KCC000011A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000011A_C01 KCC000011A_c01
GCGGCACGAGGCGACCTGTTTTCACGGCTGGACGAGTTCGACGGGGGCTTCTTCTCCAAC
AGCCGCGCGGTGGAGCTGGTGCAGCACCTCATCAACAAGGGCAGCCTCCAGGACATGTCG
GACATGATCAAGAAGCTGCGCGGCCTCATGGGGGACGCCACCTTCCTGGAGGCGTACTAG
CGCACCGGCCGGATCCTGAACGTGACGGTGTGCCCCGCCGACACCAACGAGCCGACGTGG
GTGCTCAACTACCTCACCGCGCCCAACGCGCTCATCTGGAGCGCCGGGGCCGCCTCCTCC
GCCTTTCCGGGGCTGTACCCGGCGCAGCACATCCTGGGGCGCAACAGTCGCGGAGAGATC
ATCCGCTTCTCGGCCCAGTCCACCAATGACTCGCTGGAGCGGCGGTGGCGGGACGGCTCC
CTGGAGCTGGACCTGCCCGTGCAGGCTCTGGGCGAGATGTTCAACTGCAACCACTTCCTG
GTGAGCCAGACCAACCCGCACATCGTGCCGCTGCTCAACCTGAAGAAGGCGCTCAGCCGC
AAGTGGGCCAACGTGCTGGAGGCGGAGCTCAAGCACCGCTGCCAGGTGGCGCAGTGGCTG
CTGCCCGAGTGGGTGCCCAGCAAGTGGCTCATGCTGTTCACGCAGGCCTGGGAGGGCGAC
ATCACCATGACGCTGCCCTCGGCGCTGTGGCACCTGAGCAAGACCATTGTGAACCCCACC
ACGGAGGAGCTCATCCGCAACGTCAAGGTGGGCGAGGTGGACACCTGGGAGAAGATCAGC
GCCATCGAGTGCAACTGCTCCATCGAGGCCACGCTGGACAAGTGCCTGGCCAACATCGCC
AACCAGGTCCGCGGCTACCGGCTGCAGCGCATGCACAACCGCATCCCCTCCTGGCTGCAC
ATGTCGGCGGTGGGCCTGCCCGCCGTCGTCTCCTGGGGCGACTCGGAGTTTGCCGA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000011A_C01 KCC000011A_c01
         (956 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAP73845.1| putative phospholipase [Oryza sativa (japonica cu...   233  5e-60
ref|NP_196024.1| patatin-related [Arabidopsis thaliana] gi|11282...   223  3e-57
dbj|BAB61223.1| contains EST AU057376(S21389)~similar to Arabido...   219  4e-56
ref|NP_191273.1| patatin-related [Arabidopsis thaliana] gi|11282...   207  2e-52
ref|XP_332099.1| hypothetical protein [Neurospora crassa] gi|289...   153  4e-36

>gb|AAP73845.1| putative phospholipase [Oryza sativa (japonica cultivar-group)]
          Length = 820

 Score =  233 bits (593), Expect = 5e-60
 Identities = 143/326 (43%), Positives = 186/326 (56%), Gaps = 32/326 (9%)
 Frame = +1

Query: 13   DLFSRLDEFD--GGFFSNSRAVELVQHLINKGSLQDMSDMIKKLRGLMGDATFLEAY*RT 186
            D    L  FD  GG F+ ++ V      +  G+L D+S M + LR L G+ TF EAY  T
Sbjct: 285  DSLQTLQFFDRIGGIFAVTKRV------MTYGALHDISQMQRLLRDLTGNLTFQEAYDMT 338

Query: 187  GRILNVTVCPADTNEPTWVLNYLTAPNALIWSAGAASSAFPGLYPAQHILGRNSRGEIIR 366
            GR+L VTVC    NEP   LNYLT+P+ +IWSA  AS AFPGL+ AQ ++ +N  GEI+ 
Sbjct: 339  GRVLGVTVCSPRKNEPPRCLNYLTSPHVVIWSAVTASCAFPGLFEAQELMAKNRFGEIVP 398

