTTTPSPPPTSTTTLPPTTTPSPPTT-----TTTTPP--PTTTPSPPITTTTTPPPT--- 109

Query: 235  SAGTRTANL*GICRASPSAPTLTTWTRRPAPAPTAWPAPTWCSRRWRPSALAAPTSSRSR 414
                           +PS P  TT T    P PT  P+P   +    P+   +P ++ + 
Sbjct: 110  --------------TTPSPPISTTTT----PPPTTTPSPPTTTPS-PPTTTPSPPTTTTT 150

Query: 415  TRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW*PRWCRCLRLWAPRRPSRP 594
            T  P T  +PP+     P  S   T TLP TT  S  TT                 P   
Sbjct: 151  TPPPTTTPSPPTTTPITPPAS---TTTLPPTTTPSPPTTT------------TTTPPPTT 195

Query: 595  PPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSASTPPTSTS-TPAAWPTATAG 771
             P+P    P T P   +  P    PS    TT   P  +  +PPT+T+ +P    T T  
Sbjct: 196  TPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPP 255

Query: 772  ATTACRPCSPPRASRPPAATWSAGTL-PR*PASSFSTCSTRRAST*ASPATPRTPPSSP* 948
             TT   P +    + PP  T S  T  P  P +S +T       +   P T  TPP  P 
Sbjct: 256  PTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPS-PPPTTTTTPP--PT 312

Query: 949  CGPSPTTSSGSTCPRAVSATSLSNTSFHLARTISRPLWLW-TPPRARRRRPCRLARPAAV 1125
              PSP T++  + P   + T    T      T S P+    +PP      P     P++ 
Sbjct: 313  TTPSPPTTTTPSPPITTTTTPPPTT------TPSSPITTTPSPPTTTMTTPSPTTTPSSP 366

Query: 1126 APAR*PRRRPWAASPACATAPTPP*QYAWRATPPSPTSSACHGPTTI*SCRRWRGATAGV 1305
                         +P+  T P+PP           PT+     PTT  S       T   
Sbjct: 367  ITT--------TTTPSSTTTPSPP-----------PTTMTTPSPTTTPSPPTTTMTTLPP 407

Query: 1306 TTPACPRPST-ARPTACPSTRSASTTSRSSRPPATSC-CTSW 1425
            TT + P  +T   P+  P T S  +T+  + P    C  T W
Sbjct: 408  TTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGW 449

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 110/408 (26%), Positives = 147/408 (35%), Gaps = 12/408 (2%)
 Frame = +1

Query: 10   PRRPLLRPRPARLHRRRRPTATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSAC 189
            P  P   P P        P  T PS          PP   + S P T TT P  P T+  
Sbjct: 57   PSPPTTTPSPPPTSTTTLPPTTTPSPP--TTTTTTPPPTTTPSPPITTTTTP-PPTTTPS 113

Query: 190  PRLDLIR*PASTRLLSAGTRTANL*GICRASPSAPTLTTWT----RRPAPAPTAWPAPTW 357
            P +     P  T   S  T T +       +PS PT TT T      P+P  T    P  
Sbjct: 114  PPISTTTTPPPTTTPSPPTTTPSP---PTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPA 170

Query: 358  CSRRWRPSALAAPTSSRSRTRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRSATTTGW 537
             +    P+   +P ++ + T  P T  +PP+     P  S   T TLP TT  S   T  
Sbjct: 171  STTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTS---TTTLPPTTTPSPPPT-- 225

Query: 538  *PRWCRCLRLWAPRRPSRPPPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCSAS 717
                        P   +  PP      PPT        P    PS  + TT   P  +  
Sbjct: 226  -------TTTTPPPTTTPSPPTTTTPSPPTITTTTP--PPTTTPSPPTTTTTTPPPTTTP 276

Query: 718  TPPTSTSTPAAWPTATAGATTACRPCSPP-RASRPPAATWSAGTLPR*PASSFSTCSTRR 894
            +PP  T+TP   PT+T        P  PP   + PP  T  +      P+   +T +T  
Sbjct: 277  SPP--TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPP 334

Query: 895  AST*ASPATPRT----PPSSP*CGPSPTTSSGSTCPRAVSATSLSNTS-FHLARTISRPL 1059
             +T  +P++P T    PP++    PSPTT+  S      + +S +  S      T   P 
Sbjct: 335  PTT--TPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPT 392

Query: 1060 WLWTPPRARRRR--PCRLARPAAVAPAR*PRRRPWAASPACATAPTPP 1197
               +PP        P   + P    P   P   P   SP   T PT P
Sbjct: 393  TTPSPPTTTMTTLPPTTTSSPLTTTPLP-PSITPPTFSPFSTTTPTTP 439

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 93/320 (29%), Positives = 125/320 (39%), Gaps = 15/320 (4%)
 Frame = +1

Query: 10   PRRPLLRPRPARLHRRRRPTATAPSSSGRRPAAAAPPRPWSASKPETATTPPFLPWTSAC 189
            P  P   P P        P  T PS     P    PP   +   P T  +PP    T+  
Sbjct: 135  PSPPTTTPSPPTTTTTTPPPTTTPSPPTTTPIT--PPASTTTLPPTTTPSPPTTTTTTPP 192

