KCC000008A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000008A_C01 KCC000008A_c01
AAGTCAGTACCTTTCAAACTAGGTACTTGTAGACTATCTCTAGGTAGTCTCACACAGTCG
CAGCTAAAATGCAGACCATGCTGAAGCAGCGCTGCCAGGCCGGCCGTCGGCAAGCAGGCC
AAGGCTGTGCCCGCTGTGGCCCCCAAGGGTCGGCCGTGCCCGCAACGTGGTGGTTGCTCA
GGCTGCCCCCGCTGCTGCCAAGGCCCGCTGCCCCGTCGATCTCTCGCGATGAGGTGGAGA
AGTGCATCAATGCCATCCGCTTCCTGGCTATCGACGCCATCAACAAGTCCAAGTCGGGCC
ACCCCGGCATGCCCATGGGCTGCGCTCCTATGGGCTACGTTCTGTGGAACGAGGTCATGA
AGTATAACCCCAAGAACCCCGACTTCTTCAACCGCGACCGCTTCGTGCTGTCCGCCGGCC
ACGGCTCCATGTTCCAGTACTCCATGATGCACCTGACTGGCTACGACTCCGTGCCGCTGG
ACCAGATCAAGCAGTTCCGCCAGTGGAACTCCCTGACCCCCGGGCCACCCGGAGAACTTC
GTGACTCCCGGCGTGGAGGTGACCACTGGTCCCCTGGGCCAGGGTATCTGCAACGCCGTC
GGCCTGGCCGTGGCTGAGGCCCACCTGGCTGCCCGCTTCAACAAGCCGGACGTCAAGCCC
ATCGTGGACCACTACACCTACTGCATCCTGGGTGACGGCTGCATGATGGAGGGCATCTCC
AACGAGGCCTGCTCGCTGGCCGGCCACTGGGGCCTGGGCAAGCTGATTGCCCTGTATGAC
GACAACAAGATCTCGATCGACGGCCACACCGACATCTCGTTCACCGAGGACGTGGCCAAG
CGCTACGAGGCGCTGGGCTGGCACGTGATCCACGTGATCAACGGCAACACCGACGTGGAC
GGCCTGCGCGCCGCCATTGCTCAGGCCAAGGCCGTCAAGGACAAGCCCACTCTGATCAAG
GTGTCCACCCTGATCGGCTACGGCTCGCCCAACAAGGCCGACTCGCACGACGTGCACGGC
GCCCCCCTGGGCCCCGATGAGACCGCCGCCACCCGCAAGAACCTGAACTGGCCCTACGGC
GAGTTCGAGGTGCCCCAGGACGTGTACGACGTCTTCCGCGGCGCCATCAAGCGCGGTGCC
GAGGAGGAGGCCAACTGGCACAAGGCCTGCGCCGAGTACAAGGCCAAGTACCCCAAGGAG
TGGGCTGAGTTCGAGGCCCTGACCAGCTGCAAGCTGCCCGAGAACTGGGAGGCTGCTCTG
CCCCACTTCAAGCCCGAGGACAAGGGCCTGGCCACCCGCCAGCACAGCCAGACCATGATC
AACGCCCTGGCGCCCGCGCTGCCCGGCCTGATCGGTGGCTCGGCCGACCTGGCCCCCTCC
AACCTGACCCTGATGAAGATCTCTGGCGACTTCCAGAAGGGCAGCTATGCCGAGCGCAAC
CTGCGCTTCGGTGTGCGTGAGCACGCCATGGGCGCCATCTGCAACGGCATTGCCCTGCAC
AAGTCGGGCCTGATCCCCTACTGCGCCACCTTCTACATCTTCACCGACTACATGCGCAAC
GCCATGCGCATGTCTGCCCTGTCGGAGGCCGGAGTCGTCTACGTCATGACCCACGACTCT
ATCGGCCTGGGCGAGGACGGCCCCACTCACCAGCCTATTGAGCACCTGGCGTCGTTCCGC
GCCATGCCCGACATGCTGATGATCCGCCCCGCCGGCGGCAACGAGACCGCCGGTGCCTAC
AAGGTGGCCATTGCCAACCGCAAGCGCCCCACCACCATCGCCCTGTCTCGCCAGAACATG
CCGAACATCCCCAACTGCTCGGTTGAGTGGCGTGGCCAAGGGTGCCTACACCATCCACGA
CACCAAGGCCGGCGTCAAGCCCGACGTGATCCTGATGGGCACCGGCTCTGAGCTGGAGCT
GGCCACCGCCGCCGCCGGCATCCTGGAGAAGGAGGGCAAGAACGTGCGCGTCGTGTCCTT
CCCCTGGCTGGGAGCTGTTCGAGGAGCAGTCGGCCGAGTACAAGGAGAGCGTGCTGCCCT
CCGACGTGACCGCCCGCGTGTCCGTTGAGGCCGCCACCAGCTTCGGCTGGGCCAAGTACA
TCGGCCTGAAGGGCAAGCACGTCGGCATTGACACCTTCGGTGCCTCGGCCCCCGCCCCCA
CCCTGTACGAGAAGTTCGGCATCACCGTGAACCACGTGGTGGAGGCCGCCAAGGCCACCC
TGCAGCACTAAGCGGCTCATGGTTGGAAGGCGCCTGTGGTGATGATAACGCCGGCATGTC
CGCAGGAGCAGCAGCGGCGCGAGCAGTGGCTGCGGATGCGGTAGCGGCGGCGTCAGAGAA
CCGGCGCCGGCGGAGCAGCGCGTTGCAGCGGTGTTGGGGAGGTGGAGAAGCTGGCACAGC
GATCAGACTCGCGTTTGCATGGCGGCGTGGCTGTTGGGCGGCGCATGTGTTGAAGAGACA
TTGCGTGGCCCTGGCCTGCGTTGTGGATGGGGTTGGAGCATTTGTTGGTTGCGGCGGCGG
CTGGGATGCCCGCCACCTCGGTTCCACAGCAATCTGCCTCGAGCGCACCCGGTTTTAGTG
TGGTGTGCGCCAGGGCAGTGGGGTGGTGGGCATTGCGCTGCGTGTAGGCACAGGAGAAGG
CGTCTTGGTGGCGCGGCGTGGCTAGGTGATGCGCCGGCGGCGCAGCAGCGCGGGACCATC
CGAGCCCTCCAATCATGGTGATGGGCCGTGCTGCAACTCCGGACGAGGAGTGAGAGTGTG
TGGTGTGGTTGGTTAAACTCGGGAGAATAGTAGGACCTATGATAGAGGAGTCGGTGTATC
CGCTGATTTTGAAGGGCCCCGCTTTTTTGCGGCGGGTGTCGATAGTGGTGCACCCTCCCC
CCTGCAGACGGATGGGATGCCATCAGCCATATCGCCCTGCGTGGCTCCGTGGCGCGGTGT
TGTGGCGTTCCGTTGTCTGGGGGCCTGGTCGAGCGTGGGGCGAAGAGCTCTGTCGGAACT
GCATCCTCCTGGCTCGAATGGGAGTGTCCGGATAAATGCCTCGGATTGAACGCCTGTAAC
GGCAGCAGGCTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000008A_C01 KCC000008A_c01
         (3072 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_567103.1| transketolase - like protein [Arabidopsis thali...   623  0.0
gb|AAO29950.1| Unknown protein [Arabidopsis thaliana]                 622  0.0
gb|AAM62766.1| transketolase-like protein [Arabidopsis thaliana]      620  0.0
pir||T47886 transketolase-like protein - Arabidopsis thaliana gi...   616  0.0
sp|Q43848|TKTC_SOLTU Transketolase, chloroplast precursor (TK) g...   622  0.0

>ref|NP_567103.1| transketolase - like protein [Arabidopsis thaliana]
            gi|20268682|gb|AAM14045.1| putative transketolase
            [Arabidopsis thaliana] gi|22136900|gb|AAM91794.1|
            putative transketolase [Arabidopsis thaliana]
          Length = 741

 Score =  623 bits (1607), Expect(4) = 0.0
 Identities = 302/436 (69%), Positives = 349/436 (79%)
 Frame = +1

Query: 520  PGHPENFVTPGVEVTTGPLGQGICNAVGLAVAEAHLAARFNKPDVKPIVDHYTYCILGDG 699
            PGHPENF TPG+EVTTGPLGQGI NAVGLA+AE HLAARFNKPD + +VDHYTY ILGDG
Sbjct: 176  PGHPENFETPGIEVTTGPLGQGIANAVGLALAEKHLAARFNKPDAE-VVDHYTYAILGDG 234

