KCC000007A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000007A_C01 KCC000007A_c01
aacggcccgtctccctgctttctcacttttgtttCATCTGCTGACTATCGTTTGCCTTGC
TTGTCGCTTGCTTGGAAGACATCCTCAGCCCTTGCACGCACCAAGTCACAGACAAGGGCT
GATTGCCTTGACACTCTCAGTTTAAGGCTTGAAATGTAACAAAGTGGCTGCTGTGCGGCC
ATGGGCCCAGGGAGCCTGGAATCCTCTGCCCCCGCGCTCATACTGAGGCCTGCGAGCGGC
ATTGCGCTGAAGGAAGGCGAACGAGTGTGGGAGATATGCCCGATTCGGCCCGGCGCCGGT
CAACTTTATCTAGACAGCACCAATGTCGTAAAGAGCATCAAGTCATGGGCAGAGGTCCGC
TGTCGGTATGTAGGTCACCCCAGGCGAAGCCACGCGCTTCCGGCTCTCTTCGTGTCTGGT
CTCATGAAGACCGGGAAATCGTACACGTTGGAGAATGTGGTCCCGGCGGTGCTGGCTCAG
GAGCTGAGCCAGCAGCGGCCTGATCACCCGCTGAAGGGCATGGCTGTGCTGCGGCTGAAC
TGCCTGCGGCTGGACCGCCAGGGGACGACCGCGCTGCTGTACAGCGTCCTGGAAACGATG
GTTGCTTGGGTGGAACGTGCCGAAGTGAAGGTCAAGGATGGCGCATGGCAGCAGGCGACG
CGGGTGCGTGGCGATGCAGCCGGCAGCCGTACACGCACACGCGCCGGGATGGCTATTCTG
GAGCTGCTGCAGGGCCTCGAGACCCCGGTGCTGGTGCTGATGGACGAGGTGCAGGCCCTG
CTGCAGCCCACCAACGCGCGCGGTGAACCCGACCTGGACGGCGTCAGCTACATCCGCGAC
GTGGTGCTACGCCAGA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000007A_C01 KCC000007A_c01
         (856 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_626507.1| putative multi-domain regulatory protein. [Stre...    59  1e-07
sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 precursor (...    55  2e-06
dbj|BAC37396.1| unnamed protein product [Mus musculus]                 54  4e-06
dbj|BAC58076.2| large tegument protein [Cercopithecine herpesvir...    53  7e-06
ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum] gi|27348769|...    53  7e-06

>ref|NP_626507.1| putative multi-domain regulatory protein. [Streptomyces coelicolor
           A3(2)] gi|11356702|pir||T50568 probable multi-domain
           regulatory protein [imported] - Streptomyces coelicolor
           gi|6469244|emb|CAB61705.1| putative multi-domain
           regulatory protein. [Streptomyces coelicolor A3(2)]
          Length = 1334

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 48/138 (34%), Positives = 57/138 (40%), Gaps = 8/138 (5%)
 Frame = -1

Query: 847 APRRGCS*RRPGRVHRARWWAAAGPAPRP-SAPAPGSRGPAAAPE*PSRRVCVYGCRLHR 671
           AP  G +   PG  +       AG  P P +APAPG+ GPA        R   Y      
Sbjct: 361 APAPGTAGPAPGTSYAPGTAPVAGTTPAPGTAPAPGTAGPA--------RDTSYAPGTAP 412

Query: 670 HAPASPAAMRHP*PSLRHVPPKQPSFPGRCTAARSSPG-------GPAAGSSAAAQPCPS 512
            A  +PA    P P     P   P+ PG   A    P        GPA+G+   A   P 
Sbjct: 413 VAGTTPAPGTAPAPGSTPAPGTVPA-PGTAPAPGPQPADGRRPVTGPASGTGPGAATPPE 471

Query: 511 AGDQAAAGSAPEPAPPGP 458
           A   A+AGSAP PAP GP
Sbjct: 472 AAAAASAGSAPSPAPEGP 489

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 42/115 (36%), Positives = 48/115 (41%), Gaps = 2/115 (1%)
 Frame = -1

