KCC000006A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000006A_C01 KCC000006A_c01
ctctccggaaagcctagtatcgaggaggtccagcgggttgcagagaaactcgacaacgaa
ctccgcgtcgggggcaaagcCATAAATGTCCGCGTCTGCGAGCCCTCGTCGACGGGCGCG
CCCCAACCAGTGCAGCCCACGGAGCCGCCAGTCAGTTGGGACCAGCCTGTTGAGCGCATT
TCGCGGCTCTGCGCTCAGGTGCTGCACTGCTACTTCGCCCGTCGGTCACACCAGCCCGAG
TTCAAAGCAGAGAAGCTGCTCGCGCTGCTCAGCATGACCGTCGCGCCTTCGCGCGGGCAG
GAGCCAAAGCCACTCGCTTTGTGGGCAAAGGAGGTCTTTGGCAGCATGGAGCAGATGCTT
TTAGCCATCGGCGACGCGCATTTCGGCGCATCTACTTGGTCGCTGACCGGCGCTGTCGCG
GAGCGCAGCGCCAAGCTCGCAGTGGGGAAGGCTCGCAATATGCAGGGCTGGGATCCGCTA
CGGGACCCGCTACCCATCGCAACGCTGCTGCGGCTCGCGGCGTGCCGGCAGCGGCTTGAC
GAGTCGCACACCCCGCAGTCGCAGCGCTCGGGCTTCTCCACGCCAACCTGCTGCACAGCG
CAGGACTCTTGTCGACGCTCCAGCGACTGCGGCAGCCTCAGCGCGGTGCACAGCAGCGAG
CAGCCCAGCTGCAGCCAGTCGGAGGCGTCCTGGTCGCTACGGTCTGGCTGCAACGGGGCA
CAGACCGGCAGCGCGGTCTGCTCGCCGCCGCTGGACGCCATGACAAGCAGCGGCTCGGAA
GAGCAGCCGCTGTCGACCGCGTCGCCGGCGTCGGTGGCATCCTACGACTCGTTGCGGGCC
AACAGCGGCTCGGGGTCGCTGGTGGGGTTGGTGGAGTCGGCGCCGGTGGGGAGTAGCGAC
AGCGGCCAGGGTGCTGGGACAGGCCAGTCGACCCCGGAGGCGGCGGTGCAGGAACAGCAA
CAGGAGGGACGGTTCAAGCCAGCATCGTCGTCGCCAAAGATGACGGTGGCCGGGGCCAGC
GACAGCGCAGCTTCGCCAGCGGGA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000006A_C01 KCC000006A_c01
         (1044 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_510481.1| putative protein (XP580) [Caenorhabditis elegan...    64  4e-09
pir||T44768 antifreeze glycopeptide AFGP polyprotein precursor [...    64  6e-09
pir||B89716 protein F45B8.3 [imported] - Caenorhabditis elegans        63  7e-09
dbj|BAC58076.2| large tegument protein [Cercopithecine herpesvir...    62  1e-08
ref|NP_780438.1| RIKEN cDNA 5033413A03 [Mus musculus] gi|2635495...    62  2e-08

>ref|NP_510481.1| putative protein (XP580) [Caenorhabditis elegans]
            gi|7503429|pir||T22216 hypothetical protein F45B8.3 -
            Caenorhabditis elegans gi|5824504|emb|CAB05726.2|
            Hypothetical protein F45B8.3 [Caenorhabditis elegans]
          Length = 241

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 53/159 (33%), Positives = 63/159 (39%), Gaps = 11/159 (6%)
 Frame = -3

Query: 1024 CRWPRPPSSLATTMLA*TVPPVAVPAPPPPGS--TGLSQHPGRCRYSPPAPT----PPTP 863
            C  PRP  S         VPP  +P PPPP S   G S  P  C   PPAP     PP P
Sbjct: 71   CGAPRPSPSCCPY-----VPPAPLPPPPPPASPCCGPSPVPAPCCPPPPAPAAPCCPPPP 125

Query: 862  PATPSRCWPATSRRMPPTPATRSTAAALP-----SRCLSWRPAAASRPRCRSVPRCSQTV 698
            P TPS         +P  P  +  AAA+P       C    P   + P C+  PR +  V
Sbjct: 126  PPTPSPLVCCKQAPVPENPCCQIVAAAMPPPPSAPACCVAAP-VPTNPCCQPAPRPAPCV 184