Query: 700  CMMEGISNEACSLAGHWGLGKLIALYDDNKISIDGHTDISFTEDVAKRYEALGWHVIHVI 879
            C MEGISNEACSLAGHWGLGKLIA YDDN ISIDG T+I+FTE+V +R+EALGWHVI V 
Sbjct: 235  CQMEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVK 294

Query: 880  NGNTDVDGLRAAIAQAKAVKDKPTLIKVSTLIGYGSPNKADSHDVHGAPLGPDETAATRK 1059
            NGNT  D +RAAI +AK V DKPTLIKV+T IGYGSPNKA+S+ VHGA LG  E  ATR 
Sbjct: 295  NGNTGYDEIRAAIKEAKTVTDKPTLIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRN 354

Query: 1060 NLNWPYGEFEVPQDVYDVFRGAIKRGAEEEANWHKACAEYKAKYPKEWAEFEALTSCKLP 1239
            NL WPY  F+VP DV   +      GA  E++W    A Y+ KYP+E +E +++ + +LP
Sbjct: 355  NLGWPYEPFQVPDDVKSHWSRHTPEGATLESDWSAKFAAYEKKYPEEASELKSIITGELP 414

Query: 1240 ENWEAALPHFKPEDKGLATRQHSQTMINALAPALPGLIGGSADLAPSNLTLMKISGDFQK 1419
              WE ALP + PE  G ATR  SQ  +NALA  +PG +GGSADLA SN+TL+K  GDFQK
Sbjct: 415  AGWEKALPTYTPESPGDATRNLSQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDFQK 474

Query: 1420 GSYAERNLRFGVREHAMGAICNGIALHKSGLIPYCATFYIFTDYMRNAMRMSALSEAGVV 1599
             +  ERNLRFGVREH MGAICNGIALH  GLIPYCATF++FTDYMR AMR+SALSEAGV+
Sbjct: 475  ATPEERNLRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVI 534

Query: 1600 YVMTHDSIGLGEDGPTHQPIEHLASFRAMPDMLMIRPAGGNETAGAYKVAIANRKRPTTI 1779
            YVMTHDSIGLGEDGPTHQPIEH+ASFRAMP+ LM RPA GNETAGAYK+A+  RK P+ +
Sbjct: 535  YVMTHDSIGLGEDGPTHQPIEHIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSIL 594

Query: 1780 ALSRQNMPNIPNCSVE 1827
            ALSRQ +P++P  S+E
Sbjct: 595  ALSRQKLPHLPGTSIE 610

 Score =  158 bits (399), Expect(4) = 0.0
 Identities = 69/106 (65%), Positives = 87/106 (81%)
 Frame = +3

Query: 213 PSISRDEVEKCINAIRFLAIDAINKSKSGHPGMPMGCAPMGYVLWNEVMKYNPKNPDFFN 392
           P+     V+K +N+IRFLAIDA+ K+KSGHPG+PMGCAPM ++L++EVM+YNPKNP +FN
Sbjct: 74  PTTDSSIVDKSVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFN 133

Query: 393 RDRFVLSAGHGSMFQYSMMHLTGYDSVPLDQIKQFRQWNSLTPGPP 530
           RDRFVLSAGHG M  Y+++HL GYDSV  + +KQFRQW S TPG P
Sbjct: 134 RDRFVLSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQWGSKTPGHP 179

 Score =  117 bits (294), Expect(4) = 0.0
 Identities = 55/76 (72%), Positives = 68/76 (89%)
 Frame = +3

Query: 1989 WELFEEQSAEYKESVLPSDVTARVSVEAATSFGWAKYIGLKGKHVGIDTFGASAPAPTLY 2168
            WELF+EQS EYKESVLPSDV+ARVS+EAA++FGW K +G KGK +GI++FGASAPAP LY
Sbjct: 664  WELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLY 723

Query: 2169 EKFGITVNHVVEAAKA 2216
            ++FGITV  VV+AAK+
Sbjct: 724  KEFGITVEAVVDAAKS 739

 Score = 73.6 bits (179), Expect(4) = 0.0
 Identities = 36/57 (63%), Positives = 42/57 (73%)
 Frame = +2

Query: 1811 PTARLSGVAKGAYTIHDTKAGVKPDVILMGTGSELELATAAAGILEKEGKNVRVVSF 1981
            P   + GV KG YTI D  +G KPDVIL+GTGSELE+A  AA +L K+GK VRVVSF
Sbjct: 605  PGTSIEGVEKGGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVSF 661

>gb|AAO29950.1| Unknown protein [Arabidopsis thaliana]
          Length = 741

 Score =  622 bits (1604), Expect(4) = 0.0
 Identities = 301/436 (69%), Positives = 349/436 (80%)
 Frame = +1

Query: 520  PGHPENFVTPGVEVTTGPLGQGICNAVGLAVAEAHLAARFNKPDVKPIVDHYTYCILGDG 699
            PGHPENF TPG+EVTTGPLGQGI NAVGLA+AE HLAARFNKPD + +VDHYTY ILGDG
Sbjct: 176  PGHPENFETPGIEVTTGPLGQGIANAVGLALAEKHLAARFNKPDAE-VVDHYTYAILGDG 234

Query: 700  CMMEGISNEACSLAGHWGLGKLIALYDDNKISIDGHTDISFTEDVAKRYEALGWHVIHVI 879
            C MEGISNEACSLAGHWGLGKLIA YDDN ISIDG T+I+FTE+V +R+EALGWHVI V 
Sbjct: 235  CQMEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVK 294

Query: 880  NGNTDVDGLRAAIAQAKAVKDKPTLIKVSTLIGYGSPNKADSHDVHGAPLGPDETAATRK 1059
            NGNT  D +RAAI +AK V DKPTLIKV+T IGYGSPNKA+S+ VHGA LG  E  ATR 
Sbjct: 295  NGNTGYDEIRAAIKEAKTVTDKPTLIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRN 354

Query: 1060 NLNWPYGEFEVPQDVYDVFRGAIKRGAEEEANWHKACAEYKAKYPKEWAEFEALTSCKLP 1239
            NL WPY  F+VP DV   +      GA  E++W    A Y+ KYP+E +E +++ + +LP
Sbjct: 355  NLGWPYEPFQVPDDVKSHWSRHTPEGATLESDWSAKFAAYEKKYPEEASELKSIITGELP 414

Query: 1240 ENWEAALPHFKPEDKGLATRQHSQTMINALAPALPGLIGGSADLAPSNLTLMKISGDFQK 1419
              WE ALP + PE  G ATR  SQ  +NALA  +PG +GGSADLA SN+TL+K  GDFQK
Sbjct: 415  AGWEKALPTYTPESPGDATRNLSQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDFQK 474

Query: 1420 GSYAERNLRFGVREHAMGAICNGIALHKSGLIPYCATFYIFTDYMRNAMRMSALSEAGVV 1599
             +  ERN+RFGVREH MGAICNGIALH  GLIPYCATF++FTDYMR AMR+SALSEAGV+
Sbjct: 475  ATPEERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVI 534

Query: 1600 YVMTHDSIGLGEDGPTHQPIEHLASFRAMPDMLMIRPAGGNETAGAYKVAIANRKRPTTI 1779
            YVMTHDSIGLGEDGPTHQPIEH+ASFRAMP+ LM RPA GNETAGAYK+A+  RK P+ +
Sbjct: 535  YVMTHDSIGLGEDGPTHQPIEHIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSIL 594

Query: 1780 ALSRQNMPNIPNCSVE 1827
            ALSRQ +P++P  S+E
Sbjct: 595  ALSRQKLPHLPGTSIE 610

 Score =  158 bits (399), Expect(4) = 0.0
 Identities = 69/106 (65%), Positives = 87/106 (81%)
 Frame = +3

Query: 213 PSISRDEVEKCINAIRFLAIDAINKSKSGHPGMPMGCAPMGYVLWNEVMKYNPKNPDFFN 392
           P+     V+K +N+IRFLAIDA+ K+KSGHPG+PMGCAPM ++L++EVM+YNPKNP +FN
Sbjct: 74  PTTDSSIVDKSVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFN 133

Query: 393 RDRFVLSAGHGSMFQYSMMHLTGYDSVPLDQIKQFRQWNSLTPGPP 530
           RDRFVLSAGHG M  Y+++HL GYDSV  + +KQFRQW S TPG P
Sbjct: 134 RDRFVLSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQWGSKTPGHP 179

 Score =  117 bits (294), Expect(4) = 0.0
 Identities = 55/76 (72%), Positives = 68/76 (89%)
 Frame = +3

Query: 1989 WELFEEQSAEYKESVLPSDVTARVSVEAATSFGWAKYIGLKGKHVGIDTFGASAPAPTLY 2168
            WELF+EQS EYKESVLPSDV+ARVS+EAA++FGW K +G KGK +GI++FGASAPAP LY
Sbjct: 664  WELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLY 723

