KCC000014A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000014A_C01 KCC000014A_c01
CAACCATGACGAAGAAGCGGCGGAATCGGGGACGCGCCAAGCACGGCCGCGGCCATGTGA
ACCGTGTGCGCTGCGAGTCTAGCGGCGCCATGGTGCCCAAGGACAAGGCTATCAAGCGCT
ACATTGTGCGCAACATTGTGGACGCGTCGGCTCTCCGCGACATGCAGGAGGCTTGCGTCG
TCGACAACTACGCCCTGCCCAAGATTTACCGCAAGGTGTACTACAGCATCAGCGCTGCTA
TCCACAGCCGCGTTGTGCGCGTCCGCAACGCCAAGGAGCGCCGGAACCGGGAGCCGCCTC
GCCGGTTCCCCAACCGCGACCAGCAGCAGCAGAAGAAGGATTAAGCAGGCGGACAGTAGG
ATCGTGGTGCTAGCGGCTTAGCAGCAGTGGGAGCCACGGCAGCAGCTCGGAGCCATGGCG
CCCTCGGACTGGACTCCATCGCTCACGGCGCGGGTGTGCGCGGTGTTGCTGGCTGGTGCC
CTCCGCCCACGGCGGTCTGATGTCGTGCTGTAAGGCACACGCTTCGTTGAAAAAAAAAAA
TAAAAAACAAAAAATAAATAAAAAAAAACTCGGGGGGGCCGCGTCCATTGCCATAGGATG
ATTAGCGCACGGCGGTTAAATCTGAGGAACCCGTTTCCATAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000014A_C01 KCC000014A_c01
         (642 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB93181.1| putative 40S ribosomal protein S26 [Oryza sativa...   139  3e-32
pir||T50822 ribosomal protein S26, cytosolic [imported] - garden...   139  5e-32
ref|NP_181583.1| 40S ribosomal protein S26 (RPS26A) [Arabidopsis...   135  7e-31
sp|P49216|RS26_ORYSA 40S RIBOSOMAL PROTEIN S26 (S31) gi|7440567|...   135  7e-31
ref|NP_181591.1| 40S ribosomal protein S26 (RPS26B) [Arabidopsis...   134  9e-31

>dbj|BAB93181.1| putative 40S ribosomal protein S26 [Oryza sativa (japonica
           cultivar-group)]
          Length = 133

 Score =  139 bits (351), Expect = 3e-32
 Identities = 72/136 (52%), Positives = 91/136 (65%)
 Frame = +3

Query: 6   MTKKRRNRGRAKHGRGHVNRVRCESSGAMVPKDKAIKRYIVRNIVDASALRDMQEACVVD 185
           MT KRRN GR KHGRGHV  +RC +     PKDKAIKR+ VRNIV+ +A+RD+QEACV D
Sbjct: 1   MTFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHD 60

Query: 186 NYALPKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPRRFPNRDQQQQKKD*AGGQ*DR 365
            Y LPK+Y KV++ +S AIH+ +VRVR+ + RR+R PP RF  R+ + Q     GG    
Sbjct: 61  GYVLPKLYAKVHHCVSCAIHAHIVRVRSRENRRDRRPPERFRRREDRPQGPRPGGG---A 117

Query: 366 GASGLAAVGATAAARS 413
            A G AA  A   AR+
Sbjct: 118 PAPGGAAAPAPNVART 133

>pir||T50822 ribosomal protein S26, cytosolic [imported] - garden pea
           gi|5706704|gb|AAD47346.1|AF112440_1 ribosomal protein
           S26 [Pisum sativum]
          Length = 130

 Score =  139 bits (349), Expect = 5e-32
 Identities = 65/104 (62%), Positives = 80/104 (76%)
 Frame = +3

Query: 6   MTKKRRNRGRAKHGRGHVNRVRCESSGAMVPKDKAIKRYIVRNIVDASALRDMQEACVVD 185
           MT KRRN GR KHGRGHV  +RC + G   PKDKAIKR++VRNIV+ +A+RD+QEACV D
Sbjct: 1   MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYD 60

Query: 186 NYALPKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPRRFPNR 317
            Y LPK+Y K+ Y +S AIHS VVRVR+  +RR R+PP+RF  R
Sbjct: 61  QYTLPKLYVKMQYCVSCAIHSHVVRVRSRTDRRKRDPPQRFIRR 104