Query: 697  ATRTPPTGCSWAARCCAPR*GCRSRWSVDKSPALCSRLA 581
             +   P  C    RC AP   C    + D     CS +A
Sbjct: 185  CSAPRPVPC----RCGAPPMECP---NCDMPAPRCSMMA 216

>pir||T44768 antifreeze glycopeptide AFGP polyprotein precursor [imported] -
            Boreogadus saida gi|2078483|gb|AAC60129.1| antifreeze
            glycopeptide AFGP polyprotein precursor
          Length = 507

 Score = 63.5 bits (153), Expect = 6e-09
 Identities = 81/305 (26%), Positives = 109/305 (35%), Gaps = 3/305 (0%)
 Frame = -3

Query: 1006 PSSLATTMLA*TVPPVAVPAPPPPGSTGLSQHPGRCRY---SPPAPTPPTPPATPSRCWP 836
            P+  AT   A T    A PA     +T  +           +P     P  PAT +R   
Sbjct: 128  PARAATPATAATPATAATPATAATAATAATSATAATAARAATPATAATPATPATAARAAR 187

Query: 835  ATSRRMPPTPATRSTAAALPSRCLSWRPAAASRPRCRSVPRCSQTVATRTPPTGCSWAAR 656
            A +     T AT +TAA   +   +   A  +R    + P  + T AT   P   + AA 
Sbjct: 188  AATPATAATAATAATAATAATAATAATAATPARAARAATPATAPTPATAATPATAATAA- 246

Query: 655  CCAPR*GCRSRWSVDKSPALCSRLAWRSPSAATAGCATRQAAAGTPRAAAALRWVAGPVA 476
              AP     +R +   +PA  + LA  +  A  A  AT  AA     A AA    A   A
Sbjct: 247  -TAPTAATPARAARAATPATAATLATAATPATPATPAT--AATDATAATAATPARAATPA 303

Query: 475  DPSPAYCEPSPLRAWRCAPRQRRSATK*MRRNARRRWLKASAPCCQRPPLPTKRVALAPA 296
             P+ A    +P  A   A     +      R AR     A+ P     P      A A  
Sbjct: 304  TPATAATPATPATAATAATAATAATAATPARAAR-----AATPATAATPATAATAATAAT 358

Query: 295  RAKARRSC*AARAASLL*TRAGVTDGRSSSAAPERRAAKCAQQAGPN*LAAPWAALVGAR 116
             A A  +   ARAA         T   +++AA    AA  A+ A     A P      A 
Sbjct: 359  AATAATAATPARAARAATPATAATAATAATAATAATAATPARAARAATPATPATPATPAT 418

Query: 115  PSTRA 101
            P+T A
Sbjct: 419  PATAA 423

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 81/306 (26%), Positives = 107/306 (34%), Gaps = 4/306 (1%)
 Frame = -3

Query: 1006 PSSLATTMLA*TVPPVAVPAPPPPGSTGLSQHPGRCRYSPPAPTPPTPPATPSRCWPATS 827
            P++ A      T    A  A P   +T  ++          A T  TP    +    AT+
Sbjct: 28   PAAAARAATPATAATPATAATPATAATAATE--------ATAATAATPATAATPATAATA 79

Query: 826  RRMPPTPATRSTAAALPSRCLSWRPAAASRPRCRSVPRCSQTVATRTPPTGCSWAARCCA 647
                 T AT +TAA  P+R      A A+ P   + P  + T AT          AR   
Sbjct: 80   ATTAATAATAATAAT-PARA-----ARAATPATAATPATAATAATAATAATAETPARAAT 133

Query: 646  PR*GCRSRWSVDKSPALCSRLAWRSPSAATAGCATRQAAAGTPRAAAALRWVAGPVADPS 467
            P        +   + A  +  A  S +AATA  A   A A TP A  A    A   A P+
Sbjct: 134  PATAATPATAATPATAATAATAATSATAATAARAATPATAATP-ATPATAARAARAATPA 192