Query: 2169 EKFGITVNHVVEAAKA 2216
            ++FGITV  VV+AAK+
Sbjct: 724  KEFGITVEAVVDAAKS 739

 Score = 73.6 bits (179), Expect(4) = 0.0
 Identities = 36/57 (63%), Positives = 42/57 (73%)
 Frame = +2

Query: 1811 PTARLSGVAKGAYTIHDTKAGVKPDVILMGTGSELELATAAAGILEKEGKNVRVVSF 1981
            P   + GV KG YTI D  +G KPDVIL+GTGSELE+A  AA +L K+GK VRVVSF
Sbjct: 605  PGTSIEGVEKGGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVSF 661

>gb|AAM62766.1| transketolase-like protein [Arabidopsis thaliana]
          Length = 741

 Score =  620 bits (1600), Expect(4) = 0.0
 Identities = 301/436 (69%), Positives = 348/436 (79%)
 Frame = +1

Query: 520  PGHPENFVTPGVEVTTGPLGQGICNAVGLAVAEAHLAARFNKPDVKPIVDHYTYCILGDG 699
            PGHPENF TPG+EVTTGPLGQGI NAVGLA+AE HLAARFNKPD + +VDHYTY ILGDG
Sbjct: 176  PGHPENFETPGIEVTTGPLGQGIANAVGLALAEKHLAARFNKPDAE-VVDHYTYAILGDG 234

Query: 700  CMMEGISNEACSLAGHWGLGKLIALYDDNKISIDGHTDISFTEDVAKRYEALGWHVIHVI 879
            C MEGISNEACSLAGHWGLGKLIA YDDN ISIDG T+I+FTE+V + +EALGWHVI V 
Sbjct: 235  CQMEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTENVDQLFEALGWHVIWVK 294

Query: 880  NGNTDVDGLRAAIAQAKAVKDKPTLIKVSTLIGYGSPNKADSHDVHGAPLGPDETAATRK 1059
            NGNT  D +RAAI +AK V DKPTLIKV+T IGYGSPNKA+S+ VHGA LG  E  ATR 
Sbjct: 295  NGNTGYDEIRAAIKEAKTVTDKPTLIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRN 354

Query: 1060 NLNWPYGEFEVPQDVYDVFRGAIKRGAEEEANWHKACAEYKAKYPKEWAEFEALTSCKLP 1239
            NL WPY  F+VP DV   +      GA  E++W    A Y+ KYP+E +E +++ + +LP
Sbjct: 355  NLGWPYEPFQVPDDVKSHWSRHTPEGATLESDWSAKFAAYEKKYPEEASELKSIITGELP 414

Query: 1240 ENWEAALPHFKPEDKGLATRQHSQTMINALAPALPGLIGGSADLAPSNLTLMKISGDFQK 1419
              WE ALP + PE  G ATR  SQ  +NALA  +PG +GGSADLA SN+TL+K  GDFQK
Sbjct: 415  AGWEKALPTYTPESPGDATRNLSQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDFQK 474

Query: 1420 GSYAERNLRFGVREHAMGAICNGIALHKSGLIPYCATFYIFTDYMRNAMRMSALSEAGVV 1599
             +  ERNLRFGVREH MGAICNGIALH  GLIPYCATF++FTDYMR AMR+SALSEAGV+
Sbjct: 475  ATPEERNLRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVI 534

Query: 1600 YVMTHDSIGLGEDGPTHQPIEHLASFRAMPDMLMIRPAGGNETAGAYKVAIANRKRPTTI 1779
            YVMTHDSIGLGEDGPTHQPIEH+ASFRAMP+ LM RPA GNETAGAYK+A+  RK P+ +
Sbjct: 535  YVMTHDSIGLGEDGPTHQPIEHIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSIL 594

Query: 1780 ALSRQNMPNIPNCSVE 1827
            ALSRQ +P++P  S+E
Sbjct: 595  ALSRQKLPHLPGTSIE 610

 Score =  158 bits (399), Expect(4) = 0.0
 Identities = 69/106 (65%), Positives = 87/106 (81%)
 Frame = +3

Query: 213 PSISRDEVEKCINAIRFLAIDAINKSKSGHPGMPMGCAPMGYVLWNEVMKYNPKNPDFFN 392
           P+     V+K +N+IRFLAIDA+ K+KSGHPG+PMGCAPM ++L++EVM+YNPKNP +FN
Sbjct: 74  PTTDSSIVDKSVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFN 133

Query: 393 RDRFVLSAGHGSMFQYSMMHLTGYDSVPLDQIKQFRQWNSLTPGPP 530
           RDRFVLSAGHG M  Y+++HL GYDSV  + +KQFRQW S TPG P
Sbjct: 134 RDRFVLSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQWGSKTPGHP 179

 Score =  117 bits (294), Expect(4) = 0.0
 Identities = 55/76 (72%), Positives = 68/76 (89%)
 Frame = +3

Query: 1989 WELFEEQSAEYKESVLPSDVTARVSVEAATSFGWAKYIGLKGKHVGIDTFGASAPAPTLY 2168
            WELF+EQS EYKESVLPSDV+ARVS+EAA++FGW K +G KGK +GI++FGASAPAP LY
Sbjct: 664  WELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLY 723

Query: 2169 EKFGITVNHVVEAAKA 2216
            ++FGITV  VV+AAK+
Sbjct: 724  KEFGITVEAVVDAAKS 739

 Score = 73.6 bits (179), Expect(4) = 0.0
 Identities = 36/57 (63%), Positives = 42/57 (73%)
 Frame = +2

Query: 1811 PTARLSGVAKGAYTIHDTKAGVKPDVILMGTGSELELATAAAGILEKEGKNVRVVSF 1981
            P   + GV KG YTI D  +G KPDVIL+GTGSELE+A  AA +L K+GK VRVVSF
Sbjct: 605  PGTSIEGVEKGGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVSF 661

>pir||T47886 transketolase-like protein - Arabidopsis thaliana
            gi|7329685|emb|CAB82679.1| transketolase-like protein
            [Arabidopsis thaliana]
          Length = 754

 Score =  616 bits (1588), Expect(4) = 0.0
 Identities = 302/449 (67%), Positives = 349/449 (77%), Gaps = 13/449 (2%)
 Frame = +1

Query: 520  PGHPENFVTPGVEVTTGPLGQGICNAVGLAVAEAHLAARFNKPDVKPIVDHYTYCILGDG 699
            PGHPENF TPG+EVTTGPLGQGI NAVGLA+AE HLAARFNKPD + +VDHYTY ILGDG
Sbjct: 176  PGHPENFETPGIEVTTGPLGQGIANAVGLALAEKHLAARFNKPDAE-VVDHYTYAILGDG 234

Query: 700  CMMEGISNEACSLAGHWGLGKLIALYDDNKISIDGHTDISFTEDVAKRYEALGWHVIHVI 879
            C MEGISNEACSLAGHWGLGKLIA YDDN ISIDG T+I+FTE+V +R+EALGWHVI V 
Sbjct: 235  CQMEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVK 294

Query: 880  NGNTDVDGLRAAIAQAKAVKDKPTLIKVSTLIGYGSPNKADSHDVHGAPLGPDETAATRK 1059
            NGNT  D +RAAI +AK V DKPTLIKV+T IGYGSPNKA+S+ VHGA LG  E  ATR 
Sbjct: 295  NGNTGYDEIRAAIKEAKTVTDKPTLIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRN 354

Query: 1060 NLNWPYGEFEVPQDVYDVFRGAI-------------KRGAEEEANWHKACAEYKAKYPKE 1200
            NL WPY  F+VP DV       +               GA  E++W    A Y+ KYP+E
Sbjct: 355  NLGWPYEPFQVPDDVKSCLDDLLFDLHFSSHWSRHTPEGATLESDWSAKFAAYEKKYPEE 414

Query: 1201 WAEFEALTSCKLPENWEAALPHFKPEDKGLATRQHSQTMINALAPALPGLIGGSADLAPS 1380
             +E +++ + +LP  WE ALP + PE  G ATR  SQ  +NALA  +PG +GGSADLA S
Sbjct: 415  ASELKSIITGELPAGWEKALPTYTPESPGDATRNLSQQCLNALAKVVPGFLGGSADLASS 474

Query: 1381 NLTLMKISGDFQKGSYAERNLRFGVREHAMGAICNGIALHKSGLIPYCATFYIFTDYMRN 1560
            N+TL+K  GDFQK +  ERNLRFGVREH MGAICNGIALH  GLIPYCATF++FTDYMR 
Sbjct: 475  NMTLLKAFGDFQKATPEERNLRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRG 534