Query: 784 AAGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPK 605
           A+GPA  P A APGS G  A    P+            H  AS AA   P P     P  
Sbjct: 296 ASGPASGP-AVAPGSGGGPAPGWWPAPGTAPGSSTAPPHDTAS-AADTAPAPGPTSAPGT 353

Query: 604 QPSFPGRCTAARSSPG--GPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSPT 446
            P+       A  +PG  GPA G+S A    P AG   A G+AP P   GP   T
Sbjct: 354 APA----AGTAAPAPGTAGPAPGTSYAPGTAPVAGTTPAPGTAPAPGTAGPARDT 404

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 38/114 (33%), Positives = 48/114 (41%), Gaps = 8/114 (7%)
 Frame = -1

Query: 775 PAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPAS-PAAMRHP*PSLRHVPPKQP 599
           PA   +APAPG+ GPA                   +AP + P A   P       P   P
Sbjct: 355 PAAGTAAPAPGTAGPAPGTS---------------YAPGTAPVAGTTP------APGTAP 393

Query: 598 SFPGRCTAARS---SPG-GPAAGSSAAAQPCPSAGDQAAAGSAPEP--AP-PGP 458
           + PG    AR    +PG  P AG++ A    P+ G   A G+ P P  AP PGP
Sbjct: 394 A-PGTAGPARDTSYAPGTAPVAGTTPAPGTAPAPGSTPAPGTVPAPGTAPAPGP 446

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 36/109 (33%), Positives = 41/109 (37%), Gaps = 1/109 (0%)
 Frame = +3

Query: 459 GPGGAGSGAEPAAA*SPAEGHGCAAAELPAAGPPGDDRAAVQRPGNDGCLGGTCRSEGQG 638
           GPG A SGA  A+    A G G A+   PA+GP      A   PG+ G           G
Sbjct: 268 GPGPA-SGAGAASGTDVASGAGAASGPDPASGPASGPAVA---PGSGG-------GPAPG 316

Query: 639 WRMAAGDAGAWRCSRQPYTHTRRDGYSGAAAGPRD-PGAGADGRGAGPA 782
           W  A G A     S  P   T     +  A GP   PG       A PA
Sbjct: 317 WWPAPGTAPG--SSTAPPHDTASAADTAPAPGPTSAPGTAPAAGTAAPA 363

>sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 precursor (Hydroxyproline-rich
           glycoprotein 1) gi|12018147|gb|AAG45420.1|AF309494_1
           vegetative cell wall protein gp1 [Chlamydomonas
           reinhardtii]
          Length = 555

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 40/111 (36%), Positives = 46/111 (41%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQ 602
           A P+P P +PAP    P+ AP  PS  V           P SP+    P P+     P  
Sbjct: 133 APPSPSPPSPAP-PLPPSPAPPSPSPPV-----------PPSPSPPVPPSPAPPSPTPPS 180

Query: 601 PSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSP 449
           PS P   + A  SP  P   S A   P P      A  S P PAPP P SP
Sbjct: 181 PSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSP 231

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 43/113 (38%), Positives = 48/113 (42%), Gaps = 2/113 (1%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSRGP--AAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPP 608
           A P+P P +PAP S GP   A P  PS             AP SPA      PS     P
Sbjct: 54  APPSPAPPSPAPPSPGPPSPAPPSPPS------------PAPPSPAPPSPAPPSPAPPSP 101

Query: 607 KQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSP 449
             PS P   + A  SP  P+  S A   P P A     + S P PAPP P SP
Sbjct: 102 APPS-PAPPSPAPPSPAPPSPPSPAPPSPSPPA---PPSPSPPSPAPPLPPSP 150

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 37/112 (33%), Positives = 44/112 (39%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQ 602
           A P+P P +PAP S  P + P  PS             AP SPA      PS     P  
Sbjct: 82  APPSPAPPSPAPPSPAPPS-PAPPSP------------APPSPAPPSPAPPSPPSPAPPS 128

Query: 601 PSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSPT 446
           PS P   + +  SP  P   S A   P P      +    P PAPP P  P+
Sbjct: 129 PSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPS 180