Query: 367  FSAQSTND------SLERRWRDGSLELDLPVQALGEMFNCNHFLVSQTNPHIVPLLNLKK 528
            F A  + D      + +RRWRDGSLE+DLP+  L E+FN NHF+VSQTNPHI PLL LK+
Sbjct: 399  FHAPFSTDPEQGPGASKRRWRDGSLEMDLPMMQLKELFNVNHFIVSQTNPHISPLLRLKE 458

Query: 529  ALSR-------KWANVLEAELKHRC-QVAQWLLPEWVPSKWLMLFTQAWEGDITMTLPSA 684
             ++        K A + E E+K+RC Q+ +  LP    +K   LF Q WEGD+TM +P+ 
Sbjct: 459  IVTTYGGRFAGKLARLAEMEVKYRCNQILEIGLPLGGLAK---LFAQDWEGDVTMVMPAT 515

Query: 685  LWHLSKTIVNPTTEELIRNVKVGEVDTWEKISAIECNCSIEATLDKCLA----------- 831
                 K I NPT  EL      G   TWEKISAI  NC+IE  LD+ +A           
Sbjct: 516  AAQYLKIIQNPTYAELQMAANQGRRCTWEKISAIRTNCAIELALDESIAVLNHKRRLKRS 575

Query: 832  --NIANQVRGYRLQ---RMHNRIPSW 894
               +A+  +GY      R   R+PSW
Sbjct: 576  MERVASASQGYTCSSVIRTPRRVPSW 601

>ref|NP_196024.1| patatin-related [Arabidopsis thaliana] gi|11282314|pir||T48431
            hypothetical protein F8F6.250 - Arabidopsis thaliana
            gi|7406414|emb|CAB85524.1| putative protein [Arabidopsis
            thaliana] gi|22531263|gb|AAM97135.1| putative protein
            [Arabidopsis thaliana]
          Length = 825

 Score =  223 bits (569), Expect = 3e-57
 Identities = 136/316 (43%), Positives = 183/316 (57%), Gaps = 15/316 (4%)
 Frame = +1

Query: 43   GGFFSNSRAVELVQHLINKGSLQDMSDMIKKLRGLMGDATFLEAY*RTGRILNVTVCPAD 222
            GG FS      +V+ ++ +G+L D+  +   LR L  + TF EAY  TGRIL +TVC   
Sbjct: 300  GGVFS------IVKRVMTQGALHDIRQLQCMLRNLTSNLTFQEAYDMTGRILGITVCSPR 353

Query: 223  TNEPTWVLNYLTAPNALIWSAGAASSAFPGLYPAQHILGRNSRGEIIRFSAQ-------S 381
             +EP   LNYLT+P+ +IWSA  AS AFPGL+ AQ ++ ++  GEI+ +           
Sbjct: 354  KHEPPRCLNYLTSPHVVIWSAVTASCAFPGLFEAQELMAKDRSGEIVPYHPPFNLDPEVG 413

Query: 382  TNDSLERRWRDGSLELDLPVQALGEMFNCNHFLVSQTNPHIVPLLNLKKAL-------SR 540
            T  S  RRWRDGSLE+DLP+  L E+FN NHF+VSQ NPHI PLL LK  +       + 
Sbjct: 414  TKSSSGRRWRDGSLEVDLPMMQLKELFNVNHFIVSQANPHIAPLLRLKDLVRAYGGRFAA 473

Query: 541  KWANVLEAELKHRC-QVAQWLLPEWVPSKWLMLFTQAWEGDITMTLPSALWHLSKTIVNP 717
            K A+++E E+KHRC QV +   P    +K   LF Q WEGD+T+ +P+ L   SK I NP
Sbjct: 474  KLAHLVEMEVKHRCNQVLELGFPLGGLAK---LFAQEWEGDVTVVMPATLAQYSKIIQNP 530

Query: 718  TTEELIRNVKVGEVDTWEKISAIECNCSIEATLDKCLANIANQVRGYRLQRMHNRIPSWL 897
            T  EL +    G   TWEK+SAI+ NC IE  LD  +A I N +R  RL++   R  +  
Sbjct: 531  THVELQKAANQGRRCTWEKLSAIKSNCGIELALDDSVA-ILNHMR--RLKKSAERAATAT 587