Query: 1561 AMRMSALSEAGVVYVMTHDSIGLGEDGPTHQPIEHLASFRAMPDMLMIRPAGGNETAGAY 1740
            AMR+SALSEAGV+YVMTHDSIGLGEDGPTHQPIEH+ASFRAMP+ LM RPA GNETAGAY
Sbjct: 535  AMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHIASFRAMPNTLMFRPADGNETAGAY 594

Query: 1741 KVAIANRKRPTTIALSRQNMPNIPNCSVE 1827
            K+A+  RK P+ +ALSRQ +P++P  S+E
Sbjct: 595  KIAVTKRKTPSILALSRQKLPHLPGTSIE 623

 Score =  158 bits (399), Expect(4) = 0.0
 Identities = 69/106 (65%), Positives = 87/106 (81%)
 Frame = +3

Query: 213 PSISRDEVEKCINAIRFLAIDAINKSKSGHPGMPMGCAPMGYVLWNEVMKYNPKNPDFFN 392
           P+     V+K +N+IRFLAIDA+ K+KSGHPG+PMGCAPM ++L++EVM+YNPKNP +FN
Sbjct: 74  PTTDSSIVDKSVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDEVMRYNPKNPYWFN 133

Query: 393 RDRFVLSAGHGSMFQYSMMHLTGYDSVPLDQIKQFRQWNSLTPGPP 530
           RDRFVLSAGHG M  Y+++HL GYDSV  + +KQFRQW S TPG P
Sbjct: 134 RDRFVLSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQWGSKTPGHP 179

 Score =  117 bits (294), Expect(4) = 0.0
 Identities = 55/76 (72%), Positives = 68/76 (89%)
 Frame = +3

Query: 1989 WELFEEQSAEYKESVLPSDVTARVSVEAATSFGWAKYIGLKGKHVGIDTFGASAPAPTLY 2168
            WELF+EQS EYKESVLPSDV+ARVS+EAA++FGW K +G KGK +GI++FGASAPAP LY
Sbjct: 677  WELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLY 736

Query: 2169 EKFGITVNHVVEAAKA 2216
            ++FGITV  VV+AAK+
Sbjct: 737  KEFGITVEAVVDAAKS 752

 Score = 73.6 bits (179), Expect(4) = 0.0
 Identities = 36/57 (63%), Positives = 42/57 (73%)
 Frame = +2

Query: 1811 PTARLSGVAKGAYTIHDTKAGVKPDVILMGTGSELELATAAAGILEKEGKNVRVVSF 1981
            P   + GV KG YTI D  +G KPDVIL+GTGSELE+A  AA +L K+GK VRVVSF
Sbjct: 618  PGTSIEGVEKGGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVSF 674

>sp|Q43848|TKTC_SOLTU Transketolase, chloroplast precursor (TK) gi|1658322|emb|CAA90427.1|
            transketolase precursor [Solanum tuberosum]
          Length = 741

 Score =  622 bits (1604), Expect(4) = 0.0
 Identities = 305/441 (69%), Positives = 350/441 (79%)
 Frame = +1

Query: 520  PGHPENFVTPGVEVTTGPLGQGICNAVGLAVAEAHLAARFNKPDVKPIVDHYTYCILGDG 699
            PGHPENF TPGVEVTTGPLGQGI NAVGLAVAE HLAARFNKPD + IVDHYTY ILGDG
Sbjct: 176  PGHPENFETPGVEVTTGPLGQGIANAVGLAVAEKHLAARFNKPDAE-IVDHYTYVILGDG 234

Query: 700  CMMEGISNEACSLAGHWGLGKLIALYDDNKISIDGHTDISFTEDVAKRYEALGWHVIHVI 879
            C MEGISNE CSLAGHWGLGKLIA YDDN ISIDG T+I+FTEDV+ R+E+LGWHVI V 
Sbjct: 235  CQMEGISNEVCSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSARFESLGWHVIWVK 294

Query: 880  NGNTDVDGLRAAIAQAKAVKDKPTLIKVSTLIGYGSPNKADSHDVHGAPLGPDETAATRK 1059
            NGNT  D +RAAI +AKAVKDKPT+IKV+T IG+GSPNKA+S+ VHG+ LG  E  ATR 
Sbjct: 295  NGNTGYDEIRAAIKEAKAVKDKPTMIKVTTTIGFGSPNKANSYSVHGSGLGAKEVEATRN 354

Query: 1060 NLNWPYGEFEVPQDVYDVFRGAIKRGAEEEANWHKACAEYKAKYPKEWAEFEALTSCKLP 1239
            NL WPY  F VP+DV   +      GA  E  W+   AEY+ KY +E A+ +++ + +LP
Sbjct: 355  NLGWPYEPFHVPEDVKSHWSRHTPEGAALETEWNAKFAEYEKKYAEEAADLKSIITGELP 414

Query: 1240 ENWEAALPHFKPEDKGLATRQHSQTMINALAPALPGLIGGSADLAPSNLTLMKISGDFQK 1419
              WE ALP + PE    ATR  SQ  +NALA  LPG +GGSADLA SN+TL+K+ GDFQK
Sbjct: 415  AGWEKALPTYTPESPADATRNLSQQNLNALAKVLPGFLGGSADLASSNMTLLKMFGDFQK 474

Query: 1420 GSYAERNLRFGVREHAMGAICNGIALHKSGLIPYCATFYIFTDYMRNAMRMSALSEAGVV 1599
             +  ERNLRFGVREH MGAICNGIALH  GLIPYCATF++FTDYMR AMR+SALSEAGV+
Sbjct: 475  NTPEERNLRFGVREHGMGAICNGIALHSLGLIPYCATFFVFTDYMRGAMRISALSEAGVI 534

Query: 1600 YVMTHDSIGLGEDGPTHQPIEHLASFRAMPDMLMIRPAGGNETAGAYKVAIANRKRPTTI 1779
            YVMTHDSIGLGEDGPTHQPIEHLASFRAMP++LM RPA GNETAGAYKVA+  RK P+ +
Sbjct: 535  YVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMFRPADGNETAGAYKVAVLKRKTPSIL 594

Query: 1780 ALSRQNMPNIPNCSVEWRGQG 1842
            ALSRQ +P +   S+E   +G
Sbjct: 595  ALSRQKLPQLAGTSIEGAAKG 615

 Score =  159 bits (402), Expect(4) = 0.0
 Identities = 70/99 (70%), Positives = 83/99 (83%)
 Frame = +3

Query: 234 VEKCINAIRFLAIDAINKSKSGHPGMPMGCAPMGYVLWNEVMKYNPKNPDFFNRDRFVLS 413
           VEK +N IRFLAIDA+ K+ SGHPG+PMGCAPMG++L++EVMKYNPKNP +FNRDRFVLS
Sbjct: 81  VEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLS 140

Query: 414 AGHGSMFQYSMMHLTGYDSVPLDQIKQFRQWNSLTPGPP 530
           AGHG M QY+++HL GYDSV  D +K FRQW S  PG P
Sbjct: 141 AGHGCMLQYALLHLAGYDSVQEDDLKSFRQWGSRIPGHP 179

 Score =  111 bits (277), Expect(4) = 0.0
 Identities = 52/75 (69%), Positives = 63/75 (83%)
 Frame = +3

Query: 1989 WELFEEQSAEYKESVLPSDVTARVSVEAATSFGWAKYIGLKGKHVGIDTFGASAPAPTLY 2168
            WEL++EQSAEYKESVLPS VTARVS+EA ++FGW K++G KGK +GID FGASAPA  +Y
Sbjct: 664  WELYDEQSAEYKESVLPSSVTARVSIEAGSTFGWQKFVGDKGKAIGIDGFGASAPADKIY 723

Query: 2169 EKFGITVNHVVEAAK 2213
            ++FGIT   VV AAK
Sbjct: 724  KEFGITAEAVVAAAK 738

 Score = 69.3 bits (168), Expect(4) = 0.0
 Identities = 34/53 (64%), Positives = 40/53 (75%)
 Frame = +2

Query: 1823 LSGVAKGAYTIHDTKAGVKPDVILMGTGSELELATAAAGILEKEGKNVRVVSF 1981
            + G AKG Y + D  +G KPDVIL+GTGSELE+A  AA  L+KEGK VRVVSF
Sbjct: 609  IEGAAKGGYIVSDNSSGNKPDVILIGTGSELEIAVKAAEELKKEGKTVRVVSF 661