>ref|NP_181583.1| 40S ribosomal protein S26 (RPS26A) [Arabidopsis thaliana]
           gi|25294902|pir||D84830 40S ribosomal protein S26
           [imported] - Arabidopsis thaliana
           gi|2651314|gb|AAB87594.1| 40S ribosomal protein S26
           [Arabidopsis thaliana] gi|21555493|gb|AAM63871.1| 40S
           ribosomal protein S26 [Arabidopsis thaliana]
          Length = 133

 Score =  135 bits (339), Expect = 7e-31
 Identities = 70/130 (53%), Positives = 82/130 (62%)
 Frame = +3

Query: 6   MTKKRRNRGRAKHGRGHVNRVRCESSGAMVPKDKAIKRYIVRNIVDASALRDMQEACVVD 185
           MT KRRN GR KH RGHVN +RC + G   PKDKAIKR+IVRNIV+ +A+RD+QEA V +
Sbjct: 1   MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60

Query: 186 NYALPKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPRRFPNRDQQQQKKD*AGGQ*DR 365
            Y LPK+Y K  Y +S AIHS VVRVR+   RR R PP RF  R +   K    G     
Sbjct: 61  GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPGQPGQAPRP 120

Query: 366 GASGLAAVGA 395
              G AA  A
Sbjct: 121 AGPGAAAAAA 130

>sp|P49216|RS26_ORYSA 40S RIBOSOMAL PROTEIN S26 (S31) gi|7440567|pir||T04081 probable
           ribosomal protein S31 [imported] - rice
           gi|971284|dbj|BAA07208.1| ribosomal protein S31 [Oryza
           sativa (japonica cultivar-group)]
          Length = 133

 Score =  135 bits (339), Expect = 7e-31
 Identities = 70/136 (51%), Positives = 88/136 (64%)
 Frame = +3

Query: 6   MTKKRRNRGRAKHGRGHVNRVRCESSGAMVPKDKAIKRYIVRNIVDASALRDMQEACVVD 185
           M  KRRN GR KHGRGHV  +RC +     PKDKAIKR+ VRNIV+  A+RD+QE CV D
Sbjct: 1   MIFKRRNGGRIKHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQVAIRDVQEGCVHD 60

Query: 186 NYALPKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPRRFPNRDQQQQKKD*AGGQ*DR 365
            Y LPK+Y KV++ +S AIH+ +VRVR+ + RR+R PP RF  R+ + Q     GG    
Sbjct: 61  GYVLPKLYAKVHHCVSCAIHAHIVRVRSRENRRDRRPPERFRRREDRPQGPRPGGG---A 117

Query: 366 GASGLAAVGATAAARS 413
            A G AA  A   AR+
Sbjct: 118 PAPGGAAAPAPNVART 133

>ref|NP_181591.1| 40S ribosomal protein S26 (RPS26B) [Arabidopsis thaliana]
           gi|3123279|sp|P49206|RS26_ARATH 40S ribosomal protein
           S26 gi|25294903|pir||D84831 40S ribosomal protein S26
           [imported] - Arabidopsis thaliana
           gi|2651298|gb|AAB87578.1| 40S ribosomal protein S26
           [Arabidopsis thaliana] gi|22022538|gb|AAM83227.1|
           At2g40590/T2P4.6 [Arabidopsis thaliana]
           gi|24111313|gb|AAN46780.1| At2g40590/T2P4.6 [Arabidopsis
           thaliana]
          Length = 131

 Score =  134 bits (338), Expect = 9e-31
 Identities = 73/135 (54%), Positives = 85/135 (62%)
 Frame = +3

Query: 6   MTKKRRNRGRAKHGRGHVNRVRCESSGAMVPKDKAIKRYIVRNIVDASALRDMQEACVVD 185
           MT KRRN GR KH RGHVN +RC + G   PKDKAIKR+IVRNIV+ +A+RD+QEA V +
Sbjct: 1   MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60

Query: 186 NYALPKIYRKVYYSISAAIHSRVVRVRNAKERRNREPPRRFPNRDQQQQKKD*AGGQ*DR 365
            Y LPK+Y K  Y +S AIHS VVRVR+   RR R PP RF  R +   K    G     
Sbjct: 61  GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFTRRKEDTPKPGQPG----- 115

Query: 366 GASGLAAVGATAAAR 410
            A   A  GA AA R
Sbjct: 116 QAPRPAGPGAAAAPR 130



EST assemble image


clone accession position
1 CL08h03_r AV393514 1 676
2 MX233a06_r BP091048 8 448
3 CL48b03_r AV395807 8 719
4 CL52f03_r AV395840 8 644
5 CL73b11_r AV396962 11 596
6 CL38e10_r AV395329 12 713
7 CL73h06_r AV396960 12 266
8 CL71c11_r AV396893 14 713
9 CL17d12_r AV394137 17 701
10 CL59d05_r AV397888 18 713
11 CL13d04_r AV393932 18 719
12 CL29b10_r AV394672 19 682
13 CL72g02_r AV397034 28 713
14 CL06b07_r AV393610 36 698
15 CL66g11_r AV396734 38 721
16 CL26f11_r AV394592 44 713
17 CM024g05_r AV388288 61 714
18 CL22b03_r AV394219 68 713
19 CM086d06_r AV392508 90 556
20 CL64c09_r AV396619 90 738
21 CL75e09_r AV397047 90 716
22 HC091h06_r AV638871 93 596
23 CM030d11_r AV397375 94 743
24 CM008h11_r AV386698 94 732
25 LCL063d06_r AV629673 94 529
26 LCL042d01_r AV628468 95 698
27 CL78h06_r AV397225 95 702
28 LCL070c06_r AV629972 96 646
29 LC066e06_r AV623628 97 682
30 LCL031c11_r AV627737 98 441
31 CL43h12_r AV395516 98 644
32 CL35d07_r AV395101 99 700
33 CL26d06_r AV394581 99 712
34 LC011a12_r AV619635 99 611
35 CL60c07_r AV396350 99 713
36 LC048h08_r AV622380 99 687
37 CL39e09_r AV395194 99 664
38 HCL030h12_r AV641280 99 631
39 CL26h10_r AV394627 99 690
40 CL34b03_r AV394926 99 653
41 CL40f09_r AV395350 99 651
42 CM070f07_r AV391312 99 424
43 CL36f05_r AV395131 99 701
44 CL23e11_r AV394492 99 688
45 CL16a07_r AV394015 99 715
46 CL49c12_r AV397752 99 717
47 CL08c06_r AV393520 100 651
48 CL15c03_r AV393954 101 651
49 CL70c03_r AV396832 101 713
50 CL67a06_r AV396676 101 600
51 CL12g09_r AV393840 102 680
52 CM016h11_r AV387477 102 803
53 CL79b10_r AV397182 102 648
54 CL25c03_r AV394531 102 636
55 CL44a04_r AV395617 102 632
56 CL27e10_r AV394713 102 709
57 HC073f12_r AV637484 102 591
58 CL20a07_r AV394281 102 703
59 CL65g06_r AV396552 102 717
60 CL11h05_r AV393771 102 689
61 CL33f10_r AV394956 102 673
62 CL50b07_r AV395748 102 654
63 MXL009d07_r BP093510 102 648
64 CM009b03_r AV397638 102 777
65 CL19g02_r AV394158 102 696
66 CL40h06_r AV395389 102 700
67 CL43c08_r AV395558 102 689
68 LC013a04_r AV619773 102 714
69 CL20h08_r AV394336 102 716
70 CL38e05_r AV395308 102 690
71 CL67h04_r AV396695 102 697
72 CL59d11_r AV397923 102 720
73 CL16c04_r AV394009 102 694
74 HC034d11_r AV634517 102 713
75 CL64g06_r AV396663 102 698
76 CL05h07_r AV393572 103 568
77 CL56b09_r AV396108 103 699
78 CL66g06_r AV396731 103 717
79 CL49e11_r AV397712 103 713
80 CL46h09_r AV395662 103 671
81 CL37e10_r AV395234 104 694
82 CM064d10_r AV391008 105 796
83 CL56h03_r AV396093 105 697
84 CL43f10_r AV395550 105 664
85 CL16g11_r AV394038 105 673
86 CL70e02_r AV396843 105 711
87 CM092e08_r AV392682 105 713
88 CL50f09_r AV395757 105 679
89 CM060h09_r AV390748 105 723
90 CL42d06_r AV395453 105 658
91 MX033f11_r BP087396 106 699
92 CM030c09_r AV397392 106 760
93 LCL093c09_r AV631403 106 604
94 CM030c07_r AV397426 106 737
95 CM033e10_r AV388451 106 635
96 CM086f08_r AV392554 107 708
97 CL23a12_r AV394482 107 648