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 36/112 (32%), Positives = 45/112 (40%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQ 602
           A P+P P +PAP S  P  +P  PS              P SPA    P P+     P  
Sbjct: 44  APPSPAPPSPAPPSPAP-PSPAPPS------------PGPPSPAPPSPPSPAPPSPAPPS 90

Query: 601 PSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSPT 446
           P+ P     +  +P  PA  S A   P P +    A  S   PAPP P  P+
Sbjct: 91  PAPPSPAPPS-PAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPS 141

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 34/112 (30%), Positives = 41/112 (36%)
 Frame = -1

Query: 775 PAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQPS 596
           P+P P +PAP S  P + P  PS             AP SPA      PS     P  P+
Sbjct: 79  PSPAPPSPAPPSPAPPS-PAPPSP------------APPSPAPPSPAPPSPAPPSPPSPA 125

Query: 595 FPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSPTCT 440
            P     A  SP  P+        P P +       S   P PP P  P+ T
Sbjct: 126 PPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPT 177

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 33/112 (29%), Positives = 42/112 (37%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQ 602
           A P+P P +PAP    P+ AP  P               PA P     P PS    PP +
Sbjct: 240 APPSPVPPSPAP----PSPAPPSPK-------------PPAPP-----PPPSPPPPPPPR 277

Query: 601 PSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSPT 446
           P FP       S P  P + +       PS    +    +P P PP P  P+
Sbjct: 278 PPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPS 329

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 34/111 (30%), Positives = 43/111 (38%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQ 602
           A P+P P +PAP S  P + P  PS             AP SPA    P P+     P  
Sbjct: 87  APPSPAPPSPAPPSPAPPS-PAPPSP------------APPSPAPPSPPSPAPPSPSPPA 133

Query: 601 PSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSP 449
           P  P   + A   P  PA  S +   P   +     + + P P PP P  P
Sbjct: 134 PPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPP 184

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 37/112 (33%), Positives = 42/112 (37%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQ 602
           A P+P P AP P    P+ AP  P              AP SP+    P PS    PP  
Sbjct: 125 APPSPSPPAP-PSPSPPSPAPPLPPSP-----------APPSPSPPVPPSPS----PPVP 168

Query: 601 PSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSPT 446
           PS P   +    SP  P   S A   P P      A  S   P PP P  P+
Sbjct: 169 PS-PAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPS 219

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 35/109 (32%), Positives = 44/109 (40%)
 Frame = -1

Query: 775 PAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQPS 596
           P+P P +PAP    P+ AP  P+  V           P SPA    P P+    PP  PS
Sbjct: 187 PSPAPPSPAPPVP-PSPAPPSPAPPV-----------PPSPAPPSPPSPA----PPSPPS 230

Query: 595 FPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSP 449
            P   + +  +P  P   S A   P P +    A    P P PP P  P
Sbjct: 231 -PAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRP 278

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 37/113 (32%), Positives = 43/113 (37%), Gaps = 2/113 (1%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQ 602
           A P+P P +PAP S  P + P  PS             AP SP +   P PS     P  
Sbjct: 92  APPSPAPPSPAPPSPAPPS-PAPPSP------------APPSPPSPAPPSPS--PPAPPS 136

Query: 601 PSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSA--PEPAPPGPHSP 449
           PS P        SP  P+        P P      A  S   P P+PP P SP
Sbjct: 137 PSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSP 189

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 42/158 (26%), Positives = 52/158 (32%), Gaps = 24/158 (15%)
 Frame = -1

Query: 775 PAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQPS 596
           P+P P +PAP S  P A P  PS              P  P   R P P+   +PP  PS
Sbjct: 247 PSPAPPSPAPPSPKPPAPPPPPS--------------PPPPPPPRPPFPANTPMPPSPPS 292

Query: 595 FPGRC------TAARSSPGGPAAGSSAA------------------AQPCPSAGDQAAAG 488
            P         T    SP  P   S A                   A P PS     +  
Sbjct: 293 PPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPS 352

Query: 487 SAPEPAPPGPHSPTCTISRSS*DQTRREPEARGFAWGD 374
            +P P+P    SP+ +   S   +    P A    W D
Sbjct: 353 PSPSPSPSPSPSPSPSPIPSPSPKPSPSPVAVKLVWAD 390