EST assemble image


clone accession position
1 HCL071b12_r AV643527 1 609
2 HCL076f08_r AV643820 23 548
3 HCL070e10_r AV643492 30 633
4 HCL086d05_r AV644326 32 570
5 MXL076h07_r BP097502 33 535
6 HCL050b10_r AV642346 33 674
7 MXL068c12_r BP096990 33 548
8 HCL089f02_r AV644499 33 617
9 HCL085e06_r AV644285 33 636
10 HCL083g05_r AV644198 34 562
11 MXL088d04_r BP098155 34 462
12 HCL076h09_r AV643834 35 636
13 HCL083e01_r AV644184 35 649
14 HCL087c09_r AV644374 36 621
15 HCL077e10_r AV643877 37 648
16 HCL086b07_r AV644314 37 601
17 HCL080e04_r AV644028 38 690
18 HCL069a02_r AV643399 39 644
19 HCL070h07_r AV643511 40 650
20 HCL074c02_r AV643689 42 620
21 HCL076f10_r AV643821 44 639
22 HCL078f04_r AV643930 45 662
23 HCL067c09_r AV643305 48 656
24 HCL049a07_r AV642286 49 688
25 HCL080a10_r AV644007 50 663
26 CL46h11_r AV395639 52 698
27 HCL089h08_r AV644516 53 603
28 CL06e04_r AV393600 56 620
29 CL35c02_r AV395051 58 689
30 HCL067f02_r AV643324 60 656
31 MXL049d09_r BP095921 76 574
32 MXL045a02_r BP095634 88 619
33 LCL016a09_r AV626823 89 367
34 MX210e05_r BP089604 108 415
35 LCL067g02_r AV629855 116 657
36 MXL097a03_r BP098654 116 523
37 CL58c12_r AV396241 125 631
38 MXL027d10_r BP094686 125 422
39 HCL048b02_r AV642238 125 409
40 MXL004e05_r BP093168 125 286
41 HCL075c02_r AV643743 125 647
42 HCL037a05_r AV641593 125 661
43 HCL074a06_r AV643678 125 662
44 HCL050a08_r AV642341 125 612
45 HCL008c11_r AV639984 125 714
46 MXL021f03_r BP094347 125 494
47 HCL038g10_r AV641695 125 613
48 HCL003g04_r AV639721 125 674
49 HCL025b02_r AV640943 125 607
50 HCL037c07_r AV641607 125 709
51 HCL085a01_r AV644262 125 674
52 HCL029b09_r AV641175 125 622
53 HCL004c11_r AV639749 125 296
54 HCL087e04_r AV644381 125 623
55 HCL090h06_r AV644583 125 590
56 HCL060f09_r AV642927 125 690
57 HCL054f09_r AV642609 125 674
58 MXL071c11_r BP097178 125 513
59 HCL080d09_r AV644024 125 673
60 HCL053c04_r AV642522 125 686
61 HCL010f06_r AV640113 125 359
62 HCL001f05_r AV639599 125 470
63 HCL078g11_r AV643941 125 685
64 HCL016d03_r AV640443 125 353
65 HCL065f04_r AV643206 125 675
66 HCL087b04_r AV644365 125 616
67 LCL032d06_r AV627812 125 598
68 HCL086c11_r AV644324 125 639
69 MXL086h12_r BP098096 125 638
70 HCL022g04_r AV640805 125 636
71 HCL006a11_r AV639847 125 518
72 HCL097d06_r AV645045 125 519
73 HCL064b01_r AV643119 125 652
74 HCL062c03_r AV643014 125 683
75 HCL021g12_r AV640752 125 614
76 MXL044f02_r BP095613 125 536
77 LCL075d12_r AV630212 125 597
78 HCL077d09_r AV643866 125 636
79 CL12b05_r AV393829 125 685
80 HCL075a11_r AV643735 125 650
81 HCL021c09_r AV640722 125 596
82 LCL090h11_r AV631252 125 509
83 MXL026h03_r BP094669 125 254
84 HCL077a06_r AV643841 125 687
85 LCL072b04_r AV630055 125 444
86 HCL053c03_r AV642521 125 687
87 CL76h07_r AV397121 125 689
88 HCL085h05_r AV644303 125 563
89 HCL039e01_r AV641731 125 678
90 HCL100f07_r AV645286 125 596
91 HCL079f02_r AV643983 125 655
92 HCL089a08_r AV644463 125 627
93 HCL050d01_r AV642355 125 654
94 HCL009b01_r AV640028 125 654
95 LCL060e01_r AV629534 126 509
96 HCL032h03_r AV641396 126 596
97 CL51h01_r AV395910 126 693
98 HCL095g08_r AV644942 126 597
99 HCL045d05_r AV642089 126 370
100 HCL085d12_r AV644283 127 332
101 HCL080b04_r AV644009 127 653
102 HCL048c02_r AV642243 127 444
103 LCL011f12_r AV626576 127 265
104 HCL049f04_r AV642316 127 682
105 LCL072c04_r AV630059 127 456
106 HCL053f01_r AV642539 127 655
107 HCL065d02_r AV643193 127 683
108 HCL039b03_r AV641710 127 683
109 HCL071f07_r AV643555 127 654
110 HCL042h12_r AV641950 127 685
111 HCL089b09_r AV644475 127 686
112 LCL028f07_r AV627566 127 462
113 HCL050g05_r AV642376 127 690
114 HCL040a06_r AV641774 127 651
115 HCL071b01_r AV643521 127 689
116 HCL074d06_r AV643700 127 653
117 CL14b02_r AV393873 127 690
118 LCL027d06_r AV627482 127 465
119 LCL014a08_r AV626707 127 466
120 HCL077g08_r AV643886 127 647
121 LCL030h09_r AV627710 127 471
122 LCL051c05_r AV629066 127 650
123 HCL084c03_r AV644220 127 649
124 HCL059c09_r AV642852 127 694
125 HCL053b06_r AV642516 127 693
126 HCL056f10_r AV642720 127 591
127 LCL100f10_r AV631842 127 709
128 HCL058g06_r AV642824 127 648
129 LCL052a07_r AV629100 127 607
130 CL05f11_r AV393583 127 612
131 LCL015a03_r AV626759 127 604
132 HCL079d10_r AV643972 127 602
133 HCL042e11_r AV641927 127 644
134 HCL089c12_r AV644484 127 499
135 CL50a04_r AV395739 127 614
136 HCL075c07_r AV643746 127 601
137 MXL005d10_r BP093236 127 600
138 LCL030h02_r AV627706 127 500
139 LCL003c11_r AV626158 127 505
140 LCL095h08_r AV631540 127 598
141 HCL090d10_r AV644552 127 506
142 HCL022g05_r AV640806 127 507
143 MXL007g03_r BP093388 127 509
144 LCL077g03_r AV630355 127 597
145 MXL059h01_r BP096507 127 511
146 HCL068e08_r AV643375 127 617
147 HCL054a03_r AV642566 127 514
148 HCL077c11_r AV643860 127 608
149 HCL059d01_r AV642855 127 620
150 LCL040d09_r AV628348 127 476
151 LCL034c06_r AV627945 127 353
152 HCL090e08_r AV644559 127 352
153 CL80f05_r AV397304 127 640
154 HCL090b10_r AV644535 127 519
155 HCL062f02_r AV643034 127 639
156 LCL049h06_r AV628979 127 356
157 LCL031g12_r AV627773 127 358
158 LCL094f05_r AV631472 127 326
159 HCL032f07_r AV641382 127 523
160 LCL092g08_r AV631369 127 525
161 HCL049e04_r AV642308 127 643
162 LCL028e03_r AV627556 127 361
163 LCL093c08_r AV631402 127 362
164 HCL053g04_r AV642548 127 667
165 HCL050g08_r AV642377 127 674
166 CL53e02_r AV395956 127 637
167 LCL048g03_r AV628903 127 301
168 LCL089e11_r AV631152 127 596
169 LCL096d02_r AV631573 127 636
170 HCL029e02_r AV641190 127 677
171 LCL009h04_r AV626481 127 635
172 HCL012c10_r AV640215 127 473
173 LCL081a06_r AV630579 127 405
174 LCL099d12_r AV631766 127 675
175 LCL043g03_r AV628557 127 634
176 HCL069d06_r AV643420 127 609
177 HCL084a06_r AV644211 127 636
178 LCL068f10_r AV629902 127 633
179 LCL040e02_r AV628353 127 676
180 HCL061c04_r AV642958 127 408
181 LCL043e09_r AV628545 127 677
182 MXL078g09_r BP097634 127 549
183 HCL062e08_r AV643030 127 664
184 HCL098b02_r AV645090 127 290
185 LCL011e02_r AV626566 127 409
186 MXL064h10_r BP096790 127 563
187 MXL029e03_r BP094779 127 566
188 LCL027e12_r AV627493 127 289
