KCC000010A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000010A_C01 KCC000010A_c01
caggctcgtagtttcaaaagctaggcaagatggctgacgcCGCCGGTGACAAGAAGCGCA
CTTTCCGCAAGTTCACCTATCGCGGGGTGGACCTGGACCAGCTGCTGGACATGAAGACCA
GCGACTACGTTCAGCTGTTCGCCGCTCGTCAGCGCCGCCGCTTCCAGCGCGGTCTGAAGC
GGAAGCACCAGTCCTTCATCGTCAAGCTCCGCAAGGTGAAGAAGCTGGCGGCCAGCGGCG
AGAAGCCGGAGCCTGTGCGCACGCACCTGCGCAACATGATTGTGGTGCCGGAGATGATTG
GCTCCGTCGTGGGCGTCTACAACGGCAAGACCTTCAACCAGGTGGAGATTAAGCCCGAGA
TGGTCGGCCACTACCTGGCTGAGTTCTCCATCTCCTACAAGCCCGTGAAGCACGGCCGCC
CGGGTATCGGCGCGACTCACTCGTCGCGCTTCATCCCGCTCAAGTAAATGGACTTCGTGT
GGGCTCGGACCGGCGGGGAGGCGGCCGCCCCCTGAGCTCCCCGCCCTGCGGTGGAACGGC
GTGTAACGGGTGAAATTGAAAAAAA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000010A_C01 KCC000010A_c01
         (565 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAO37527.1| putative ribosomal protein S15 [Oryza sativa (jap...   244  6e-64
dbj|BAC24881.1| putative 40S ribosomal protein S15 [Oryza sativa...   243  1e-63
sp|Q945U1|RS15_ELAOL 40S ribosomal protein S15 gi|15425963|gb|AA...   239  2e-62
sp|O65059|RS15_PICMA 40S ribosomal protein S15 gi|25294846|pir||...   236  2e-61
gb|AAL32040.1|AF439281_1 ribosomal S15 protein [Retama raetam]        235  3e-61

>gb|AAO37527.1| putative ribosomal protein S15 [Oryza sativa (japonica
           cultivar-group)] gi|31126745|gb|AAP44665.1| putative 40S
           ribosomal protein S15 [Oryza sativa (japonica
           cultivar-group)]
          Length = 154

 Score =  244 bits (623), Expect = 6e-64
 Identities = 120/146 (82%), Positives = 129/146 (88%)
 Frame = +3

Query: 27  KMADAAGDKKRTFRKFTYRGVDLDQLLDMKTSDYVQLFAARQRRRFQRGLKRKHQSFIVK 206
           ++A A   KKRTFRK++YRGVDLD LLDM T D VQLF AR RRRFQRGLKRK  + I K
Sbjct: 9   EVAAAGAPKKRTFRKYSYRGVDLDALLDMSTDDLVQLFPARARRRFQRGLKRKPMALIKK 68

Query: 207 LRKVKKLAASGEKPEPVRTHLRNMIVVPEMIGSVVGVYNGKTFNQVEIKPEMVGHYLAEF 386
           LRK KK A +GEKPEPVRTHLRNMI+VPEMIGS+VGVYNGKTFNQVEIKPEM+GHYLAEF
Sbjct: 69  LRKAKKDAPAGEKPEPVRTHLRNMIIVPEMIGSIVGVYNGKTFNQVEIKPEMIGHYLAEF 128

Query: 387 SISYKPVKHGRPGIGATHSSRFIPLK 464
           SISYKPVKHGRPGIGATHSSRFIPLK
Sbjct: 129 SISYKPVKHGRPGIGATHSSRFIPLK 154

>dbj|BAC24881.1| putative 40S ribosomal protein S15 [Oryza sativa (japonica
           cultivar-group)]
          Length = 222

 Score =  243 bits (621), Expect = 1e-63
 Identities = 120/146 (82%), Positives = 129/146 (88%)
 Frame = +3

Query: 27  KMADAAGDKKRTFRKFTYRGVDLDQLLDMKTSDYVQLFAARQRRRFQRGLKRKHQSFIVK 206
           ++A  A  KKRTFRK++YRGVDLD LLDM T D VQLF AR RRRFQRGLKRK  + I K
Sbjct: 77  EVAAGAQPKKRTFRKYSYRGVDLDALLDMSTDDLVQLFPARARRRFQRGLKRKPMALIKK 136

Query: 207 LRKVKKLAASGEKPEPVRTHLRNMIVVPEMIGSVVGVYNGKTFNQVEIKPEMVGHYLAEF 386
           LRK KK A +GEKPEPVRTHLRNMI+VPEMIGS+VGVYNGKTFNQVEIKPEM+GHYLAEF
Sbjct: 137 LRKAKKDAPAGEKPEPVRTHLRNMIIVPEMIGSIVGVYNGKTFNQVEIKPEMIGHYLAEF 196

Query: 387 SISYKPVKHGRPGIGATHSSRFIPLK 464
           SISYKPVKHGRPGIGATHSSRFIPLK
Sbjct: 197 SISYKPVKHGRPGIGATHSSRFIPLK 222