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 33/110 (30%), Positives = 39/110 (35%)
 Frame = -1

Query: 775 PAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQPS 596
           P+P P +P P S  P   P                 AP SPA    P P+     P  P 
Sbjct: 169 PSPAPPSPTPPSPSPPVPPS---------------PAPPSPAPPVPPSPAPPSPAPPVP- 212

Query: 595 FPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSPT 446
            P     +  SP  P+  S A   P P A         P PAPP P  P+
Sbjct: 213 -PSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVP---PSPAPPSPAPPS 258

 Score = 41.2 bits (95), Expect = 0.022
 Identities = 32/106 (30%), Positives = 39/106 (36%)
 Frame = -1

Query: 775 PAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQPS 596
           P+P P +PAP      A P  PS             AP SP +   P PS    P   P 
Sbjct: 200 PSPAPPSPAPPVPPSPAPPSPPSP------------APPSPPSPAPPSPSPPAPPSPVPP 247

Query: 595 FPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGP 458
            P   + A  SP  PA     +  P P       A +   P+PP P
Sbjct: 248 SPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSP 293

 Score = 41.2 bits (95), Expect = 0.022
 Identities = 33/112 (29%), Positives = 41/112 (36%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQ 602
           A P+P P +PAP S  P + P                 AP SP+    P PS     P  
Sbjct: 102 APPSPAPPSPAPPSPAPPSPPS---------------PAPPSPSPPAPPSPS-----PPS 141

Query: 601 PSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSPT 446
           P+ P   + A  SP  P   S +   P   A       S   P PP P  P+
Sbjct: 142 PAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPS 193

>dbj|BAC37396.1| unnamed protein product [Mus musculus]
          Length = 221

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 48/135 (35%), Positives = 58/135 (42%), Gaps = 8/135 (5%)
 Frame = -1

Query: 823 RRPGRVHRARWWAAAGPAPRPSAPAPGSRGPAAAPE*PSRR--VCVYGCRLHRHAPASPA 650
           RR  R  R+    AAGPAP P+  A G  GP A     +RR      GC   R AP+ PA
Sbjct: 15  RRWRRDPRSSCGPAAGPAPPPAPTAAGRSGPEAGAPGATRRGGRRASGCWGCRSAPSVPA 74

Query: 649 AMRHP*PSLRHVPPKQPSFPGRCTAARSSPGG----PAAGSSAAAQPCPSAGDQAAAGSA 482
           A   P  +  H P   P+      A R SPG     P     +AA P P++G    A + 
Sbjct: 75  AAAKPGVAPAH-PRASPA-----AAERPSPGSGRAQPIPPRGSAASPKPTSGALTPAAAP 128

Query: 481 PEPAPPG--PHSPTC 443
           P   PP   P S  C
Sbjct: 129 PTARPPAALPASSAC 143

>dbj|BAC58076.2| large tegument protein [Cercopithecine herpesvirus 1]
          Length = 3326

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 43/116 (37%), Positives = 54/116 (46%), Gaps = 3/116 (2%)
 Frame = -1

Query: 787  AAAGPAPRPSAPA-PGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVP 611
            AAAG A  P APA P +    AAP  P+             APA+PAA   P        
Sbjct: 2845 AAAGRASAPPAPAAPAAPAAPAAPAAPA-------------APAAPAAPAAPAAPAAPAA 2891

Query: 610  PKQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPA--PPGPHSP 449
            P  P+ P    AA ++P  PAA ++ AA   P+A    AA +AP PA  P  P +P
Sbjct: 2892 PAAPAAP----AAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPAAPAAP 2943

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 47/138 (34%), Positives = 61/138 (44%), Gaps = 2/138 (1%)
 Frame = -1

Query: 856  SGVAPRRGCS*RRPGRVHRARWWAAAGPAPR-PSAPA-PGSRGPAAAPE*PSRRVCVYGC 683
            +   P R  S   P     A   A+A PAP  P+APA P +    AAP  P+        
Sbjct: 2827 AATGPTRPTSPATPTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAPA-------- 2878