Query: 466  PAYCEPSPLRAWRCAPRQRRSATK*MRRNARRRW-LKASAPCCQRPPLPTKRVALAPAR- 293
             A    +   A   A     +      R AR      A  P     P      A AP   
Sbjct: 193  TAATAATAATAATAATAATAATAATPARAARAATPATAPTPATAATPATAATAATAPTAA 252

Query: 292  --AKARRSC*AARAASLL*TRAGVTDGRSSSAAPERRAAKCAQQAGPN*LAAPWAALVGA 119
              A+A R+   A AA+L       T    ++AA +  AA  A  A     A P  A   A
Sbjct: 253  TPARAARAATPATAATLATAATPATPATPATAATDATAATAATPARAATPATPATAATPA 312

Query: 118  RPSTRA 101
             P+T A
Sbjct: 313  TPATAA 318

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 56/212 (26%), Positives = 75/212 (34%), Gaps = 14/212 (6%)
 Frame = -3

Query: 1015 PRPPSSLATTMLA*TVPPVAVPAPPPPGSTGLSQHPGRCRYSPPAPTPPTPPATPSRCWP 836
            P   +  AT   A T+   A PA P   +T  +        +P     P  PAT +    
Sbjct: 254  PARAARAATPATAATLATAATPATPATPATAATDATAATAATPARAATPATPATAA---- 309

Query: 835  ATSRRMPPTPATRSTAAALPSRCLSWRPAAASRPRCRSVPRCSQTVATRTPPTGCSWAAR 656
                  P TPAT +TAA   +   +  PA A+R    +      T AT       + AA 
Sbjct: 310  -----TPATPATAATAATAATAATAATPARAARAATPATAATPATAATAATAATAATAAT 364

Query: 655  CCAPR*GCRSRWSVDKSPALCSRLAWRSPSAATAGCATRQAAAGTP-------------- 518
               P    R+      + A  +  A  + +AAT   A R A   TP              
Sbjct: 365  AATPARAARAATPATAATAATAATAATAATAATPARAARAATPATPATPATPATPATAAT 424

Query: 517  RAAAALRWVAGPVADPSPAYCEPSPLRAWRCA 422
             A AA    A   A  + A   P+P RA R A
Sbjct: 425  AATAATAATAATAATAATAATAPTPARAARAA 456

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 82/333 (24%), Positives = 112/333 (33%), Gaps = 25/333 (7%)
 Frame = -3

Query: 1042 PLAKLRCRWPRPPSSLATTMLA*TVPPVAVPAPPPPGSTGLSQHPGRCRYSPPAPTPPTP 863
            P    R      P++ AT   A T    A  A     +T           + P P     
Sbjct: 179  PATAARAARAATPATAATAATAATAATAATAATAATAATPARAARAATPATAPTPATAAT 238

Query: 862  PAT-------PSRCWPATSRR--------------MPPTPATRSTAAALPSRCLSWRPAA 746
            PAT       P+   PA + R               P TPAT +TAA   +   +  PA 
Sbjct: 239  PATAATAATAPTAATPARAARAATPATAATLATAATPATPATPATAATDATAATAATPAR 298

Query: 745  ASRPRCRSVPRCSQTVATRTPPTGCSWAARCCAPR*GCRS---RWSVDKSPALCSRLAWR 575
            A+ P   +      T AT       + AA    P    R+     +   + A  +  A  
Sbjct: 299  AATPATPATAATPATPATAATAATAATAATAATPARAARAATPATAATPATAATAATAAT 358

Query: 574  SPSAATAGCATRQAAAGTPRAAAALRWVAGPVADPSPAYCEPSPLRAWRCAPRQRRSATK 395
            + +AATA    R A A TP  AA     A   A  + A    +P RA R A     +   
Sbjct: 359  AATAATAATPARAARAATPATAA----TAATAATAATAATAATPARAARAATPATPATPA 414

Query: 394  *MRRNARRRWLKASAPCCQRPPLPT-KRVALAPARAKARRSC*AARAASLL*TRAGVTDG 218
                 A       +A         T    A AP  A+A R+   A  A+        T G
Sbjct: 415  TPATPATAATAATAATAATAATAATAATAATAPTPARAARAATPATGAT---PATAPTAG 471

Query: 217  RSSSAAPERRAAKCAQQAGPN*LAAPWAALVGA 119
             +++AA    AA  A+ + P   A P  A   A
Sbjct: 472  TAATAATAATAATPARASTPATAATPVTAATPA 504