>sp|Q945U1|RS15_ELAOL 40S ribosomal protein S15 gi|15425963|gb|AAK97632.1| 40S ribosomal
           protein S15 [Elaeis oleifera]
          Length = 153

 Score =  239 bits (609), Expect = 2e-62
 Identities = 117/141 (82%), Positives = 126/141 (88%)
 Frame = +3

Query: 42  AGDKKRTFRKFTYRGVDLDQLLDMKTSDYVQLFAARQRRRFQRGLKRKHQSFIVKLRKVK 221
           A  KKRTFRKF+YRGVDLDQLLDM T + V+LF AR RRRFQRGLKRK  + I KLRK K
Sbjct: 13  AQPKKRTFRKFSYRGVDLDQLLDMGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAK 72

Query: 222 KLAASGEKPEPVRTHLRNMIVVPEMIGSVVGVYNGKTFNQVEIKPEMVGHYLAEFSISYK 401
           + A  GEKPEPVRTHLRNMI+VPEMIGS++GVYNGKTFNQVEIKPEM+GHYLAEFSISYK
Sbjct: 73  RDAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYK 132

Query: 402 PVKHGRPGIGATHSSRFIPLK 464
           PVKHGRPGIGATHSSRFIPLK
Sbjct: 133 PVKHGRPGIGATHSSRFIPLK 153

>sp|O65059|RS15_PICMA 40S ribosomal protein S15 gi|25294846|pir||T51960 probable 40S
           ribosomal protein S15 [imported] - Picea mariana
           gi|2982268|gb|AAC32121.1| probable 40S ribosomal protein
           S15 [Picea mariana]
          Length = 151

 Score =  236 bits (601), Expect = 2e-61
 Identities = 118/151 (78%), Positives = 130/151 (85%), Gaps = 6/151 (3%)
 Frame = +3

Query: 30  MADAAGD------KKRTFRKFTYRGVDLDQLLDMKTSDYVQLFAARQRRRFQRGLKRKHQ 191
           MADA  D      KKRTF+KF+YRGVDLD LLDM + + V+LF AR RRRFQRGLKR+  
Sbjct: 1   MADADVDVGPVQPKKRTFKKFSYRGVDLDALLDMTSEELVKLFHARARRRFQRGLKRQPM 60

Query: 192 SFIVKLRKVKKLAASGEKPEPVRTHLRNMIVVPEMIGSVVGVYNGKTFNQVEIKPEMVGH 371
           + I KLRK K+ A SGEKPEPVRTHLRNMI+VPEMIGS++GVYNGKTFNQVEIKPEM+GH
Sbjct: 61  ALIKKLRKAKREAPSGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGH 120

Query: 372 YLAEFSISYKPVKHGRPGIGATHSSRFIPLK 464
           YLAEFSISYKPVKHGRPGIGATHSSRFIPLK
Sbjct: 121 YLAEFSISYKPVKHGRPGIGATHSSRFIPLK 151

>gb|AAL32040.1|AF439281_1 ribosomal S15 protein [Retama raetam]
          Length = 139

 Score =  235 bits (600), Expect = 3e-61
 Identities = 113/138 (81%), Positives = 124/138 (88%)
 Frame = +3

Query: 51  KKRTFRKFTYRGVDLDQLLDMKTSDYVQLFAARQRRRFQRGLKRKHQSFIVKLRKVKKLA 230
           KKRTF+KF++RGVDLD LLDM T D V+LF+AR RRRFQRGL RK  + I KLRK K+ A
Sbjct: 2   KKRTFKKFSFRGVDLDALLDMSTDDLVKLFSARARRRFQRGLTRKPMALIKKLRKAKREA 61

Query: 231 ASGEKPEPVRTHLRNMIVVPEMIGSVVGVYNGKTFNQVEIKPEMVGHYLAEFSISYKPVK 410
             GEKPEPVRTHLRNMI+VPEMIGS++GVYNGKTFNQVEIKPEM+GHYLAEFSISYKPVK
Sbjct: 62  PQGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVK 121

Query: 411 HGRPGIGATHSSRFIPLK 464
           HGRPGIGATHSSRFIPLK
Sbjct: 122 HGRPGIGATHSSRFIPLK 139



EST assemble image


clone accession position
1 CL01b11_r AV393336 1 117
2 CL57g03_r AV396301 13 543
3 CL16g01_r AV393994 13 543
4 CL01f01_r AV393348 15 545
5 CL01f05_r AV393351 15 551
6 HCL099h09_r AV645227 15 413
7 HCL097d03_r AV645042 16 445
8 CL20e12_r AV394291 21 496
9 CL65f12_r AV396607 41 570
10 CM011g12_r AV386922 44 396
11 CL63c02_r AV396529 46 565
12 HCL098a04_r AV645081 65 486
13 CL09c09_r AV393715 91 559
14 CM071g03_r AV391320 95 559
15 CM085h01_r AV392368 218 528




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research