Query: 682  RLHRHAPASPAAMRHP*PSLRHVPPKQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGD 503
                 APA+PAA   P        P  P+ P    AA ++P  PAA ++ AA   P+A  
Sbjct: 2879 -----APAAPAAPAAPAAPAAPAAPAAPAAPA-APAAPAAPAAPAAPAAPAAPAAPAAPA 2932

Query: 502  QAAAGSAPEPAPPGPHSP 449
             AA  +AP  AP  P +P
Sbjct: 2933 PAAVPAAP-AAPAAPAAP 2949

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 42/113 (37%), Positives = 54/113 (47%)
 Frame = -1

Query: 787  AAAGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPP 608
            A+A PAP P A A G   P + P  P+  V   G      APA+PAA   P        P
Sbjct: 2817 ASATPAPPPVA-ATGPTRPTS-PATPTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAP 2874

Query: 607  KQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSP 449
              P+ P    AA ++P  PAA ++ AA   P+A    AA +AP  AP  P +P
Sbjct: 2875 AAPAAPA-APAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAP-AAPAAPAAP 2925

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 40/123 (32%), Positives = 56/123 (45%), Gaps = 2/123 (1%)
 Frame = -1

Query: 787  AAAGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPP 608
            A A PA   +  AP +    AAP  P+             APA+PAA   P        P
Sbjct: 2882 APAAPAAPAAPAAPAAPAAPAAPAAPA-------------APAAPAAPAAPAAPAAPAAP 2928

Query: 607  KQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPA--PPGPHSPTCTIS 434
              P+ P    AA ++P  PAA ++ AA   P+A    AA +AP PA  P    +PT T++
Sbjct: 2929 AAPA-PAAVPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPVVVPAPTATLT 2987

Query: 433  RSS 425
             ++
Sbjct: 2988 ATT 2990

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 38/119 (31%), Positives = 49/119 (40%), Gaps = 1/119 (0%)
 Frame = -1

Query: 787  AAAGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPP 608
            A A PA   +  AP +  PAA P  P+             APA+PAA   P        P
Sbjct: 2915 APAAPAAPAAPAAPAAPAPAAVPAAPA-------------APAAPAAPAAP------AAP 2955

Query: 607  KQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEP-APPGPHSPTCTIS 434
              P+ P    AA ++P  PA  +     P P+A   A   ++P P A P    PT T S
Sbjct: 2956 AAPAAP----AAPAAPAAPAPAAVPVVVPAPTATLTATTTTSPAPAATPASPVPTPTSS 3010

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 31/111 (27%), Positives = 39/111 (34%), Gaps = 7/111 (6%)
 Frame = -1

Query: 775  PAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQPS 596
            P P P A  P +   +  P  P+ R      +     P +P     P       P   P 
Sbjct: 2631 PPPLPPAARPAAPDRSVPPPRPAPRPSEPAVQSRARRPDAPPQSARP-----RTPRDDPG 2685

Query: 595  FPGRCTAARSSPGGPAAGSSAAAQPCPS-------AGDQAAAGSAPEPAPP 464
             P   +    SP  PA        P PS        G+ AAA SAP+P PP
Sbjct: 2686 PPAAPSTLPPSPPPPAPHPPDPPPPDPSPRPNELGGGETAAAPSAPDPPPP 2736

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 36/115 (31%), Positives = 46/115 (39%), Gaps = 7/115 (6%)
 Frame = -1

Query: 763  PSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPK----QPS 596
            PS P P    P   P  PS R    G        A+P+A   P P     P +    +  
Sbjct: 2695 PSPPPPAPHPPDPPPPDPSPRPNELG---GGETAAAPSAPDPPPPQTVRAPERPRDDRAP 2751

Query: 595  FPGRCTAAR-SSPGGPAAGSSAAAQPCPSAGDQAAAG--SAPEPAPPGPHSPTCT 440
             PGR +  R +S  G  A SS   +P   A   A     +  +P PPGP +PT T
Sbjct: 2752 APGRVSLPRRASRQGRPAPSSPLQRPRRRAARPAVGSLTNLADPHPPGPETPTPT 2806

