KCC000015A_c05
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000015A_C05 KCC000015A_c05
GTGGCAAGTTGCTCTTCAACTAGCAAAGATGGCCGCCGCCATTCCTATGGTTGAGGTTCA
CAGCATTGAGACGGGCGAGAAGGCGGCCCAGGTCGCCCTCCCCGGCCGTCTTCACCGGCG
CCCATCCGCCCGGATATCGTGCGCAGCCATCCACACGCAACATGGCGAAGAACAACGCGC
CAGGCCGTACGCCGCTGTTCATGAAGGCCGGCCACCGAGACCGCTGCCGAGTCTTGGGGC
ACTGGTCGCGCCGTGTCGCGTATTCCCCGTGTGCCCGTGTGGCTGGTACCCACCAGCGCC
GGCCAGGGTGCCTTCGGCAACATGTGCCGCGGTGGTCGCATGTTCGCCCCACACCAAGGT
GTGGCGCCGCTGGCACCGCAAGATCAACGTGAACCAGAAGCGCTACGCCGTGGTGTCCGC
CCTGGCGGCCTCGGCTCTGCCCGCTCTGGTCATGGCTCGCGGCCACAAGATTGAGCAGGT
GCCCATGGTGCCCCTGGTCCTGGACGACGCCGTGGAGGGCGTGAAGAAGACCTCGAAGGC
GCTGGAGATCCTGAAGAAGATCGGCGCCCTGCCCGATGTGGAGAAGAGCAAGGACTCCAA
GTCGCTGCGCGCCGGCAAGGGCAAGATGCGCAACCGGCGTTACGTGATGCGCAAGGGCCC
CCTGGTTGTCTTCGCCAACGACGAGGGCATCTCCAAGGCCTTCCGCAACCTGCCCGGCGT
GGAGGTGACCTCCGTGGACCGCCTGAACCTGCTGCAGCTGGCCCCCGGCGGCCACCTGGG
CCGCTTCTGCATCTGGTCCAAGTCGGCCTTCGAGAAGCTGGACAAGGTGTTCGGCACCGA
CACCACCGAGAGCGAGCAGAAGAAGGGCTACAAGCTGCCCCGCGCCTGCATGGCCAACGG
CGACCTGGCCCGCCTGATCAACAGCGACGAGATCCAGTCGGCTGTCCGGCCCGCCAAGAG
CGCCGGCCCCAAGCACGCGCCGCTCAAGAAGAACCCCCTGCGCAACCTGGGCGCCATGCT
CAAGCTCAACCCCTACGCCAAGGTGGCCCGCCGCGTGGAGATCACCCGCTCCACCAAGAA
GGCCGCCAAGCGCAGCGAGAAGCTGGCCAAGATCGCCAAGGGCGAGAAGACCGGCGGCCA
GAAGGACAAGGCCATCAAGGCCATCGGCAAGAAGTTCTACAAGAACATGCTGGTGGAGTC
GGACTACGCCGGCGACGACTACGACCTGTTCGCCCGCTGGATCACCGTGCAGAAGCAGAC
CAAGACCGCCTAAACGGCGTCGCCCCTGGAAAGCTTGCCGGCGACAGGCCCTGCGTCTGG
CGCTACTGTCGGAGAATGATGATGGGTTTTGTGCTTTCGCTGCCGTCCAGGCTTTTGCGT
CGTGTGGCCGCGGTTGGGGTTTGCGTCTCGGCGGGGGCTGGGGTCCGCGGGCTCTGGCGT
CTGCTTGGGGCGCTCTGCCGCCGTGGGCGCACGGCGCGCGGGCTGTTTGGGCCGATGGGG
GGCTGGTGCCGGGCCGCAGGCTGAGGCGCTAGCAGCTGCTGTGTTTTGTTTAGTATGTGT
GTGCACGCGGTTGGCAACCTGGTCAGGCGAGACAATCTGCTCCTATTGCAAATGCGCGTG
AGGAACGCACGCGTGGTGCTCAAAGCACGGCGCCTCCGCTGAGCTCGAGGCGAGGGGTCC
TTGGCCACAACTTTGTGTAAAAGGATCTTGGCGTTTCCAAAGGTCACATAGGGGCCCGGG
GCGGATTGGCATGCTTCGAGGGTGTAACATGAAGTAAGGaaaaaaaaaaaaaaaaaaaaa
aaaaaaaaaaaaaaaaaactcgagacctcgtgc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000015A_C05 KCC000015A_c05
         (1833 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAA78600.1| 60S ribosomal protein L4 [Chlamydomonas sp. HS-5]     446  e-138
dbj|BAC83047.1| putative 60S ribosomal protein L4/L1 [Oryza sati...   319  e-103
sp|Q9XF97|RL4_PRUAR 60S ribosomal protein L4 (L1) gi|4887131|gb|...   366  e-100
gb|AAM65510.1| 60S ribosomal protein L4-B (L1) [Arabidopsis thal...   358  2e-97
ref|NP_187574.1| 60S ribosomal protein L4/L1 (RPL4A) [Arabidopsi...   357  3e-97