 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 80/298 (26%), Positives = 110/298 (36%), Gaps = 4/298 (1%)
 Frame = -3

Query: 1015 PRPPSSLATTMLA*TVPPVAVPAPPPPGSTGLSQHPGRCRYSPPAPTPPTPPATPSRCWP 836
            P   ++ AT   A T P  A PA     +T  +        +P  P  P   AT +    
Sbjct: 233  PATAATPATAATAATAPTAATPARAARAATPATAATLATAATPATPATPATAATDATAAT 292

Query: 835  ATSRRMPPTPATRSTAAALPSRCLSWRPAAASRPRCRSVPRCSQTVATRTPPTGCSWAAR 656
            A +     TPAT +TAA   +   +   A A+     + P  ++     TP T  + A  
Sbjct: 293  AATPARAATPATPATAATPATPATAATAATAATAATAATP--ARAARAATPATAATPATA 350

Query: 655  CCAPR*GCRSRWSVDKSPALCSRLAW--RSPSAATAGCATRQAAAGTPRAAAALRWVAGP 482
              A      +  +   +PA  +R A    + +AATA  A   A A TP  AA     A P
Sbjct: 351  ATAATAATAATAATAATPARAARAATPATAATAATAATAATAATAATPARAARAATPATP 410

Query: 481  VADPSPAYCEPSPLRAWRCAPRQRRSATK*MRRNARRRWLKASAPCCQRPPLPTKRVALA 302
                +PA    +P  A   A     +AT      A      A+AP               
Sbjct: 411  ATPATPA----TPATAATAA----TAATAATAATAATAATAATAP--------------T 448

Query: 301  PARAKARRSC*AARAASLL*TRAG--VTDGRSSSAAPERRAAKCAQQAGPN*LAAPWA 134
            PARA AR +  A  A       AG   T   +++AA   RA+  A  A P   A P A
Sbjct: 449  PARA-ARAATPATGATPATAPTAGTAATAATAATAATPARASTPATAATPVTAATPAA 505

 Score = 39.7 bits (91), Expect = 0.087
 Identities = 61/269 (22%), Positives = 100/269 (36%), Gaps = 10/269 (3%)
 Frame = +2

Query: 74  AKP*MSA-SASPRRRARPNQCSPRSRQSVGTSLLSAFRGSALRCCTATSPVGHTSPSSKQ 250
           A+P  +A +A+P   A P   +  +  +  T+   A   +A    TA +P    + ++  
Sbjct: 26  ARPAAAARAATPATAATP--ATAATPATAATAATEATAATAATPATAATPATAATAATTA 83

Query: 251 RSCSRCSA*PSRLRAGRSQSHSLCGQRRSLAAWSRCF*PSATRISAHLLGR*PALSRSAA 430
            + +  +   +  RA R+ + +      + A  +     +AT  +A    R    + +A 
Sbjct: 84  ATAATAATAATPARAARAATPATAATPATAATAAT----AATAATAETPARAATPATAAT 139

Query: 431 PSSQWGRLAICRAGIRYGTRYPSQRCCGSRRAGSGLTSRTPRS-----RSARASPRQPAA 595
           P++     A         T   S     + RA +  T+ TP +     R+ARA+    AA
Sbjct: 140 PATA----ATPATAATAATAATSATAATAARAATPATAATPATPATAARAARAATPATAA 195

Query: 596 QRRTLVDAPATAAASARCTAASSPAAASRRRPGRYGLAATGHRPA----ARSARRRWTP* 763
              T   A   A A+   TAA+   AA    P      AT   PA    A +A    TP 
Sbjct: 196 TAATAATAATAATAATAATAATPARAARAATPATAPTPATAATPATAATAATAPTAATPA 255

Query: 764 QAAARKSSRCRPRRRRRWHPTTRCGPTAA 850
           +AA   +            P T   P  A
Sbjct: 256 RAARAATPATAATLATAATPATPATPATA 284

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 42/199 (21%), Positives = 75/199 (37%)
 Frame = +2

Query: 134 SPRSRQSVGTSLLSAFRGSALRCCTATSPVGHTSPSSKQRSCSRCSA*PSRLRAGRSQSH 313
           +P +  +  T   +A   +  R  T  +P    +P++   + +  +A  +   A  + + 
Sbjct: 277 TPATPATAATDATAATAATPARAATPATPATAATPATPATAATAATAATAATAA--TPAR 334

