KCC000012A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000012A_C01 KCC000012A_c01
ACCGCCGCCGCCACCGCCTCCACTGCCGCCCGGCATGCCGCCAGCTCTGGTGCCAGGTAA
GCTGACACGCCGCCCGCCGCCTTGCCCCCCTCAGCCCCCTCGCCCCCTGCTGCCGCCGCC
GCTGCGTCCAGCTCCGCTGCCGCCGCCCTCAAAATGGCCCCTAAGGAGCAGAAGTCGAAG
GAGGCCAAGGCCCTTGCTGCGGCCAACAGCAGCAAGGGTAAGCGGAAGAAGTGGAGCAAG
GGCAAGATGAAGGAGAAGGTCAACAACGCCGTCCTGTTCGACAAGGCGGTGTATGAGAAG
CTGCTGAACGAGGTGCCGAAGTACAAGATGATTTCGCCCTCGGTCCTGGCCGACCGCCTG
CGCATTGGTGGCAGCCTCGCTCGCGCTGCCATCCGTGAGCTGTCCAACAAGGGCCTCATC
AAGCCCATTGTTCAGCACCACGGCCAGATGGTCTACACCCGCGCCACCGCTGCCTAAGCG
CGTGCTGTAACACAAAATGGCGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000012A_C01 KCC000012A_c01
         (546 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAK92193.1|AF400221_1 ribosomal protein S25 [Spodoptera frugi...   129  3e-29
ref|NP_524315.2| Ribosomal protein S25 CG6684-PA [Drosophila mel...   128  4e-29
ref|XP_313760.1| ENSANGP00000017618 [Anopheles gambiae] gi|21297...   127  7e-29
gb|AAA03464.1| cloned by ability to arrest the cell cycle when e...   126  2e-28
ref|NP_195631.1| 40S ribosomal protein S25 (RPS25E) [Arabidopsis...   125  3e-28

>gb|AAK92193.1|AF400221_1 ribosomal protein S25 [Spodoptera frugiperda]
          Length = 119

 Score =  129 bits (324), Expect = 3e-29
 Identities = 62/109 (56%), Positives = 82/109 (74%)
 Frame = +1

Query: 142 AALKMAPKEQKSKEAKALAAANSSKGKRKKWSKGKMKEKVNNAVLFDKAVYEKLLNEVPK 321
           A+ K   K QK KE      +   K K+KKWSKGK+++K+NN VLFDK  YEKL  EVP+
Sbjct: 9   ASAKQPQKTQKKKEG-----SGGGKAKKKKWSKGKVRDKLNNQVLFDKPTYEKLYKEVPQ 63

Query: 322 YKMISPSVLADRLRIGGSLARAAIRELSNKGLIKPIVQHHGQMVYTRAT 468
           YK+I+P+V+++RL++ GSLAR A+ EL  KGLIK +VQHHGQ++YTRAT
Sbjct: 64  YKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHHGQVIYTRAT 112

>ref|NP_524315.2| Ribosomal protein S25 CG6684-PA [Drosophila melanogaster]
           gi|24645867|ref|NP_731544.1| Ribosomal protein S25
           CG6684-PB [Drosophila melanogaster]
           gi|33860207|sp|P48588|RS25_DROME 40S ribosomal protein
           S25 gi|17945282|gb|AAL48698.1| RE14595p [Drosophila
           melanogaster] gi|23170969|gb|AAN13495.1| CG6684-PA
           [Drosophila melanogaster] gi|23170970|gb|AAF54605.2|
           CG6684-PB [Drosophila melanogaster]
          Length = 117

 Score =  128 bits (322), Expect = 4e-29
 Identities = 63/111 (56%), Positives = 82/111 (73%)
 Frame = +1

Query: 136 AAAALKMAPKEQKSKEAKALAAANSSKGKRKKWSKGKMKEKVNNAVLFDKAVYEKLLNEV 315
           A ++ K   K QK KE      +   K K+KKWSKGK+++K+NN VLFDKA YEKL  EV
Sbjct: 7   AKSSAKQPQKTQKKKEG-----SGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEV 61

Query: 316 PKYKMISPSVLADRLRIGGSLARAAIRELSNKGLIKPIVQHHGQMVYTRAT 468
           P YK+I+PSV+++RL+I GSLA+ A+ EL  KGLIK +VQHH Q++YTRAT
Sbjct: 62  PAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRAT 112

>ref|XP_313760.1| ENSANGP00000017618 [Anopheles gambiae] gi|21297098|gb|EAA09243.1|
           ENSANGP00000017618 [Anopheles gambiae str. PEST]
          Length = 142

 Score =  127 bits (320), Expect = 7e-29
 Identities = 67/138 (48%), Positives = 89/138 (63%), Gaps = 7/138 (5%)
 Frame = +1