>dbj|BAA78600.1| 60S ribosomal protein L4 [Chlamydomonas sp. HS-5]
          Length = 363

 Score =  446 bits (1147), Expect(2) = e-138
 Identities = 219/297 (73%), Positives = 246/297 (82%)
 Frame = +2

Query: 353  TKVWRRWHRKINVNQKRYAVVSALAASALPALVMARGHKIEQVPMVPLVLDDAVEGVKKT 532
            TK WRRWHRK+N+ QKR+AV SALAASALP+LVMARGH+IEQVP VPLVL DAVE V KT
Sbjct: 62   TKTWRRWHRKVNLTQKRHAVASALAASALPSLVMARGHRIEQVPEVPLVLSDAVESVSKT 121

Query: 533  SKALEILKKIGALPDVEKSKDSKSLRAGKGKMRNRRYVMRKGPLVVFANDEGISKAFRNL 712
            SKALEILKKIGA PDVEK+K SK LR GKGKMRNRRY +RKGPL+VFAND GIS+AFRNL
Sbjct: 122  SKALEILKKIGAAPDVEKAKASKQLRRGKGKMRNRRYTLRKGPLIVFANDSGISRAFRNL 181

Query: 713  PGVEVTSVDRLNLLQLAPGGHLGRFCIWSKSAFEKLDKVFGTDTTESEQKKGYKLPRACM 892
             GVEVTSVD LNLLQLAPGGH+GRFC+W+KSAF+KLD +FGT T  SE KKGYKLPRACM
Sbjct: 182  TGVEVTSVDHLNLLQLAPGGHMGRFCVWTKSAFDKLDSIFGTYTKPSEVKKGYKLPRACM 241

Query: 893  ANGDLARLINSDEIQSAVRPAKSAGPKHAPLKKNPLRNLGAMLKLNPYAKVARRVEITRS 1072
             N DL RLINSDEIQS VRPAK    KHAPLKKNPL+NLGAMLKLNPYAK   R E+  S
Sbjct: 242  TNSDLTRLINSDEIQSVVRPAKKLTTKHAPLKKNPLKNLGAMLKLNPYAKAQLRREVLVS 301

Query: 1073 TKKAAKRSEKLAKIAKGEKTGGQKDKAIKAIGKKFYKNMLVESDYAGDDYDLFARWI 1243
             K+A  R EKLA +  G+  G +K    KA+GKKFYK M+V+SDY G+DYD F++W+
Sbjct: 302  EKRAVARQEKLAAMRAGKSVGPKKSAEQKALGKKFYKQMIVDSDYKGEDYDEFSKWL 358

 Score = 70.9 bits (172), Expect(2) = e-138
 Identities = 36/45 (80%), Positives = 37/45 (82%)
 Frame = +1

Query: 217 ETAAESWGTGRAVSRIPRVPVWLVPTSAGQGAFGNMCRGGRMFAP 351
           +TAAESWGTGRAVSRIPRVP       AGQ AFGNMCRGGRMFAP
Sbjct: 18  QTAAESWGTGRAVSRIPRVPGG-GTHRAGQAAFGNMCRGGRMFAP 61

>dbj|BAC83047.1| putative 60S ribosomal protein L4/L1 [Oryza sativa (japonica
            cultivar-group)]
          Length = 405

 Score =  319 bits (817), Expect(2) = e-103
 Identities = 160/300 (53%), Positives = 220/300 (73%), Gaps = 1/300 (0%)
 Frame = +2

Query: 353  TKVWRRWHRKINVNQKRYAVVSALAASALPALVMARGHKIEQVPMVPLVLDDAVEGVKKT 532
            TK WR+WHR++NV+ +R AV SALAA+++P+LV+ARGH+IE VP +PLV+ D+ E ++KT
Sbjct: 109  TKTWRKWHRRVNVHLRRVAVASALAATSVPSLVLARGHRIETVPELPLVISDSAESIEKT 168