189 HCL038c11_r AV641662 127 631
190 HCL039e09_r AV641737 127 662
191 LCL010c09_r AV626507 127 418
192 LCL007f12_r AV626356 127 620
193 HCL097e09_r AV645054 127 600
194 HCL004d08_r AV639752 127 288
195 HCL062g04_r AV643042 127 621
196 HCL037g11_r AV641631 127 430
197 LCL045f03_r AV628686 127 432
198 HCL078g05_r AV643938 127 627
199 LCL085h02_r AV630892 127 443
200 HCL006a08_r AV639844 127 578
201 LCL033e03_r AV627894 127 622
202 LCL097a12_r AV631619 127 593
203 LCL030e09_r AV627686 127 484
204 HCL090h01_r AV644580 127 579
205 HCL026d05_r AV641022 127 680
206 HCL010h07_r AV640128 127 487
207 HCL072c06_r AV643585 127 656
208 HCL025a12_r AV640941 127 592
209 HCL081g05_r AV644097 127 624
210 HCL004c07_r AV639745 127 443
211 LCL026f08_r AV627433 127 597
212 HCL093b07_r AV644740 127 622
213 HCL099c05_r AV645177 128 597
214 LCL062h12_r AV629660 128 594
215 HCL096f12_r AV644993 129 596
216 HCL025a01_r AV640936 129 590
217 HCL095b06_r AV644889 129 622
218 MXL040a01_r BP095325 129 638
219 HCL093h09_r AV644796 129 597
220 HCL055f07_r AV642664 129 633
221 HCL006h06_r AV639900 129 598
222 HCL100h09_r AV645310 129 596
223 MXL025b06_r BP094575 129 607
224 HCL004c06_r AV639744 129 353
225 HCL067a06_r AV643287 129 636
226 HCL051g05_r AV642440 129 656
227 HCL001c09_r AV639580 129 464
228 HCL037a04_r AV641592 129 649
229 HCL017c04_r AV640491 129 604
230 HCL041g10_r AV641881 129 647
231 HCL067f03_r AV643325 129 234
232 HCL026f08_r AV641040 129 650
233 HCL019f02_r AV640636 130 409
234 HCL049f08_r AV642319 130 652
235 CL57h08_r AV396262 130 681
236 HCL038g09_r AV641694 130 685
237 HCL012h12_r AV640244 130 289
238 HCL003a05_r AV639682 130 686
239 HCL031f06_r AV641324 130 636
240 HCL084e06_r AV644237 130 602
241 HCL026f06_r AV641038 130 499
242 HCL050c05_r AV642350 130 688
243 HCL075a01_r AV643729 130 646
244 CL56d04_r AV396086 130 674
245 HCL056a10_r AV642685 130 655
246 HCL067g02_r AV643333 130 614
247 HCL091c04_r AV644613 130 519
248 HCL017c02_r AV640489 130 633
249 HCL063g01_r AV643097 130 647
250 HCL082g11_r AV644145 130 630
251 HCL091b04_r AV644602 130 597
252 HCL015f11_r AV640406 130 232
253 HCL078h05_r AV643943 130 594
254 HCL067a04_r AV643285 130 595
255 LCL088b03_r AV631049 131 650
256 CL65d03_r AV396584 131 689
257 CL04g07_r AV393366 131 697
258 HCL094f09_r AV644852 131 597
259 MXL006g12_r BP093325 131 514
260 HCL096a09_r AV644961 131 598
261 HCL054c08_r AV642586 131 590
262 HCL061a01_r AV642940 131 653
263 HCL079b11_r AV643962 131 588
264 HCL008f10_r AV640007 131 604
265 HCL033e10_r AV641435 131 531
266 HCL098h12_r AV645160 131 518
267 HCL071e03_r AV643549 131 654
268 CL35f10_r AV395085 131 656
269 HCL055b04_r AV642634 131 663
270 HCL019g12_r AV640651 131 408
271 HCL041e01_r AV641859 131 674
272 LCL097d06_r AV631638 131 358
273 CL29f09_r AV394669 131 686
274 HCL037f02_r AV641621 131 647
275 HCL026f09_r AV641041 131 572
276 HCL064e01_r AV643138 131 687
277 LCL025a01_r AV627321 131 622
278 HCL064b10_r AV643124 131 609
279 LCL074d04_r AV630152 131 636
280 HCL051a10_r AV642393 131 686
281 HCL082e12_r AV644133 132 623
282 HCL088g01_r AV644446 132 639
283 LCL034d05_r AV627951 132 371
284 LCL097a01_r AV631613 133 462
285 HCL068e05_r AV643372 134 654
286 HCL055h11_r AV642678 134 662
287 HCL072g12_r AV643617 134 671
288 HCL034g01_r AV641494 134 674
289 HCL097f09_r AV645063 134 709
290 HCL091b01_r AV644599 134 598
291 HCL003e02_r AV639709 134 620
292 HCL004g05_r AV639771 134 286
293 HCL094h06_r AV644870 134 597
294 MXL047d11_r BP095789 134 601
295 HCL048g07_r AV642271 134 288
296 HCL096f04_r AV644990 134 596
297 HCL013e05_r AV640274 134 322
298 HCL066b07_r AV643238 134 621
299 MXL010h12_r BP093613 134 356
300 HCL047h11_r AV642233 134 417
301 HCL087h10_r AV644403 134 600
302 HCL047f02_r AV642214 134 650
303 MXL027h01_r BP094707 134 470
304 HCL076c06_r AV643798 134 599
305 HCL003e10_r AV639714 134 501
306 CL22e10_r AV394276 134 577
307 HCL091c07_r AV644615 134 634
308 HCL077h02_r AV643888 134 635
309 HCL085c09_r AV644277 134 636
310 HCL063c01_r AV643069 134 641
311 HCL015d09_r AV640388 135 456
312 HCL095d04_r AV644906 135 636
313 HCL031b07_r AV641291 135 495
314 HCL008d03_r AV639988 135 674
315 CL08d05_r AV393501 135 656
316 HCL068f07_r AV643383 135 637
317 HCL051h02_r AV642443 135 691
318 HCL061a11_r AV642948 135 666
319 HCL019g02_r AV640643 135 357
320 HCL029b04_r AV641173 135 597
321 HCL044a06_r AV642018 135 416
322 LCL001h02_r AV626062 135 650
323 HCL036b05_r AV641552 135 661
324 CL77f04_r AV397246 135 651
325 CL41b08_r AV395419 135 688
326 LCL017a02_r AV626867 135 353
327 HCL083d05_r AV644178 135 592
328 LCL041f08_r AV628427 135 622
329 LCL040e09_r AV628357 135 502
330 LCL072b07_r AV630056 135 506
331 HCL094h04_r AV644868 136 570
332 LCL044e12_r AV628617 136 449
333 HCL022g06_r AV640807 136 597
334 HCL054g10_r AV642617 136 655
335 HCL049e05_r AV642309 136 656
336 LCL019g07_r AV627012 136 362
337 LCL040f03_r AV628363 136 359
338 LCL003b07_r AV626148 136 289
339 HCL074d03_r AV643697 136 635
340 HCL009g05_r AV640070 136 427
341 HCL055b05_r AV642635 136 673
342 HCL004a12_r AV639739 136 636
343 HCL100b02_r AV645241 136 622
344 HCL081h04_r AV644104 136 605
345 HCL076d10_r AV643808 138 612
346 HCL056c04_r AV642699 138 687
347 HCL076e12_r AV643815 138 621
348 HCL022h04_r AV640816 138 622
349 HCL063d04_r AV643079 138 653
350 HCL055g04_r AV642669 138 636
351 HCL002d07_r AV639649 138 650
352 HCL036e05_r AV641572 138 674
353 CL01f02_r AV393349 138 603
354 HCL033g06_r AV641446 138 541
355 HCL091e07_r AV644633 138 636
356 HCL037b05_r AV641600 138 597
357 HCL068b10_r AV643354 138 612
358 HCL091c03_r AV644612 138 596
359 HCL053b03_r AV642513 138 691
360 HCL021c10_r AV640723 138 620
361 HCL045g09_r AV642110 138 647
362 HCL053h08_r AV642561 138 681
363 HCL096e07_r AV644984 138 598
364 HCL024d06_r AV640903 138 546
365 HCL051b06_r AV642398 138 578
366 HCL046g11_r AV642172 138 675
367 HCL077b04_r AV643848 138 694
368 LCL073a12_r AV630097 138 519
369 HCL058g10_r AV642828 138 653
370 HCL037c05_r AV641605 138 650
371 CL01c08_r AV393320 138 650
372 HCL034b03_r AV641466 138 677
373 CL51e03_r AV395942 139 708
