KCC000009A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000009A_C01 KCC000009A_c01
GCACGAGGTCTCATCCATTTCCCGAGGCGTCTGACTCGCGGCAAGCTCTACAAGATGGCC
ACCAAGGCAGGTGTTGAGAAGGCTGGTGTTGAGGCGGAGGCTCCCCAGGTGCACCGCATC
CGCATCACCCTGACCTCCAAGAACGTGAAGAACCTGGAGAAGGTCTGCGCTGACCTGATC
AAGGGTGCCAAGGAGAAGCAGCTGAAGGTGAAGGGCCCCGTGCGCATGCCCACCAAGGTG
CTGCGCATCACCACCCGCAAGGCCCCCTCGGGTCAGGGTACCAACACCTTCGACCGCTTC
GAGATGCGCATCCACAAGCGCCTGATCGACCTGCACTCGCCCGCCGATGTGGTCAAGCAG
ATCACCTCGATCAGCATTGAGCCCGGCGTTGAGGTGGAGGTGACCATTGCCGACATGTAA
AGTGCTGGCAGCACCGATCAGAACAGACCTCTTATCGTTTGTGTAACGTGACCGGGGTGC
CCCAAAAAAAACAACAACACCAAAAACAAAAAAAAAAAACCCGCTTTCAAGAACCCGCCC
AAGGGCCTCCGGGATCCATCCCCCTCC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000009A_C01 KCC000009A_c01
         (567 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM28852.1|AF503586_1 ribosomal protein S20 [Branchiostoma be...   184  9e-46
emb|CAC44156.1| putative 40S ribosomal protein 20S protein [Onco...   182  2e-45
ref|NP_190321.1| 40S ribosomal protein S20 (RPS20B) [Arabidopsis...   182  2e-45
gb|AAM94275.1| ribosomal protein S20 [Chlamys farreri]                182  3e-45
ref|NP_201036.1| 40S ribosomal protein S20 (RPS20C) [Arabidopsis...   181  8e-45

>gb|AAM28852.1|AF503586_1 ribosomal protein S20 [Branchiostoma belcheri tsingtaunese]
          Length = 121

 Score =  184 bits (466), Expect = 9e-46
 Identities = 89/120 (74%), Positives = 105/120 (87%)
 Frame = +1

Query: 55  MATKAGVEKAGVEAEAPQVHRIRITLTSKNVKNLEKVCADLIKGAKEKQLKVKGPVRMPT 234
           MA + G +      E  Q+HRIRITLTS+NVK+LEKVCADLI+GAKEK L+VKGPVRMPT
Sbjct: 1   MAYQKGADSGKAPMEETQIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLQVKGPVRMPT 60

Query: 235 KVLRITTRKAPSGQGTNTFDRFEMRIHKRLIDLHSPADVVKQITSISIEPGVEVEVTIAD 414
           K+LRITTRK P G+G+ T+DR++MRIHKRLIDLHSP+++VKQITSISIEPGVEVEVTIAD
Sbjct: 61  KILRITTRKTPCGEGSKTWDRYQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIAD 120

>emb|CAC44156.1| putative 40S ribosomal protein 20S protein [Oncorhynchus mykiss]
          Length = 119

 Score =  182 bits (463), Expect = 2e-45
 Identities = 92/112 (82%), Positives = 103/112 (91%)
 Frame = +1

Query: 79  KAGVEAEAPQVHRIRITLTSKNVKNLEKVCADLIKGAKEKQLKVKGPVRMPTKVLRITTR 258
           KA VEAE   +HRIRITLTS+NVK+LEKVCADLI+GAKEK LKVKGPVRMPTK LRITTR
Sbjct: 8   KAPVEAEVA-IHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTR 66

Query: 259 KAPSGQGTNTFDRFEMRIHKRLIDLHSPADVVKQITSISIEPGVEVEVTIAD 414
           K P G+G+ T+DRF+MRIHKRLIDLHSP+++VKQITSISIEPGVEVEVTIAD
Sbjct: 67  KTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIAD 118

>ref|NP_190321.1| 40S ribosomal protein S20 (RPS20B) [Arabidopsis thaliana]
           gi|30692858|ref|NP_850665.1| 40S ribosomal protein S20
           (RPS20B) [Arabidopsis thaliana] gi|7440305|pir||T12992
           ribosomal protein S20, cytosolic - Arabidopsis thaliana
           gi|5541704|emb|CAB51209.1| 40S RIBOSOMAL PROTEIN S20
           homolog [Arabidopsis thaliana]
           gi|21617905|gb|AAM66955.1| 40S ribosomal protein
           S20-like protein [Arabidopsis thaliana]
           gi|27765022|gb|AAO23632.1| At3g47370 [Arabidopsis
           thaliana]
          Length = 122