Query: 533  SKALEILKKIGALPDVEKSKDSKSLRAGKGKMRNRRYVMRKGPLVVFAND-EGISKAFRN 709
            S+A++ILK++GA  D EK+KDS  +R GKGKMRNRRY+ RKGPL+V+  +   I KAFRN
Sbjct: 169  SQAIKILKQVGAYADAEKAKDSVGIRPGKGKMRNRRYINRKGPLIVYGTEGSKIVKAFRN 228

Query: 710  LPGVEVTSVDRLNLLQLAPGGHLGRFCIWSKSAFEKLDKVFGTDTTESEQKKGYKLPRAC 889
            LPGV+V +V+RLNLL LAPGGHLGRF IW++SAF+KL++V+GT    S +KKG+ LPR  
Sbjct: 229  LPGVDVANVERLNLLDLAPGGHLGRFVIWTESAFKKLEEVYGTFEAPSLKKKGFILPRPK 288

Query: 890  MANGDLARLINSDEIQSAVRPAKSAGPKHAPLKKNPLRNLGAMLKLNPYAKVARRVEITR 1069
            MAN DL R+INSDE+QS V+P      K    +KNPL+N+ A+LKLNPY   AR++    
Sbjct: 289  MANADLGRIINSDEVQSVVKPLNKE-VKRREKRKNPLKNVAAVLKLNPYFGTARKMATLA 347

Query: 1070 STKKAAKRSEKLAKIAKGEKTGGQKDKAIKAIGKKFYKNMLVESDYAGDDYDLFARWITV 1249
               +   R EKL   +K  K   ++   +KA GK +YK M+ +SDYA  ++D F++W+ V
Sbjct: 348  EAARIKARKEKLD--SKRTKLSPEEAAKVKAAGKAWYKTMISDSDYA--EFDNFSKWLGV 403

 Score = 82.4 bits (202), Expect(2) = e-103
 Identities = 48/79 (60%), Positives = 54/79 (67%), Gaps = 1/79 (1%)
 Frame = +1

Query: 118 APIRPDIVRS-HPHATWRRTTRQAVRRCS*RPATETAAESWGTGRAVSRIPRVPVWLVPT 294
           AP+RPD+VR  H   +  +    AV R   R   +T+AESWGTGRAVSRIPRVP      
Sbjct: 34  APLRPDVVRFVHRLLSCNKRQPYAVSR---RAGHQTSAESWGTGRAVSRIPRVPGGGTHR 90

Query: 295 SAGQGAFGNMCRGGRMFAP 351
            AGQGAFGNMCRGGRMFAP
Sbjct: 91  -AGQGAFGNMCRGGRMFAP 108

>sp|Q9XF97|RL4_PRUAR 60S ribosomal protein L4 (L1) gi|4887131|gb|AAD32206.1|AF134732_1 60S
            ribosomal protein L1 [Prunus armeniaca]
          Length = 408

 Score =  366 bits (939), Expect = e-100
 Identities = 205/415 (49%), Positives = 272/415 (65%), Gaps = 4/415 (0%)
 Frame = +2

Query: 23   AKMAAAIPMVEVHSIE---TGEKAAQVALPGRLHRRPSARISCAAIHTQHGEEQRARPYA 193
            A  AAA P+V V S+E     ++   VALP  +  + S R         +  +   +PYA
Sbjct: 3    AAAAAARPLVTVQSLEGDMATDQTQTVALPDVM--KASIRPDIVTFVHSNISKNSRQPYA 60

Query: 194  AVHEGRPPRPLPSLGALVAPCRVFPVCPCGWYPPAPARVPSATCAAVVACSPHTKVWRRW 373
               +        S G   A  R+ P  P G    A        C      +P TK+WRRW
Sbjct: 61   VSKKAGHQTSAESWGTGRAVSRI-PRVPGGGTHRAGQGAFGNMCRGGRMFAP-TKIWRRW 118

Query: 374  HRKINVNQKRYAVVSALAASALPALVMARGHKIEQVPMVPLVLDDAVEGVKKTSKALEIL 553
            HRKINVNQKRYAVVSA+AASA+P+LV+ARGHKIE VP +PLV+ D++EGV++TS AL++L
Sbjct: 119  HRKINVNQKRYAVVSAIAASAVPSLVLARGHKIETVPELPLVVSDSIEGVEETSAALKVL 178