374 HCL048f11_r AV642267 139 622
375 MXL078h10_r BP097645 139 655
376 CL71h09_r AV396870 139 689
377 HCL003h09_r AV639730 139 470
378 HCL041d07_r AV641854 139 709
379 HCL085e10_r AV644288 139 656
380 HCL019e07_r AV640632 139 405
381 HCL032h09_r AV641401 139 549
382 MXL037f01_r BP095189 139 543
383 HCL062f05_r AV643036 140 674
384 HCL080e03_r AV644027 140 600
385 HCL038d08_r AV641668 140 677
386 HCL076e02_r AV643810 140 707
387 HCL005a07_r AV639787 140 620
388 HCL051a06_r AV642391 141 650
389 HCL028b05_r AV641123 141 677
390 HCL058f03_r AV642817 141 656
391 HCL048f07_r AV642264 141 314
392 HCL072b07_r AV643578 141 662
393 HCL073a08_r AV643628 141 642
394 LCL070d07_r AV629981 141 598
395 HCL084e10_r AV644240 141 634
396 HCL019c02_r AV640613 141 282
397 HCL040h12_r AV641827 141 597
398 LCL088d02_r AV631070 141 636
399 HCL046g03_r AV642166 141 596
400 HCL019f03_r AV640637 141 408
401 CL75g01_r AV397099 141 693
402 HCL001f03_r AV639597 141 465
403 HCL006e12_r AV639879 141 626
404 HCL048g10_r AV642274 141 620
405 HCL012d07_r AV640219 141 288
406 HCL031d05_r AV641306 141 650
407 HCL031e03_r AV641314 141 685
408 MXL075d10_r BP097421 141 519
409 CL28b12_r AV394790 142 656
410 HCL045a01_r AV642067 142 470
411 MXL095a11_r BP098540 142 534
412 HCL046b01_r AV642131 142 597
413 HCL079e07_r AV643977 142 617
414 HCL056a01_r AV642679 142 673
415 HCL025f01_r AV640972 142 620
416 HCL071e02_r AV643548 143 691
417 CL01b05_r AV393308 143 638
418 LCL081h04_r AV630635 143 458
419 HCL079h03_r AV643997 143 681
420 HCL050b11_r AV642347 144 688
421 HCL039c09_r AV641721 144 709
422 HCL065e11_r AV643203 144 656
423 HCL093c02_r AV644746 144 598
424 HCL039h10_r AV641767 144 650
425 HCL002c09_r AV639641 144 675
426 HCL060e04_r AV642920 144 611
427 HCL059a06_r AV642837 144 688
428 HCL028c12_r AV641135 144 636
429 HCL099a08_r AV645163 144 597
430 HCL032d10_r AV641369 144 531
431 HCL079h08_r AV644000 144 612
432 HCL083d12_r AV644183 144 649
433 HCL009d08_r AV640052 144 469
434 HCL028a10_r AV641119 144 674
435 HCL033a10_r AV641408 144 546
436 HCL031b04_r AV641290 144 596
437 HCL093g11_r AV644790 145 598
438 HCL086c08_r AV644322 145 692
439 HCL068e11_r AV643377 146 656
440 HCL061c07_r AV642960 146 660
441 CL68h01_r AV396917 146 639
442 HCL049f05_r AV642317 146 637
443 HCL087h04_r AV644401 146 634
444 HCL018g08_r AV640590 146 607
445 HCL024c05_r AV640891 146 620
446 HCL068f09_r AV643384 146 598
447 HCL054f07_r AV642607 146 693
448 HCL036g07_r AV641582 146 721
449 HCL053f07_r AV642542 146 605
450 CL46d05_r AV395649 146 692
451 HCL097b10_r AV645029 146 597
452 HCL096a11_r AV644962 146 598
453 HCL098a09_r AV645085 146 611
454 HCL035b10_r AV641516 146 613
455 HCL099f09_r AV645212 146 593
456 HCL032g04_r AV641389 146 553
457 HCL073b08_r AV643636 146 641
458 CL54b03_r AV396143 147 719
459 HCL003c12_r AV639701 147 504
460 HCL054b05_r AV642575 147 637
461 LCL079f08_r AV630488 148 463
462 MXL038h03_r BP095251 149 591
463 HCL069f02_r AV643434 149 639
464 HCL098e11_r AV645126 149 620
465 HCL088f07_r AV644443 149 694
466 CL01g07_r AV393329 149 685
467 HCL061c12_r AV642963 150 488
468 HCL046c10_r AV642142 150 596
469 HCL046e04_r AV642154 150 597
470 HCL076b01_r AV643789 150 662
471 HCL095f10_r AV644933 150 598
472 HCL083g11_r AV644202 150 655
473 MXL054f03_r BP096207 150 649
474 HCL085f06_r AV644292 150 647
475 HCL029a05_r AV641167 150 255
476 HCL050d07_r AV642359 150 687
477 HCL051g08_r AV642442 150 687
478 HCL095h03_r AV644949 150 604
479 HCL036b03_r AV641551 150 681
480 HCL053c07_r AV642523 150 698
481 HCL001b09_r AV639571 150 469
482 CL69e07_r AV396780 150 676
483 HCL091f05_r AV644641 150 636
484 HCL073f12_r AV643662 150 636
485 HCL080f03_r AV644032 150 630
486 MXL070b10_r BP097107 150 621
487 HCL015h03_r AV640415 150 380
488 HCL018h08_r AV640598 150 675
489 HCL066a10_r AV643232 150 692
490 HCL031h01_r AV641336 150 507
491 HCL059g04_r AV642879 150 674
492 HCL047c05_r AV642195 151 408
493 HCL099h10_r AV645228 151 604
494 HCL077d08_r AV643865 151 617
495 HCL091h08_r AV644666 151 650
496 HCL087c06_r AV644372 151 646
497 HCL007h05_r AV639955 151 620
498 MXL035a04_r BP095051 151 548
499 HCL095d02_r AV644904 151 636
500 HCL033f05_r AV641439 151 546
501 HCL078f10_r AV643934 151 694
502 HCL024b05_r AV640886 151 328
503 HCL077d04_r AV643863 151 712
504 HCL072c02_r AV643581 151 692
505 HCL053a10_r AV642509 151 690
506 HCL009f09_r AV640065 151 470
507 HCL062f04_r AV643035 151 674
508 CL20c01_r AV394312 151 591
509 HCL047b01_r AV642187 151 597
510 HCL021g10_r AV640750 151 598
511 HCL089f12_r AV644506 151 509
512 HCL090h07_r AV644584 152 351
513 HCL032a10_r AV641349 152 531
514 HCL038c01_r AV641654 152 597
515 HCL062c02_r AV643013 153 656
516 HCL007d12_r AV639933 153 677
517 HCL027e05_r AV641085 154 600
518 HCL033b06_r AV641412 155 558
519 HCL090g12_r AV644579 155 495
520 CL12g03_r AV393805 155 694
521 HCL041h06_r AV641888 155 629
522 HCL083h10_r AV644208 155 712
523 HCL033c04_r AV641416 155 531
524 HCL001g04_r AV639604 156 469
525 HCL026c02_r AV641013 156 620
526 HCL041e05_r AV641862 156 650
527 HCL018d04_r AV640562 156 636
528 HCL096c07_r AV644976 157 593
529 HCL013b10_r AV640255 158 518
530 MXL050h05_r BP096004 159 572
531 HCL018g05_r AV640589 159 634
532 HCL082e06_r AV644129 159 666
533 HCL076g08_r AV643828 159 628
534 HCL088c07_r AV644426 159 682
535 HCL063a06_r AV643059 159 665
536 HCL053g01_r AV642546 159 675
537 HCL090g10_r AV644577 159 523
538 CL40c05_r AV395341 160 694
539 CL44a12_r AV395583 160 673
540 CL39d12_r AV395210 160 527
541 HCL058d07_r AV642806 161 333
542 HCL075f01_r AV643766 161 655
543 HCL018d02_r AV640561 161 650
544 HCL080g08_r AV644044 161 720
545 HCL010g01_r AV640118 161 500
546 MXL076c06_r BP097470 161 550
547 HCL005c04_r AV639803 161 597
548 CL08b03_r AV393511 161 689
549 HCL025b04_r AV640945 161 604
550 HCL080c07_r AV644017 161 706
551 CL10d12_r AV393701 163 517
552 HCL069e05_r AV643429 163 655
553 HCL098c07_r AV645105 163 598
554 HCL066d07_r AV643253 165 656
555 HCL015c03_r AV640381 165 356
556 HCL056h09_r AV642733 165 684
557 HCL098e06_r AV645123 165 636
558 HCL077d12_r AV643869 165 679