98 CL26h04_r AV394586 107 665
99 CL58e06_r AV396220 107 714
100 CL64a06_r AV396654 107 713
101 CL02d04_r AV397607 107 722
102 CL21e02_r AV394358 107 624
103 CL79a04_r AV397146 108 649
104 CL69g04_r AV396808 108 713
105 CL39g09_r AV395195 108 651
106 MX026d10_r BP087138 108 632
107 CL54b05_r AV396171 108 713
108 CL59b02_r AV397900 108 721
109 CL05h10_r AV393594 108 670
110 CL35c09_r AV395077 108 704
111 CL78g09_r AV397239 108 660
112 CL78g10_r AV397190 108 669
113 LC099g01_r AV625909 108 603
114 CL78g03_r AV397204 108 699
115 CL38e09_r AV395319 108 697
116 CL19a08_r AV394206 108 682
117 CL70g08_r AV396829 108 718
118 CL57c03_r AV396284 108 725
119 CL55d09_r AV396009 108 719
120 CL77h06_r AV397271 108 720
121 CS001d10_r AV398024 108 737
122 CL64h07_r AV396647 108 690
123 CL21g04_r AV394397 109 706
124 CL25e11_r AV394545 109 701
125 CL36a05_r AV395126 109 693
126 CL48h11_r AV395835 109 714
127 CL60b06_r AV396360 109 649
128 CL74b03_r AV396482 109 713
129 LCL047e07_r AV628816 109 692
130 CL23h07_r AV394481 110 643
131 CL38g01_r AV395296 110 712
132 CM028g05_r AV387675 111 775
133 CL57a12_r AV396268 111 724
134 CL25f12_r AV394562 111 697
135 CM092c10_r AV392672 111 687
136 CL17b08_r AV394124 111 714
137 CL20f01_r AV394313 111 637
138 CL74g06_r AV396451 111 717
139 HCL094c02_r AV644819 111 601
140 CM010e12_r AV386955 111 659
141 CM035a04_r AV388731 111 652
142 LCL004c06_r AV626207 111 486
143 CS001c12_r AV397969 111 738
144 CM025g04_r AV388060 111 779
145 CM018g02_r AV387275 111 759
146 CM086g01_r AV392524 111 675
147 LC085d02_r AV624981 111 712
148 LC028f09_r AV620924 111 713
149 CL26g12_r AV394628 111 651
150 LCL007e09_r AV626350 112 661
151 CL64b01_r AV396609 112 713
152 CL22g11_r AV394263 112 592
153 HC098h10_r AV639406 112 578
154 CS001f09_r AV398019 112 555
155 LCL022e06_r AV627194 112 648
156 CL43h09_r AV395546 112 720
157 CL55a02_r AV396047 113 665
158 CM060h08_r AV390769 113 724
159 CM046d08_r AV388041 113 752
160 LCL047f06_r AV628825 113 646
161 CM048h01_r AV389113 113 635
162 HCL095f02_r AV644925 114 593
163 LC061b08_r AV623258 114 648
164 CL32a05_r AV394830 114 651
165 LC043e03_r AV621980 114 745
166 HC093d10_r AV638984 114 537
167 CL78b10_r AV397241 115 650
168 HCL034d10_r AV641483 115 698
169 CL56c03_r AV396090 115 713
170 CL76a04_r AV397115 115 714
171 CL16f11_r AV394037 115 654
172 CL33c05_r AV394968 115 697
173 CL73g08_r AV396982 116 718
174 MX015f08_r BP086737 116 595
175 MX015b09_r BP086717 116 594
176 CL27e06_r AV394691 116 720
177 CL41d05_r AV395401 116 644
178 CL78b02_r AV397216 116 614
179 CL43d12_r AV395513 116 699
180 CL35h04_r AV395093 117 701
181 CL63g05_r AV396550 117 713
182 CL52g06_r AV395858 118 700
183 CM065d07_r AV391118 118 825
184 CM029b06_r AV389313 118 732
185 CM058g11_r AV390415 118 830
186 HCL091f08_r AV644643 118 648
187 CM063d04_r AV390073 118 839
188 CL49h02_r AV397708 118 688
189 CL10h09_r AV393682 118 716
190 CL48c10_r AV395793 118 690
191 MX043f05_r BP087787 118 653
192 CL80h09_r AV397311 118 743
193 LC090e12_r AV625296 118 713