Query: 554  KKIGALPDVEKSKDSKSLRAGKGKMRNRRYVMRKGPLVVFANDEG-ISKAFRNLPGVEVT 730
            K+IGA  D EK+KDS S+R GKGKMRNRRY+ RKGPL+V+  +   + KAFRN+PG+++ 
Sbjct: 179  KQIGAYSDAEKAKDSHSIRPGKGKMRNRRYINRKGPLIVYGTEGAKLVKAFRNIPGIDII 238

Query: 731  SVDRLNLLQLAPGGHLGRFCIWSKSAFEKLDKVFGTDTTESEQKKGYKLPRACMANGDLA 910
            +V+RLNLL+LAPGGHLGRF +W+KSAFEKLD ++G+    SE+K GY LPR+ M N DLA
Sbjct: 239  NVERLNLLKLAPGGHLGRFVVWTKSAFEKLDSIYGSFDKVSEKKNGYVLPRSKMVNADLA 298

Query: 911  RLINSDEIQSAVRPAKSAGPKHAPLKKNPLRNLGAMLKLNPYAKVARRVEITRSTKKAAK 1090
            R+INSDE+QS V P +  G K APLKKNPLR L  MLKLNPYAK ARR+ +    ++   
Sbjct: 299  RIINSDEVQSVVSPIQE-GSKRAPLKKNPLRILNTMLKLNPYAKTARRMSLLAEAERVKA 357

Query: 1091 RSEKLAKIAKGEKTGGQKDKAIKAIGKKFYKNMLVESDYAGDDYDLFARWITVQK 1255
            + EKL K  K +    ++   IKA GK +Y+ M+ +SDY   ++D F +W+ V +
Sbjct: 358  KKEKLDK--KRKPISKEEASTIKAAGKAWYQTMISDSDYT--EFDNFTKWLGVSQ 408

>gb|AAM65510.1| 60S ribosomal protein L4-B (L1) [Arabidopsis thaliana]
          Length = 406

 Score =  358 bits (918), Expect = 2e-97
 Identities = 203/408 (49%), Positives = 268/408 (64%), Gaps = 4/408 (0%)
 Frame = +2

Query: 32   AAAIPMVEVHSIE---TGEKAAQVALPGRLHRRPSARISCAAIHTQHGEEQRARPYAAVH 202
            AAA P+V + +++   + ++++ V LP  +   P        +H Q     R +PYA   
Sbjct: 4    AAARPLVTIQTLDGDISTDQSSTVVLPDVM-TAPVRPDIVNFVHAQISNNSR-QPYAVSK 61

Query: 203  EGRPPRPLPSLGALVAPCRVFPVCPCGWYPPAPARVPSATCAAVVACSPHTKVWRRWHRK 382
            +        S G   A  R+ P  P G    A        C      +P TK+WRRWHR+
Sbjct: 62   KAGHQTSAESCGTGRAVSRI-PRVPGGGTHRAGQAAFGNMCRGGRMFAP-TKIWRRWHRR 119

Query: 383  INVNQKRYAVVSALAASALPALVMARGHKIEQVPMVPLVLDDAVEGVKKTSKALEILKKI 562
            +NVN KR+A+VSA+AA+A+PALVMARGHKIE VP +PLV+ D+ E V+KTS A+++LK+I
Sbjct: 120  VNVNMKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEKTSAAIKVLKQI 179

Query: 563  GALPDVEKSKDSKSLRAGKGKMRNRRYVMRKGPLVVFAND-EGISKAFRNLPGVEVTSVD 739
            GA  D EK+K+S  +R GKGKMRNRRY+ RKGPLVV+  +   I KAFRNLPGVE+  V+
Sbjct: 180  GAYDDAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVYGTEGSKIVKAFRNLPGVELCHVE 239

Query: 740  RLNLLQLAPGGHLGRFCIWSKSAFEKLDKVFGTDTTESEQKKGYKLPRACMANGDLARLI 919
            RLNLL+LAPGGHLGRF IW+KSAFEKL+ ++G+    SE+KKGY LPRA M N DLAR+I
Sbjct: 240  RLNLLKLAPGGHLGRFVIWTKSAFEKLESIYGSFEKPSEKKKGYVLPRAKMVNADLARII 299