 Score = 36.2 bits (82), Expect = 0.70
 Identities = 37/130 (28%), Positives = 48/130 (36%), Gaps = 17/130 (13%)
 Frame = -1

Query: 784 AAGPAP-----RP----SAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPA------ 650
           AAGP P     RP    + P PG+     AP  P       G       P +PA      
Sbjct: 405 AAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGRPPTP 464

Query: 649 AMRHP*PSLRHVPP--KQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPE 476
           A R P P+ R   P  + P+  GR       P  PA      A   P+  +  A+   P 
Sbjct: 465 AGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPANPTASSEPPT 524

Query: 475 PAPPGPHSPT 446
           P P G  +P+
Sbjct: 525 PNPEGAPAPS 534

>ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum] gi|27348769|dbj|BAC45786.1|
           blr0521 [Bradyrhizobium japonicum USDA 110]
          Length = 745

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 42/117 (35%), Positives = 47/117 (39%), Gaps = 5/117 (4%)
 Frame = -1

Query: 784 AAGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PS-----LR 620
           AA P PRP+AP P    PAA P  P               P  PAA + P P       +
Sbjct: 86  AAAP-PRPAAPPPPPPPPAARPAPPP-------------PPPPPAAPKQPSPPPAAAPQQ 131

Query: 619 HVPPKQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSP 449
           H P   P  P    AAR +P  PA   +AA Q  P      AA   P P PP P  P
Sbjct: 132 HAPTPPPPAP---PAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPPAGP 185

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 38/108 (35%), Positives = 46/108 (42%), Gaps = 3/108 (2%)
 Frame = -1

Query: 778 GPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPA-AMRHP*PSLRHVPPKQ 602
           GP  +P  P  G  G AA P  P+R           H PA+P  A   P P+    PP  
Sbjct: 43  GPDGKPKQPPKGPPG-AAPPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPP 101

Query: 601 PSFPGRCTAARSSPGGPAAGSSAAAQPC--PSAGDQAAAGSAPEPAPP 464
           P       AAR +P  P    +A  QP   P+A  Q  A + P PAPP
Sbjct: 102 P-------AARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPP 142

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 40/115 (34%), Positives = 47/115 (40%), Gaps = 3/115 (2%)
 Frame = -1

Query: 775 PAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQPS 596
           P P P+AP   S  PAAAP+  +           R AP  PA      P     PP  P+
Sbjct: 111 PPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPA 170

Query: 595 FPGRCTAARSSPGGPAAGSSAA--AQPCPSAGDQAAAGSAP-EPAPPGPHSPTCT 440
                T     P GPAA  + A  A P P A   AA  + P  PAP    +PT T
Sbjct: 171 ARPTPTPPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAPTPT 225

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 40/124 (32%), Positives = 48/124 (38%), Gaps = 10/124 (8%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPKQ 602
           A PA RP AP P +  PAAAP+               HAP  P     P P+ R  P   
Sbjct: 140 APPAARP-APTPPAPPPAAAPQ---------------HAPPPP-----PPPAARPTPTPP 178

Query: 601 PSFPGRCTAARSSPGG----------PAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHS 452
           P  P    AAR +P            PAA ++    P P+    A     P PAP    +
Sbjct: 179 PPPPAG-PAARPTPAPTATPTPVAPPPAAPTARPGSPAPA----ATPAPTPTPAPTATPA 233

Query: 451 PTCT 440
           PT T
Sbjct: 234 PTAT 237

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 44/141 (31%), Positives = 49/141 (34%), Gaps = 11/141 (7%)
 Frame = -1

Query: 850 VAPRRGCS*RRPGRVHRARWWAAAGPAPRPSA-------PAPGSRG---PAAAPE*PSRR 701
           VAP       RPG    A    A  P P P+A       PAPGS     PA  P  P   
Sbjct: 200 VAPPPAAPTARPGSPAPAAT-PAPTPTPAPTATPAPTATPAPGSTPGAPPAGRPGAPPPG 258

Query: 700 VCVYGCRLHRHAPASP-AAMRHP*PSLRHVPPKQPSFPGRCTAARSSPGGPAAGSSAAAQ 524
           V           P SP AA   P P     P   P+  G  T     PG  +  +  AA 
Sbjct: 259 V----------RPGSPPAAGSPPAPGATPAPTTTPAPGGTATPPSGRPGPASTPAPGAAT 308