Query: 190  PRLDLIR*PASTRLLSAGTRTANL*GICRASPSAPTLTTW--TRRPAPAPTAWPAP-TWC 360
            P       P +T  ++  T T  L      SP   T TT   T  P+P  T  P+P T  
Sbjct: 193  PTTTPS--PPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTIT 250

Query: 361  SRRWRPSALAAPTSSRSRTRAPPTASAPPSCWSRCPRPSRRWTWTLPSTTRRS---ATTT 531
            +    P+   +P ++ + T  P T  +PP+     P  S   T TLP TT  S    TTT
Sbjct: 251  TTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTS---TTTLPPTTTPSPPPTTTT 307

Query: 532  GW*PRWCRCLRLWAPRRPSRPPPAPAGCGPPTAPAPASRCPSCWRPSTTSATTAASPSCS 711
               P          P   +  PP      PP    P+S   +   P TT+ TT  SP+ +
Sbjct: 308  TPPPTTTPS----PPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTP-SPTTT 362

Query: 712  ASTP------PTSTSTPAAWPT--ATAGATTACRPCSPPRASRPPAATWS-AGTLPR*PA 864
             S+P      P+ST+TP+  PT   T   TT   P +    + PP  T S   T P  P+
Sbjct: 363  PSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPS 422

Query: 865  SSFSTCSTRRAST*ASPATP 924
             +  T S    +T  +P  P
Sbjct: 423  ITPPTFSPFSTTTPTTPCVP 442

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 75/260 (28%), Positives = 104/260 (39%), Gaps = 5/260 (1%)
 Frame = +1

Query: 646  RCPSCWRPSTTSATTAASPSCSASTPPTSTSTPAAWPTATAGATTACRPCSPPRASRPPA 825
            R   CW P     TT + P+ + S PPTST+T     T +   TT   P  P     PP 
Sbjct: 43   RVNCCW-PMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTP-PPTTTPSPPI 100

Query: 826  ATWSAGTLPR*PASSFSTCSTRRAST*ASPATPRTPPSSP*CGPSPTTSSGSTCPRAVSA 1005
             T +       P+   ST +T   +T  +P+ P T PS P   PSP T++ +T P   + 
Sbjct: 101  TTTTTPPPTTTPSPPISTTTTPPPTT--TPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTP 158

Query: 1006 TSLSNTSF--HLARTISRPLWLWTPPRARRRRPCRLARPAAVAPAR*PRRRPWAASPACA 1179
            +  + T      + T   P    +PP      P     P    P+  P   P   +P  +
Sbjct: 159  SPPTTTPITPPASTTTLPPTTTPSPPTTTTTTP-----PPTTTPSP-PTTTP--ITPPTS 210

Query: 1180 TAPTPP*QYAWRATP-PSPTSSACHGPTTI*SCRRWRGATAGVTTPACPRPSTARPTACP 1356
            T   PP       TP P PT++    PTT          T    T   P P T   T  P
Sbjct: 211  TTTLPP-----TTTPSPPPTTTTTPPPTT----------TPSPPTTTTPSPPTITTTTPP 255

Query: 1357 STRSAS--TTSRSSRPPATS 1410
             T + S  TT+ ++ PP T+
Sbjct: 256  PTTTPSPPTTTTTTPPPTTT 275



EST assemble image


clone accession position
1 MXL071h06_r BP097211 1 344
2 MXL099f03_r BP098816 25 407
3 MXL027b11_r BP094680 62 308
4 MXL039b10_r BP095272 108 600
5 HCL035c05_r AV641521 116 626
6 MXL036d12_r BP095137 121 492
7 MXL028e04_r BP094738 123 372
8 MXL074g10_r BP097385 126 456
9 MXL010h04_r BP093608 126 407
10 MXL059a06_r BP096454 130 525
11 MXL066g09_r BP096904 144 629
12 MXL014d08_r BP093830 147 591
13 MXL086c11_r BP098062 248 385
14 MXL072g10_r BP097270 248 630
15 HCL051e08_r AV642424 261 754
16 LCL015f02_r AV626798 281 723
17 MXL041c07_r BP095403 417 789
18 LCL044g02_r AV628626 426 691
19 MXL015c06_r BP093896 488 727
20 LCL047d11_r AV628810 489 944
21 LCL026e06_r AV627427 501 858
22 MXL008h02_r BP093471 502 956
23 LCL001a05_r AV626010 525 1028
24 HCL075h11_r AV643783 567 980
25 MXL060h01_r BP096565 608 986
26 CL01c07_r AV393339 697 1219
27 LCL031g06_r AV627768 699 973
28 MXL023a03_r BP094434 713 1087
29 MXL050f10_r BP095991 781 1170
30 MXL047d05_r BP095785 808 1290
31 LCL013e03_r AV626674 837 1305
32 HCL093d09_r AV644763 864 1290
33 HCL016b04_r AV640426 884 1098
34 HCL016b06_r AV640428 887 1290
35 CL65f03_r AV396585 912 1385
36 LCL032a12_r AV627790 1003 1492




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research