 Score =  182 bits (463), Expect = 2e-45
 Identities = 88/112 (78%), Positives = 104/112 (92%)
 Frame = +1

Query: 79  KAGVEAEAPQVHRIRITLTSKNVKNLEKVCADLIKGAKEKQLKVKGPVRMPTKVLRITTR 258
           KAG+EA   Q+H+IRITL+SKNVKNLEKVC DL++GAK+K+L+VKGPVRMPTKVL+ITTR
Sbjct: 10  KAGLEAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTR 69

Query: 259 KAPSGQGTNTFDRFEMRIHKRLIDLHSPADVVKQITSISIEPGVEVEVTIAD 414
           KAP G+GTNT+DRFE+R+HKR+IDL S  DVVKQITSI+IEPGVEVEVTIAD
Sbjct: 70  KAPCGEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIAD 121

>gb|AAM94275.1| ribosomal protein S20 [Chlamys farreri]
          Length = 117

 Score =  182 bits (462), Expect = 3e-45
 Identities = 89/107 (83%), Positives = 101/107 (94%)
 Frame = +1

Query: 94  AEAPQVHRIRITLTSKNVKNLEKVCADLIKGAKEKQLKVKGPVRMPTKVLRITTRKAPSG 273
           AE   +HRIRITLTS+NVK+LEKVCADLIKGAK+KQLKVKGPVRMPTKVLRITTRK P G
Sbjct: 10  AEEAPIHRIRITLTSRNVKSLEKVCADLIKGAKDKQLKVKGPVRMPTKVLRITTRKTPCG 69

Query: 274 QGTNTFDRFEMRIHKRLIDLHSPADVVKQITSISIEPGVEVEVTIAD 414
           +G+ ++DRF+MRIHKRLIDLHSP+++VKQITSISIEPGVEVEVTIAD
Sbjct: 70  EGSKSWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIAD 116

>ref|NP_201036.1| 40S ribosomal protein S20 (RPS20C) [Arabidopsis thaliana]
           gi|22331606|ref|NP_190089.2| 40S ribosomal protein S20
           (RPS20A) [Arabidopsis thaliana]
           gi|21542443|sp|P49200|RS20_ARATH 40S ribosomal protein
           S20 gi|11762182|gb|AAG40369.1|AF325017_1 AT5g62300
           [Arabidopsis thaliana]
           gi|13877519|gb|AAK43837.1|AF370460_1 40S ribosomal
           protein S20 [Arabidopsis thaliana]
           gi|20465624|gb|AAM20143.1| putative 40S ribsomomal
           protein [Arabidopsis thaliana]
           gi|21281054|gb|AAM45072.1| putative 40S ribsomomal
           protein [Arabidopsis thaliana]
           gi|21553799|gb|AAM62892.1| ribosomal protein S20-like
           protein [Arabidopsis thaliana]
          Length = 124

 Score =  181 bits (458), Expect = 8e-45
 Identities = 87/112 (77%), Positives = 103/112 (91%)
 Frame = +1

Query: 79  KAGVEAEAPQVHRIRITLTSKNVKNLEKVCADLIKGAKEKQLKVKGPVRMPTKVLRITTR 258
           KAG+E    Q+H+IRITL+SKNVKNLEKVC DL++GAK+K+L+VKGPVRMPTKVL+ITTR
Sbjct: 12  KAGLEEPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTR 71

Query: 259 KAPSGQGTNTFDRFEMRIHKRLIDLHSPADVVKQITSISIEPGVEVEVTIAD 414
           KAP G+GTNT+DRFE+R+HKR+IDL S  DVVKQITSI+IEPGVEVEVTIAD
Sbjct: 72  KAPCGEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIAD 123



EST assemble image


clone accession position
1 CM026b10_r AV387504 1 567
2 CL11f09_r AV393798 1 479
3 CL57g06_r AV396257 10 540
4 HCL099d05_r AV645189 12 384
5 CL01b10_r AV393335 15 509
6 CL27c03_r AV394724 21 481
7 CL18h12_r AV394095 25 457
8 CL11d12_r AV393795 31 479
9 HCL091a03_r AV644591 228 480




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research