Query: 523 PCPSAGDQAAAGSAPEPAPPG 461
           P P+A         P P  PG
Sbjct: 309 PAPTATPAPGGALTPPPGRPG 329

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 35/109 (32%), Positives = 39/109 (35%)
 Frame = -1

Query: 784 AAGPAPRPSAPAPGSRGPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPPK 605
           AA PAP P AP P +  P  AP  P               PA PAA   P P+    P  
Sbjct: 143 AARPAPTPPAPPPAA-APQHAPPPPPPPAARPTPTPPPPPPAGPAARPTPAPTATPTPVA 201

Query: 604 QPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGP 458
            P        AR     PAA  +    P P+A     A  AP   P  P
Sbjct: 202 PPP---AAPTARPGSPAPAATPAPTPTPAPTATPAPTATPAPGSTPGAP 247

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 22/55 (40%), Positives = 25/55 (45%)
 Frame = -1

Query: 613 PPKQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAGSAPEPAPPGPHSP 449
           PP  P+ P     A + P  PAA   AAA P P+A        A  PAPP P  P
Sbjct: 60  PPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPP 114

 Score = 37.0 bits (84), Expect = 0.41
 Identities = 41/134 (30%), Positives = 48/134 (35%), Gaps = 9/134 (6%)
 Frame = -1

Query: 820 RPGRVHRARWWAAAGPAPRPSA-PAPGSR--------GPAAAPE*PSRRVCVYGCRLHRH 668
           RPG    A    A G  P P+  PAPG          GPA+ P                 
Sbjct: 260 RPGSPPAAGSPPAPGATPAPTTTPAPGGTATPPSGRPGPASTPA---------------P 304

Query: 667 APASPAAMRHP*PSLRHVPPKQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAG 488
             A+PA    P P     PP  P  PG         G P AG+ AA  P  +A  QA   
Sbjct: 305 GAATPAPTATPAPGGALTPP--PGRPGAGPTPGPQGGTPPAGAPAAGTP--AAPPQAGGL 360

Query: 487 SAPEPAPPGPHSPT 446
            A   AP G  +P+
Sbjct: 361 PARPAAPAGAAAPS 374

 Score = 35.8 bits (81), Expect = 0.92
 Identities = 35/116 (30%), Positives = 40/116 (34%), Gaps = 5/116 (4%)
 Frame = -1

Query: 781 AGPAPRPSAPAPGSR--GPAAAPE*PSRRVCVYGCRLHRHAPASPAAMRHP*PSLRHVPP 608
           A PA RP AP PG R   P AA   P+               A+PA    P P     PP
Sbjct: 246 APPAGRPGAPPPGVRPGSPPAAGSPPA-------------PGATPAPTTTPAPGGTATPP 292

Query: 607 KQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAG---DQAAAGSAPEPAPPGPHSP 449
                P       S+P   AA  +  A P P           G+ P P P G   P
Sbjct: 293 SGRPGPA------STPAPGAATPAPTATPAPGGALTPPPGRPGAGPTPGPQGGTPP 342

 Score = 35.8 bits (81), Expect = 0.92
 Identities = 23/55 (41%), Positives = 26/55 (46%), Gaps = 4/55 (7%)
 Frame = -1

Query: 610 PKQPSFPGRCTAARSSPGGPAAGSSAAAQPCPSAGDQAAAG----SAPEPAPPGP 458
           PKQP       A  ++P  PAA   AAA P P A    AA     +AP P PP P
Sbjct: 48  PKQPPKGPPGAAPPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPP 102



EST assemble image


clone accession position
1 HCL077g07_r AV643885 1 536
2 HCL037f07_r AV641623 35 548
3 HCL020d11_r AV640679 35 469
4 MXL025f05_r BP094611 37 483
5 HCL086d09_r AV644328 37 554
6 HCL080g03_r AV644040 175 739
7 CL01b02_r AV393305 200 646
8 CL75e04_r AV397074 324 872
9 LCL081e02_r AV630607 476 817




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research