Query: 898  HMSAVGLPAVVSWGDS 945
              S  GL +   +  S
Sbjct: 588  SSSHHGLASTTRFNAS 603

>dbj|BAB61223.1| contains EST AU057376(S21389)~similar to Arabidopsis thaliana
            chromosome 5, F8F6.250~unknown protein [Oryza sativa
            (japonica cultivar-group)] gi|20804680|dbj|BAB92368.1|
            P0512C01.22 [Oryza sativa (japonica cultivar-group)]
          Length = 1044

 Score =  219 bits (559), Expect = 4e-56
 Identities = 127/283 (44%), Positives = 172/283 (59%), Gaps = 14/283 (4%)
 Frame = +1

Query: 76   LVQHLINKGSLQDMSDMIKKLRGLMGDATFLEAY*RTGRILNVTVCPADTNEPTWVLNYL 255
            +V+ ++  G++ D+  +   LR L  + TF EAY  TGRIL VTVC    +EP   LNYL
Sbjct: 306  VVKRILTHGAVHDIRHLQTLLRNLTSNLTFQEAYDMTGRILVVTVCSPRKHEPPRCLNYL 365

Query: 256  TAPNALIWSAGAASSAFPGLYPAQHILGRNSRGEIIRFSA------QSTNDSLERRWRDG 417
            T+P+ LIWSA  AS AFPGL+ AQ ++ ++  GE + F A      +    +  RRWRDG
Sbjct: 366  TSPHVLIWSAVTASCAFPGLFEAQELMAKDRFGETVPFHAPFLLGLEERVGATTRRWRDG 425

Query: 418  SLELDLPVQALGEMFNCNHFLVSQTNPHIVPLLNLKK-------ALSRKWANVLEAELKH 576
            SLE DLP++ L E+FN NHF+VSQ NPHI PLL LK+       + + K A + E E+KH
Sbjct: 426  SLESDLPMKQLKELFNVNHFIVSQANPHIAPLLRLKEIIRAYGGSFAAKLAELAEMEVKH 485

Query: 577  RC-QVAQWLLPEWVPSKWLMLFTQAWEGDITMTLPSALWHLSKTIVNPTTEELIRNVKVG 753
            RC Q+ +   P    +K   LF Q WEGD+T+ +P+ L   SK I NP+  EL +    G
Sbjct: 486  RCNQILELGFPLGGIAK---LFAQDWEGDVTVVMPATLAQYSKIIQNPSYAELQKAANQG 542

Query: 754  EVDTWEKISAIECNCSIEATLDKCLANIANQVRGYRLQRMHNR 882
               TWEK+SAI  NC+IE  LD+C+A + N +R  RL+R   R
Sbjct: 543  RRCTWEKLSAIRANCAIELVLDECVA-LLNHMR--RLKRSAER 582

>ref|NP_191273.1| patatin-related [Arabidopsis thaliana] gi|11282313|pir||T47774
            hypothetical protein F24I3.220 - Arabidopsis thaliana
            gi|6911884|emb|CAB72184.1| putative protein [Arabidopsis
            thaliana] gi|26450904|dbj|BAC42559.1| unknown protein
            [Arabidopsis thaliana] gi|29029050|gb|AAO64904.1|
            At3g57140 [Arabidopsis thaliana]
          Length = 801

 Score =  207 bits (528), Expect = 2e-52
 Identities = 122/302 (40%), Positives = 175/302 (57%), Gaps = 13/302 (4%)
 Frame = +1

Query: 43   GGFFSNSRAVELVQHLINKGSLQDMSDMIKKLRGLMGDATFLEAY*RTGRILNVTVCPAD 222
            GG F+       V+ ++ +G++ ++  +  KLR L  + TF EAY  TGRIL +TVC   
Sbjct: 301  GGIFTT------VKRVMTQGAVHEIRHLQWKLRNLTNNLTFQEAYDITGRILGITVCSLR 354

Query: 223  TNEPTWVLNYLTAPNALIWSAGAASSAFPGLYPAQHILGRNSRGEIIRFSAQSTNDSLE- 399
             +EP   LNYLT+P+ +IWSA  AS AFPGL+ AQ ++ ++  GEI+ +      D  E 
Sbjct: 355  KHEPPRCLNYLTSPHVVIWSAVTASCAFPGLFEAQELMAKDRTGEIVPYHPPFNLDPEEG 414