Query: 920  NSDEIQSAVRPAKSAGPKHAPLKKNPLRNLGAMLKLNPYAKVARRVEITRSTKKAAKRSE 1099
            NSDEIQS V P K    K A LKKNPL+NL  MLKLNPYAK A+R+ +    ++   + E
Sbjct: 300  NSDEIQSVVNPIKK-DAKRAVLKKNPLKNLNVMLKLNPYAKTAKRMSLLAEAQRVKAKKE 358

Query: 1100 KLAKIAKGEKTGGQKDKAIKAIGKKFYKNMLVESDYAGDDYDLFARWI 1243
            KLAK  K +    ++  AIKA GK +YK M+ +SDY   ++D F +W+
Sbjct: 359  KLAK--KRKTVTKEEALAIKAAGKSWYKTMISDSDYT--EFDNFTKWL 402

>ref|NP_187574.1| 60S ribosomal protein L4/L1 (RPL4A) [Arabidopsis thaliana]
            gi|17369604|sp|Q9SF40|RL4B_ARATH 60S ribosomal protein
            L4-2 (L1) gi|6682241|gb|AAF23293.1|AC016661_18 putative
            60S ribosomal protein L1 [Arabidopsis thaliana]
            gi|15982715|gb|AAL09727.1| AT3g09630/F11F8_22
            [Arabidopsis thaliana] gi|27311665|gb|AAO00798.1|
            putative 60S ribosomal protein L1 [Arabidopsis thaliana]
            gi|30725664|gb|AAP37854.1| At3g09630 [Arabidopsis
            thaliana]
          Length = 406

 Score =  357 bits (917), Expect = 3e-97
 Identities = 203/408 (49%), Positives = 268/408 (64%), Gaps = 4/408 (0%)
 Frame = +2

Query: 32   AAAIPMVEVHSIE---TGEKAAQVALPGRLHRRPSARISCAAIHTQHGEEQRARPYAAVH 202
            AAA P+V + +++   + ++++ V LP  +   P        +H Q     R +PYA   
Sbjct: 4    AAARPLVTIQTLDGDMSTDQSSTVVLPDVM-TAPVRPDIVNFVHAQISNNSR-QPYAVSK 61

Query: 203  EGRPPRPLPSLGALVAPCRVFPVCPCGWYPPAPARVPSATCAAVVACSPHTKVWRRWHRK 382
            +        S G   A  R+ P  P G    A        C      +P TK+WRRWHR+
Sbjct: 62   KAGHQTSAESWGTGRAVSRI-PRVPGGGTHRAGQAAFGNMCRGGRMFAP-TKIWRRWHRR 119

Query: 383  INVNQKRYAVVSALAASALPALVMARGHKIEQVPMVPLVLDDAVEGVKKTSKALEILKKI 562
            +NVN KR+A+VSA+AA+A+PALVMARGHKIE VP +PLV+ D+ E V+KTS A+++LK+I
Sbjct: 120  VNVNMKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEKTSAAIKVLKQI 179

Query: 563  GALPDVEKSKDSKSLRAGKGKMRNRRYVMRKGPLVVFAND-EGISKAFRNLPGVEVTSVD 739
            GA  D EK+K+S  +R GKGKMRNRRY+ RKGPLVV+  +   I KAFRNLPGVE+  V+
Sbjct: 180  GAYDDAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVYGTEGSKIVKAFRNLPGVELCHVE 239

Query: 740  RLNLLQLAPGGHLGRFCIWSKSAFEKLDKVFGTDTTESEQKKGYKLPRACMANGDLARLI 919
            RLNLL+LAPGGHLGRF IW+KSAFEKL+ ++G+    SE+KKGY LPRA M N DLAR+I
Sbjct: 240  RLNLLKLAPGGHLGRFVIWTKSAFEKLESIYGSFEKPSEKKKGYVLPRAKMVNADLARII 299

Query: 920  NSDEIQSAVRPAKSAGPKHAPLKKNPLRNLGAMLKLNPYAKVARRVEITRSTKKAAKRSE 1099
            NSDEIQS V P K    K A LKKNPL+NL  MLKLNPYAK A+R+ +    ++   + E
Sbjct: 300  NSDEIQSVVNPIKK-DAKRAVLKKNPLKNLNVMLKLNPYAKTAKRMSLLAEAQRVKAKKE 358

Query: 1100 KLAKIAKGEKTGGQKDKAIKAIGKKFYKNMLVESDYAGDDYDLFARWI 1243
            KLAK  K +    ++  AIKA GK +YK M+ +SDY   ++D F +W+
Sbjct: 359  KLAK--KRKTVTKEEALAIKAAGKSWYKTMISDSDYT--EFDNFTKWL 402