194 HCL017d04_r AV640501 118 692
195 CL80c02_r AV397336 119 588
196 MX049g08_r BP088029 119 640
197 CL26h06_r AV394590 119 716
198 CL64e02_r AV396655 119 713
199 CS001d04_r AV397939 119 736
200 CM027f06_r AV387655 119 823
201 CM049f03_r AV389601 119 332
202 CM051h05_r AV389813 119 412
203 CL79c03_r AV397158 119 491
204 CL48b10_r AV395792 119 701
205 CL69d12_r AV396784 119 528
206 CL43a03_r AV395564 119 720
207 CL73f11_r AV396965 119 557
208 CL30g08_r AV394756 119 685
209 CL40g10_r AV395358 119 719
210 HC048b12_r AV635587 119 651
211 CL07e06_r AV393477 119 687
212 CL35c10_r AV395082 119 689
213 CL44c10_r AV395613 119 718
214 CL80b01_r AV397294 119 672
215 CL78d11_r AV397226 119 648
216 CL68e09_r AV396928 119 720
217 CL42c05_r AV395462 119 696
218 HCL024d02_r AV640899 119 647
219 CL38f01_r AV395291 119 671
220 CL16e02_r AV394028 119 697
221 CL03e11_r AV393408 119 670
222 CL79a06_r AV397171 119 700
223 CL46e07_r AV395657 119 637
224 LCL005h07_r AV626289 119 698
225 CL40f06_r AV395387 119 701
226 CL62f07_r AV396418 119 699
227 CM034e09_r AV388678 119 752
228 CL65g02_r AV396598 119 702
229 CM092g04_r AV392680 119 668
230 CL51a04_r AV395928 119 716
231 CL49a02_r AV397757 119 721
232 CL60b11_r AV396367 119 716
233 CL21g03_r AV394343 119 708
234 CL12h08_r AV393855 119 715
235 CL60h02_r AV396362 119 713
236 CL58c10_r AV396239 119 714
237 CL01c05_r AV393310 119 713
238 MX022f09_r BP087004 119 614
239 CL27b08_r AV394718 119 611
240 MX251h09_r BP092275 119 657
241 CL38e07_r AV395312 119 693
242 CL72g06_r AV397037 119 713
243 CL06b09_r AV393643 119 728
244 CL80a07_r AV397326 120 501
245 CL63a01_r AV396541 120 711
246 CL46g12_r AV395672 120 710
247 CL61c07_r AV396308 120 713
248 CL68h08_r AV396954 120 700
249 CL48c03_r AV395808 120 543
250 CL44g01_r AV395603 120 702
251 CL02a10_r AV397601 120 665
252 CL32c05_r AV394832 121 673
253 CL68a11_r AV396955 121 716
254 CL19c03_r AV394182 121 699
255 CL80f10_r AV397314 121 713
256 CL10f02_r AV393658 122 713
257 CL08f11_r AV393548 123 716
258 CL33a08_r AV394973 124 713
259 CL03a03_r AV393431 124 717
260 CL59d02_r AV397902 124 717
261 CL60d08_r AV396398 124 713
262 CL66h04_r AV396756 125 713
263 CL36e03_r AV395107 125 712
264 CL49d02_r AV397760 125 701
265 LCL006h06_r AV626322 125 420
266 CL45d11_r AV397798 125 702
267 MX005c11_r BP086265 126 669
268 CM093f11_r AV392975 127 718
269 CM085f11_r AV392397 128 463
270 LCL091c03_r AV631273 129 593
271 CL66g04_r AV396754 130 714
272 CL55a03_r AV396031 131 713
273 CL37f04_r AV395272 131 713
274 HCL046d09_r AV642150 135 648
275 CL24c04_r AV394424 137 731
276 CL01c10_r AV393295 137 713
277 CL08e04_r AV393507 158 713
278 CL75h11_r AV397090 159 716
279 MX103c07_r BP088970 182 714
280 LC091d04_r AV625353 184 600
281 CL30f09_r AV394771 194 703
282 HCL084b12_r AV644218 206 713
283 CL36c08_r AV395142 210 713
284 CL58f10_r AV396245 222 737
285 HCL094d11_r AV644835 269 709
286 MX104e02_r BP089073 273 714
287 HCL099h03_r AV645224 308 713
288 MX103h05_r BP089021 329 714




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research