559 HCL032f10_r AV641385 165 576
560 HCL013h01_r AV640295 165 505
561 HCL003g08_r AV639723 166 440
562 MXL055f08_r BP096266 169 686
563 HCL051g07_r AV642441 171 703
564 HCL096h04_r AV645004 172 584
565 HCL092d02_r AV644691 172 527
566 HCL022f06_r AV640798 176 622
567 HCL019f11_r AV640642 176 469
568 HCL076h10_r AV643835 176 699
569 MXL013a10_r BP093747 179 469
570 HCL014c07_r AV640322 180 683
571 LCL068a08_r AV629870 182 636
572 HCL100g02_r AV645293 182 622
573 HCL092a03_r AV644670 184 517
574 HCL083h04_r AV644204 189 644
575 HCL003d11_r AV639706 191 351
576 HCL048f04_r AV642262 194 500
577 HCL081c08_r AV644073 194 710
578 HCL075h06_r AV643780 195 686
579 HCL026b10_r AV641011 195 709
580 HCL096d12_r AV644981 197 598
581 HCL099g01_r AV645216 197 527
582 HCL018d08_r AV640564 198 717
583 HCL058a08_r AV642792 202 688
584 HCL096e05_r AV644982 205 531
585 MXL003g04_r BP093123 210 597
586 HCL068g07_r AV643388 210 694
587 LCL094b01_r AV631447 211 529
588 LCL024a01_r AV627262 214 405
589 HCL100a03_r AV645233 214 599
590 HCL057h12_r AV642790 221 741
591 LCL077h11_r AV630373 237 804
592 HCL018f02_r AV640578 244 806
593 HCL011c02_r AV640147 247 600
594 HCL005e05_r AV639819 250 622
595 HCL071a07_r AV643518 250 793
596 HCL080c04_r AV644015 263 806
597 CL15c06_r AV393973 264 690
598 HCL019b08_r AV640609 274 597
599 MXL013g08_r BP093788 274 825
600 HCL056d08_r AV642705 275 796
601 HCL008e10_r AV640000 288 741
602 HCL007g03_r AV639946 288 733
603 HCL094b11_r AV644817 305 829
604 HCL089d09_r AV644491 306 871
605 CL22d03_r AV394221 310 830
606 MX224e10_r BP090478 327 853
607 LCL051a07_r AV629055 336 829
608 HCL044d11_r AV642047 346 653
609 MXL080g09_r BP097753 351 723
610 LCL090f02_r AV631231 356 825
611 MXL098f04_r BP098758 357 853
612 HCL033h09_r AV641452 362 746
613 HCL089g03_r AV644508 403 883
614 MXL035h08_r BP095105 410 742
615 HCL092d01_r AV644690 419 771
616 CL12f09_r AV393839 425 942
617 HCL058c08_r AV642800 425 941
618 MXL024e10_r BP094535 425 929
619 HCL085h01_r AV644300 429 966
620 MXL021d10_r BP094335 432 825
621 CL20d04_r AV394328 482 942
622 LCL015d07_r AV626786 494 1022
623 HCL100d10_r AV645269 507 885
624 MXL023f08_r BP094476 569 930
625 HCL081c04_r AV644071 745 999
626 MXL043c05_r BP095529 755 1139
627 HCL064h09_r AV643167 810 1294
628 MXL052h05_r BP096110 812 1224
629 MXL065c08_r BP096812 852 1260
630 MXL018b08_r BP094099 865 1350
631 MXL007f11_r BP093384 865 1357
632 HCL047g06_r AV642224 905 1188
633 CM092h08_r AV392684 939 1477
634 HCL018h10_r AV640600 952 1321
635 HC094g09_r AV639084 985 1399
636 MX228c05_r BP090733 1072 1579
637 LCL019h12_r AV627022 1083 1577
638 MXL096g12_r BP098642 1111 1606
639 HCL090b03_r AV644530 1207 1610
640 HC015a07_r AV632970 1223 1720
641 MXL083f06_r BP097925 1234 1630
642 HCL046a07_r AV642126 1257 1632
643 MXL061h10_r BP096621 1294 1682
644 HC049h06_r AV635711 1339 1978
645 MX218e02_r BP090080 1346 1756
646 HCL026e05_r AV641031 1349 1853
647 HCL048a11_r AV642237 1354 1850
648 HC018e03_r AV633244 1367 1823
649 HC093c09_r AV638975 1395 1820
650 MX203c06_r BP089229 1411 1757
651 MX041a08_r BP087671 1415 1877
652 HCL058c01_r AV642798 1431 1862
653 MXL089d06_r BP098210 1435 1803
654 MXL008c11_r BP093432 1462 1865
655 CM039f05_r AV388967 1476 2024
656 HC079f01_r AV637934 1483 1920
657 MX048a04_r BP087961 1503 1847
658 CL38a05_r AV395290 1504 1971
659 HC098f12_r AV639386 1511 1911
660 HCL097a07_r AV645015 1513 1956
661 MX219b09_r BP090127 1551 1838
662 HC026c02_r AV633861 1551 2063
663 LC057h08_r AV623023 1560 2071
664 LC098b09_r AV625812 1570 1836
665 HCL009g06_r AV640071 1580 1770
666 MXL056c05_r BP096301 1581 1942
667 CM022h05_r AV387871 1585 2156
668 CM074g05_r AV391577 1595 2225
669 HCL013f06_r AV640281 1603 1959
670 CM079a12_r AV391940 1603 2206
671 HC095d10_r AV639137 1609 2158
672 MX015d01_r BP086722 1660 2008
673 MX223d12_r BP090402 1661 2115
674 MX240h02_r BP091551 1675 2142
675 HC014b03_r AV632900 1677 2168
676 HC019f09_r AV633340 1690 2206
677 MX235g04_r BP091233 1694 2078
678 CM017b07_r AV388182 1699 2301
679 CM009e04_r AV397633 1699 2245
680 HC077g05_r AV637807 1701 2152
681 HC038d05_r AV634820 1705 2208
682 HC025h05_r AV633834 1732 2270
683 HC027d08_r AV633959 1785 2342
684 HC003c12_r AV632054 1786 2230
685 MX218g10_r BP090100 1790 2107
686 HC063f02_r AV636740 1805 2249
687 MX018c06_r BP086844 1813 2210
688 CM070b11_r AV391286 1892 2496
689 HC047e08_r AV635531 1902 2316
690 MX260f09_r BP092905 1925 2189
691 HC024h08_r AV633760 1956 2443
692 HC064h07_r AV636838 1958 2541
693 MX242a10_r BP091638 1968 2453
694 HC023f01_r AV633656 1981 2367
695 CM024e02_r AV388280 1988 2594
696 HC071b03_r AV637283 1998 2551
697 HC099a08_r AV639415 2003 2484
698 HC039b09_r AV634878 2006 2507
699 HC052h11_r AV635935 2008 2443
700 HC036c02_r AV634665 2009 2577
701 HC034f10_r AV634536 2012 2554
702 HC073e08_r AV637472 2036 2485
703 HC011f06_r AV632708 2058 2488
704 HC096c01_r AV639196 2070 2506
705 HC008b06_r AV632431 2094 2604
706 HC077c02_r AV637765 2101 2540
707 CL43d06_r AV395525 2105 2718
708 MX067b10_r BP088716 2114 2440
709 HC073h12_r AV637506 2114 2563
710 LCL082h08_r AV630700 2114 2596
711 HC050c01_r AV635732 2127 2623
712 HC064a11_r AV636782 2169 2620
713 MX207g11_r BP089465 2171 2668
714 MX251d03_r BP092231 2187 2668
715 HCL098g06_r AV645144 2209 2620
716 MX250h09_r BP092194 2351 2762
717 HCL027b06_r AV641063 2396 2898
718 HCL093c08_r AV644751 2739 3249
719 HCL043g11_r AV642007 2774 3249
720 CL10h12_r AV393702 2775 3242
721 HCL080c11_r AV644020 2780 3249
722 HCL083f03_r AV644189 2782 3275
723 HCL053e03_r AV642532 2788 3249
724 HCL065c06_r AV643187 2790 3249
725 HCL064f05_r AV643145 2795 3249
726 HCL083d03_r AV644177 2831 3306
727 HCL060c10_r AV642909 2841 3334
728 HCL091a02_r AV644590 2842 3066
729 HCL053h02_r AV642556 2853 3329
730 HCL073c07_r AV643643 2855 3249
731 HCL098a11_r AV645087 2879 3249
732 HCL007c03_r AV639920 2884 3249
733 HCL074e01_r AV643702 2896 3226
734 MXL092h04_r BP098406 2899 3249
735 MXL071d08_r BP097182 2947 3225
736 LCL021h01_r AV627147 3067 3284




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research