EST assemble image


clone accession position
1 MX215d05_r BP089879 1 401
2 LC072c09_r AV624054 15 634
3 LC036g06_r AV621483 16 726
4 MX215h10_r BP089915 19 617
5 MX235c01_r BP091196 20 466
6 MX232h08_r BP091041 20 482
7 HC035f07_r AV634617 22 665
8 HC015h02_r AV633031 22 705
9 MX231d11_r BP090945 26 623
10 HC020b02_r AV633375 28 702
11 MX231d12_r BP090946 28 663
12 HC058d08_r AV636353 29 677
13 MX011f05_r BP086562 32 626
14 MX226c11_r BP090602 57 545
15 CM091a08_r AV397539 111 732
16 CM009a07_r AV397639 113 811
17 CM063f02_r AV390056 113 819
18 CM067e12_r AV390926 113 789
19 CM080h11_r AV392039 113 779
20 HC100g06_r AV639543 113 615
21 CM037a02_r AV388836 115 571
22 CM043e12_r AV389500 116 448
23 CM011a10_r AV386914 116 671
24 CM050e09_r AV389800 116 561
25 CM048d03_r AV389068 116 562
26 CM076g06_r AV391731 116 825
27 CM075f07_r AV391634 116 831
28 CM062f06_r AV390122 116 804
29 CM083h04_r AV392182 116 749
30 CM035d10_r AV388722 116 560
31 CM074g10_r AV391523 116 700
32 LC034g12_r AV621350 116 705
33 LC007d03_r AV619369 116 752
34 LC067d06_r AV623695 116 723
35 LC087b05_r AV625048 116 702
36 LC039e12_r AV621681 116 730
37 LC076f01_r AV624354 116 728
38 LCL021c05_r AV627110 116 446
39 LCL081a10_r AV630581 117 458
40 LCL017h06_r AV626908 118 423
41 LC016f04_r AV620034 118 749
42 CM097c03_r AV393178 119 726
43 CM023h09_r AV387796 120 789
44 CM059b09_r AV390652 120 805
45 CM072h10_r AV391497 120 787
46 CM018g07_r AV387266 120 721
47 LCL033g05_r AV627911 120 664
48 CM059e03_r AV390682 120 778
49 LCL068g12_r AV629910 120 618
50 LC043b02_r AV621953 121 727
51 HC033b03_r AV634418 121 703
52 LC060c05_r AV623197 121 730
53 LCL052b10_r AV629109 121 657
54 LCL031a02_r AV627713 121 540
55 LC080b04_r AV624608 121 682
56 HC055a07_r AV636089 122 339
57 HC083b03_r AV638194 122 731
58 CM079e12_r AV391944 122 734
59 HCL008h09_r AV640019 122 681
60 HC034g08_r AV634545 122 627
61 HC041c06_r AV635050 122 665
62 MX209h02_r BP089566 122 667
63 MXL041a01_r BP095384 122 667
64 MXL098c08_r BP098738 122 575
65 CM058e07_r AV390368 122 822
66 MX027g02_r BP087188 122 675
67 MX256h12_r BP092633 123 709
68 MX037f04_r BP087567 123 659
69 MXL097d07_r BP098687 123 564
70 CM069c12_r AV391201 123 749
71 HC092e05_r AV638912 123 640
72 MXL076h05_r BP097501 123 674
73 LC074d12_r AV624210 124 532
74 CM021e11_r AV387905 124 749
75 HC038h03_r AV634858 124 720
76 LC079c07_r AV624549 124 698
77 LCL040c10_r AV628339 124 538
78 MX228g05_r BP090760 124 414
79 LC032h03_r AV621218 124 658
80 CM098h03_r AV392881 124 709
81 HC038b07_r AV634808 126 701
82 CM051e04_r AV389817 126 443
83 HCL012f07_r AV640232 126 414
84 CM012g05_r AV387174 126 703
85 HC039c12_r AV634891 127 709
86 HC039c09_r AV634889 127 699
87 HC068b12_r AV637064 127 688
88 HC027d05_r AV633956 127 748
89 CM037f08_r AV388888 127 708
90 LCL080e08_r AV630547 127 652
91 MX219h04_r BP090164 127 386
92 MX068e02_r BP088769 127 548
93 HC013a05_r AV632820 127 694
94 HC024e04_r AV633726 127 703
95 MX234h10_r BP091173 128 412
96 MX255h10_r BP092559 128 698
97 MX250f06_r BP092170 128 691
98 CM036d12_r AV388803 128 561