Query: 400  ----RRWRDGSLELDLPVQALGEMFNCNHFLVSQTNPHIVPLLNLKK-------ALSRKW 546
                RRWRDGSLE+DLP+  L E+FN NHF+VSQ NPHI P L +K+         + K 
Sbjct: 415  SASVRRWRDGSLEMDLPMIQLKELFNVNHFIVSQANPHIAPFLRMKEFVRACGGRFAAKL 474

Query: 547  ANVLEAELKHRC-QVAQWLLPEWVPSKWLMLFTQAWEGDITMTLPSALWHLSKTIVNPTT 723
            A + E E+KHRC QV +  LP     +   LF Q WEGD+T+ +P+      K I NP+ 
Sbjct: 475  AQLAEMEVKHRCNQVLELGLP---LREVASLFAQEWEGDVTIVMPATFSQYLKIIQNPSN 531

Query: 724  EELIRNVKVGEVDTWEKISAIECNCSIEATLDKCLANIANQVRGYRLQRMHNRIPSWLHM 903
             E+ +    G   TWEK++ I+ N  IE  LD+C+  + N +R  RL+R   R  ++  +
Sbjct: 532  VEIQKAANQGRRCTWEKLAVIKANFGIELALDECV-TVLNHMR--RLKRSAERAAAFSAI 588

Query: 904  SA 909
            S+
Sbjct: 589  SS 590

>ref|XP_332099.1| hypothetical protein [Neurospora crassa] gi|28920133|gb|EAA29514.1|
            hypothetical protein [Neurospora crassa]
          Length = 802

 Score =  153 bits (387), Expect = 4e-36
 Identities = 100/294 (34%), Positives = 150/294 (51%), Gaps = 24/294 (8%)
 Frame = +1

Query: 19   FSRLDEFDGGFFSNSRAVELVQHLINKGSLQDMSDMIKKLRGLMGDATFLEAY*RTGRIL 198
            +  LD F G    N    + ++ L+ +GS  D++++ + +R ++GD TF EAY RT RI 
Sbjct: 290  YGDLDVFKG---PNDGISDSLRRLLTQGSWADITNLTRVMRSMLGDLTFQEAYNRTRRIC 346

Query: 199  NVTVCPADTNEPTWVLNYLTAPNALIWSAGAASSAFPGLYPAQHILGRNSRGEIIRFSAQ 378
            N+ V  A   E   +LNY+TAPN +IWSA AAS + P ++ A  +L ++         A 
Sbjct: 347  NICVSTASIYELPRLLNYITAPNVMIWSAVAASCSVPLVFQAAPLLVKDPAT-----GAH 401

Query: 379  STNDSLERRWRDGSLELDLPVQALGEMFNCNHFLVSQTNPHIVPLLNLKKAL-------- 534
               +   +RW DGS++ DLP+  L EMFN NHF+VSQ NPHIVP L+    L        
Sbjct: 402  VPWNPTPQRWIDGSVDNDLPMTRLAEMFNVNHFIVSQVNPHIVPFLSKDDRLYPRNHPGR 461

Query: 535  -----------SRKWANVLEAELKHRCQVAQWLLPEW-----VPSKWLMLFTQAWEGDIT 666
                       + +W   L    K         L E+     + +K   + +Q + GDIT
Sbjct: 462  LRQQKAAAQENNSEWLYYLTTLAKDEAVHRLHFLTEFGIFPGLLTKLRSILSQRYSGDIT 521

Query: 667  MTLPSALWHLSKTIVNPTTEELIRNVKVGEVDTWEKISAIECNCSIEATLDKCL 828
            +     L  L + + NPT+E ++RN  +GE  TW K+S I    +IE  LD+ +
Sbjct: 522  ILPELELQDLPRILKNPTSEFMMRNCLIGERATWPKLSRIRDRLAIELALDQAV 575



EST assemble image


clone accession position
1 CL01c01_r AV393337 1 450
2 CL46b10_r AV395664 92 589
3 CL20d10_r AV394324 450 680
4 CL45f08_r AV397765 456 944
5 HCL018a09_r AV640542 599 1061




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research