Query: 76  AALPPSAPSPPAAAAAASSSAAAALKMAPKE-------QKSKEAKALAAANSSKGKRKKW 234
           + LP    SPP  +  +S       KM PK+       Q  K  K     +  K K+KKW
Sbjct: 2   SVLPSFYQSPPTFSFFSSPY----FKMPPKKDTKGSAKQPQKTQKKKEGGSGGKAKKKKW 57

Query: 235 SKGKMKEKVNNAVLFDKAVYEKLLNEVPKYKMISPSVLADRLRIGGSLARAAIRELSNKG 414
           SKGK+++K+NN VLFDKA Y+KL  EVP YK+I+PSV+++RL+I GSLA+  +REL  KG
Sbjct: 58  SKGKVRDKLNNQVLFDKATYDKLYKEVPAYKLITPSVVSERLKIRGSLAKRGLRELCQKG 117

Query: 415 LIKPIVQHHGQMVYTRAT 468
           LIK +VQHH Q++YTR T
Sbjct: 118 LIKLVVQHHAQVIYTRTT 135

>gb|AAA03464.1| cloned by ability to arrest the cell cycle when expressed in the
           fission yeast Schizosaccharomyces pombe
          Length = 113

 Score =  126 bits (316), Expect = 2e-28
 Identities = 62/111 (55%), Positives = 81/111 (72%)
 Frame = +1

Query: 136 AAAALKMAPKEQKSKEAKALAAANSSKGKRKKWSKGKMKEKVNNAVLFDKAVYEKLLNEV 315
           A ++ K   K QK KE      +   K K+KKWSKGK+++K+NN VLFDKA YEKL  EV
Sbjct: 3   AKSSAKQPQKTQKKKEG-----SGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEV 57

Query: 316 PKYKMISPSVLADRLRIGGSLARAAIRELSNKGLIKPIVQHHGQMVYTRAT 468
           P YK+I+PSV+++RL+I GSL + A+ EL  KGLIK +VQHH Q++YTRAT
Sbjct: 58  PAYKLITPSVVSERLKIRGSLDKRALIELREKGLIKQVVQHHSQVIYTRAT 108

>ref|NP_195631.1| 40S ribosomal protein S25 (RPS25E) [Arabidopsis thaliana]
           gi|30580493|sp|Q9T029|R25B_ARATH 40S ribosomal protein
           S25-2 gi|7440560|pir||T08568 ribosomal protein S25,
           cytosolic - Arabidopsis thaliana
           gi|4914432|emb|CAB43635.1| ribosomal protein S25
           [Arabidopsis thaliana] gi|7270903|emb|CAB80583.1|
           ribosomal protein S25 [Arabidopsis thaliana]
           gi|14335026|gb|AAK59777.1| AT4g39200/T22F8_100
           [Arabidopsis thaliana] gi|16323232|gb|AAL15350.1|
           AT4g39200/T22F8_100 [Arabidopsis thaliana]
           gi|21553704|gb|AAM62797.1| ribosomal protein S25
           [Arabidopsis thaliana]
          Length = 108

 Score =  125 bits (315), Expect = 3e-28
 Identities = 65/110 (59%), Positives = 80/110 (72%), Gaps = 5/110 (4%)
 Frame = +1

Query: 154 MAPKEQK-----SKEAKALAAANSSKGKRKKWSKGKMKEKVNNAVLFDKAVYEKLLNEVP 318
           MAPK+ K     SK AK+       K K+KKWSKGK KEKVNN VLFD+A Y+KLL E P
Sbjct: 1   MAPKKDKVPPPSSKPAKS----GGGKQKKKKWSKGKQKEKVNNMVLFDQATYDKLLTEAP 56

Query: 319 KYKMISPSVLADRLRIGGSLARAAIRELSNKGLIKPIVQHHGQMVYTRAT 468
           K+K+I+PS+L+DR+RI GSLAR AIREL  KG+I+ +  H  Q +YTRAT
Sbjct: 57  KFKLITPSILSDRMRINGSLARRAIRELMAKGVIRMVAAHSSQQIYTRAT 106



EST assemble image


clone accession position
1 LCL012c06_r AV626610 1 503
2 CL01c03_r AV393338 55 419
3 HCL083f08_r AV644193 55 504
4 LC077c07_r AV624401 56 582
5 HCL005h04_r AV639836 153 504
6 HCL045f08_r AV642101 154 427
7 HCL018g09_r AV640591 160 502
8 HCL008a05_r AV639965 161 502
9 HCL002h03_r AV639674 169 503
10 HCL094g12_r AV644864 169 499
11 HCL063c06_r AV643072 169 504
12 HCL090f01_r AV644563 171 501
13 MX010d05_r BP086504 174 338
14 HCL092c06_r AV644687 198 502
15 HCL096h02_r AV645002 200 391
16 HCL093a06_r AV644729 224 490
17 CL01e05_r AV393346 231 546




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research