99 MX062h06_r BP088543 128 654
100 MX005g06_r BP086283 128 381
101 HC097b04_r AV639263 129 646
102 CM018e04_r AV387244 129 662
103 MX218h02_r BP090103 129 458
104 MXL003c08_r BP093094 129 414
105 LC056d08_r AV622907 129 685
106 HC016e06_r AV633081 130 685
107 MX020f05_r BP086931 130 448
108 CM093c09_r AV392978 130 769
109 HC036g08_r AV634707 130 699
110 HC067h02_r AV637038 130 670
111 CM086h09_r AV392537 131 771
112 HCL011g04_r AV640182 131 553
113 LC061d03_r AV623270 131 375
114 HC094f09_r AV639074 131 641
115 CM097f02_r AV393190 131 675
116 MXL026a04_r BP094630 131 540
117 MXL035h11_r BP095108 131 601
118 LC013b03_r AV619783 133 728
119 HCL060d05_r AV642915 134 535
120 HC040f09_r AV635002 134 630
121 HCL012f10_r AV640235 134 453
122 MX063e12_r BP088567 134 563
123 LC059e01_r AV623141 134 726
124 HC067e02_r AV637016 134 685
125 HC063f09_r AV636747 134 730
126 HCL026a04_r AV641002 134 691
127 HC093g09_r AV639011 134 647
128 HC052c03_r AV635884 134 666
129 HC002b07_r AV631956 134 728
130 CM078g09_r AV391827 134 831
131 HC077g03_r AV637805 134 667
132 MXL003h06_r BP093133 134 680
133 HC089c12_r AV638677 134 694
134 MX204e12_r BP089297 134 555
135 CM096b04_r AV392777 135 691
136 MXL002c06_r BP093022 135 650
137 LCL001d01_r AV626031 135 673
138 LC004a01_r AV619112 135 762
139 CM093f07_r AV393014 136 730
140 CM028f09_r AV387724 136 819
141 HC058b01_r AV636332 139 676
142 LC066d01_r AV623616 139 620
143 HC045h04_r AV635397 142 705
144 HC063g02_r AV636751 143 663
145 CM018f10_r AV387223 143 759
146 CM035d08_r AV388748 143 702
147 HCL005b11_r AV639799 146 664
148 HC032c07_r AV634350 147 701
149 HC048g05_r AV635628 150 650
150 MX208d07_r BP089495 150 587
151 CM021b09_r AV387949 154 823
152 CM069b05_r AV391216 157 887
153 CM030f12_r AV397353 157 829
154 CM052d07_r AV390547 161 601
155 CM070h09_r AV391299 166 859
156 LCL096b12_r AV631562 168 538
157 CM085d11_r AV392395 175 819
158 CM067h12_r AV390927 183 891
159 HC098h05_r AV639401 186 651
160 LC010c03_r AV619573 186 827
161 LCL031c10_r AV627736 200 521
162 LCL039g02_r AV628297 200 715
163 HC093b10_r AV638964 203 717
164 CM043g05_r AV389470 213 397
165 HC078g09_r AV637876 218 805
166 MX226d10_r BP090611 219 692
167 CM070d05_r AV391251 223 835
168 CM088f11_r AV393024 265 921
169 CM001c01_r AV386515 268 917
170 HC087b11_r AV638504 273 831
171 CM074h09_r AV391583 292 1010
172 LCL061a03_r AV629560 306 777
173 CM037h12_r AV388912 316 904
174 CM058c03_r AV390358 316 966
175 LCL025f09_r AV627366 316 861
176 HC030d11_r AV634200 322 898
177 CM086a01_r AV392517 324 875
178 LCL008b09_r AV626382 331 840
179 HC070d09_r AV637230 347 872
180 HC082a05_r AV638105 353 906
181 HC011b07_r AV632672 371 907
182 LCL065g05_r AV629770 378 822
183 CM004b09_r AV386649 380 983
184 MX228h10_r BP090773 393 841
185 HC040c08_r AV634971 393 905
186 CM065c07_r AV391151 397 1030
187 HCL100f10_r AV645289 443 818
188 HC021b08_r AV633467 466 938
189 CM080b12_r AV392014 530 1160
190 HC047f11_r AV635544 553 1141
191 HC002f10_r AV631998 564 1008
192 MX016b09_r BP086760 570 1040
193 CM100c07_r AV392852 574 1035
194 HC031d08_r AV634282 579 1128
195 LCL004d06_r AV626213 599 864
196 CM015f11_r AV387420 603 1204
197 HC019d04_r AV633315 604 1009
198 HC091h03_r AV638868 610 1028
199 CM073d04_r AV391388 611 1246
200 HC005h08_r AV632258 617 1147
201 CL57c02_r AV396281 634 1160
202 MX202f01_r BP089193 660 1024
203 MX004a07_r BP086204 660 940
204 MX204c10_r BP089279 660 1004
205 MX251a07_r BP092204 661 1147
206 MX038c08_r BP087591 663 1035
207 HC083e04_r AV638223 676 1002
208 CM090c02_r AV392297 682 1054
209 HC075c03_r AV637600 687 1124
210 HC005c06_r AV632204 696 1211
211 LCL001h08_r AV626068 696 1196
212 HC028b08_r AV634017 727 1248
213 LC023a07_r AV620505 738 1260
214 MX027e02_r BP087179 747 1209
215 CM062c11_r AV390125 754 1361
216 HC088g02_r AV638628 757 1200
217 CM042g01_r AV389271 762 1118
218 CM084c11_r AV392587 763 1281
219 LC090b11_r AV625268 764 1295
220 CM082e05_r AV392138 780 1372
221 CM086g04_r AV392550 788 1216
222 MX016f10_r BP086781 789 1242
223 HC075d03_r AV637612 793 1231
224 CM058b06_r AV390378 796 1311
225 MX065h06_r BP088653 796 1150
226 MX061f03_r BP088488 800 1159
227 CM056b08_r AV390333 808 1405
228 HC050f02_r AV635763 811 1324
229 HC023f08_r AV633661 818 1280
230 CM078e04_r AV391830 819 1321
231 LC069d04_r AV623838 838 1344
232 MXL040e11_r BP095360 849 1229
233 HC064h10_r AV636841 853 1319
234 MXL089b06_r BP098196 854 1229
235 HC025h12_r AV633839 854 1328
236 HC013b11_r AV632835 854 1319
237 MX238a05_r BP091391 855 1156
238 CM066e08_r AV390819 862 1483
239 LC099e07_r AV625895 864 1170
240 LC062a06_r AV623315 868 1352
241 CM034a04_r AV388608 868 1336
242 HC074c06_r AV637531 870 1383
243 HC091b09_r AV638815 874 1279
244 CM003b04_r AV386553 875 1367
245 HC061h09_r AV636621 875 1335
246 HC015e07_r AV633008 875 1339
247 HC078f03_r AV637863 878 1042
248 LC093d09_r AV625483 881 1182
249 CM040c11_r AV389185 883 1398
250 CM007f05_r AV386823 889 1374
251 MX027b07_r BP087170 907 1285
252 CM026f09_r AV387556 907 1521
253 HC062e07_r AV636662 909 1357
254 CL01c06_r AV393314 933 1474
255 HC027c05_r AV633944 968 1474
256 CM078b09_r AV391822 1013 1611
257 MXL095h12_r BP098590 1015 1388
258 MXL019d12_r BP094199 1015 1498
259 CM074c02_r AV391511 1016 1590
260 CM080g02_r AV392028 1081 1686
261 CM027g01_r AV387587 1106 1697
262 MXL032b08_r BP094906 1164 1529
263 MX035g05_r BP087500 1183 1465
264 HCL045e06_r AV642094 1260 1567
265 CL33h10_r AV394958 1270 1761
266 CL67b03_r AV396698 1276 1811
267 CL68c07_r AV396923 1311 1933
268 CL26e03_r AV394605 1331 1867
269 CM073f06_r AV391418 1338 1933
270 CM076h03_r AV391711 1364 1963
271 CL17h05_r AV394112 1385 1901
272 CM007g05_r AV386828 1390 1842
273 CL50e04_r AV395742 1391 1896
274 HC030g07_r AV634227 1394 1931
275 CL36b08_r AV395141 1395 1898
276 CL13d10_r AV393928 1425 1879
277 CM082a04_r AV392074 1449 1999
278 CL09d02_r AV393746 1457 1933
279 HCL094a03_r AV644801 1488 1935
280 LC079a09_r AV624532 1533 2111
281 CM063h06_r AV390061 1568 2053
282 MX035g08_r BP087501 1618 1933
283 HCL098e12_r AV645127 1632 1933
284 LCL028b07_r AV627534 1679 1979




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research