Query: 314 SLCGQRRSLAAWSRCF*PSATRISAHLLGR*PALSRSAAPSSQWGRLAICRAGIRYGTRY 493
           +      + AA       +AT  +A       A + +AA  ++  R A         T  
Sbjct: 335 AARAATPATAATPATAATAATAATA-------ATAATAATPARAARAATPATAATAATAA 387

Query: 494 PSQRCCGSRRAGSGLTSRTPRSRSARASPRQPAAQRRTLVDAPATAAASARCTAASSPAA 673
            +     +        + TP + +  A+P  PA        A A  AA+A  TAA++  A
Sbjct: 388 TAATAATAATPARAARAATPATPATPATPATPATAATAATAATAATAATA-ATAATAATA 446

Query: 674 ASRRRPGRYGLAATGHRPA 730
            +  R  R    ATG  PA
Sbjct: 447 PTPARAARAATPATGATPA 465

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 54/247 (21%), Positives = 89/247 (35%), Gaps = 7/247 (2%)
 Frame = +2

Query: 95  SASPRRRARP-NQCSPRSRQSVGTSLLSAFRGSALRCCTATSPVGHTSPSSKQRSCSRCS 271
           +A+P   A P    +P +  +  T+  SA   +A R  T  +     +P++  R+    +
Sbjct: 131 AATPATAATPATAATPATAATAATAATSATAATAARAATPATAATPATPATAARAAR--A 188

Query: 272 A*PSRLRAGRSQSHSLCGQRRSLAAWSRCF*PS-ATRISAHLLGR*PALSRSAAPSSQWG 448
           A P+      + + +      + AA +    P+ A R +       PA + + A ++   
Sbjct: 189 ATPATAATAATAATAATAATAATAATAAT--PARAARAATPATAPTPATAATPATAATAA 246

Query: 449 RLAICRAGIRYGTRYPSQRCCGSRRAGSGLTSRTPRSRSARASPRQPAAQRRTLVDA-PA 625
                    R               A +  T  TP + +  A+    A   R    A PA
Sbjct: 247 TAPTAATPARAARAATPATAATLATAATPATPATPATAATDATAATAATPARAATPATPA 306

Query: 626 TAAASAR----CTAASSPAAASRRRPGRYGLAATGHRPAARSARRRWTP*QAAARKSSRC 793
           TAA  A      TAA++  AA+   P R   AAT    A  +          AA  ++  
Sbjct: 307 TAATPATPATAATAATAATAATAATPARAARAATPATAATPATAATAATAATAATAATAA 366

Query: 794 RPRRRRR 814
            P R  R
Sbjct: 367 TPARAAR 373

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 54/239 (22%), Positives = 90/239 (37%), Gaps = 3/239 (1%)
 Frame = +2

Query: 65  ASGAKP*MSASASPRRRARPNQCSPRSRQSVGTSLLSAFRGSALRCCTATSPVGHTSPSS 244
           A+ A P   A+A+   RA     +P +  +  T+  +A   +A    TA +P      ++
Sbjct: 171 ATAATPATPATAARAARA----ATPATAATAATAATAATAATAATAATAATPARAARAAT 226

Query: 245 KQRSCSRCSA*PSRLRAGRSQSHSLCGQRRSLAAWSRCF*PSATRISAHLLGR*PALSRS 424
              + +  +A      A  + + +     R+  A +     +    +       PA + +
Sbjct: 227 PATAPTPATAATPATAATAATAPTAATPARAARAATPATAATLATAATPATPATPATAAT 286

Query: 425 ---AAPSSQWGRLAICRAGIRYGTRYPSQRCCGSRRAGSGLTSRTPRSRSARASPRQPAA 595
              AA ++   R A         T         +  A +  T+ TP +R+ARA+    AA
Sbjct: 287 DATAATAATPARAATPATPATAATPATPATAATAATAATAATAATP-ARAARAATPATAA 345

Query: 596 QRRTLVDAPATAAASARCTAASSPAAASRRRPGRYGLAATGHRPAARSARRRWTP*QAA 772
              T   A   A A+   TAA+   AA    P     AAT     A +A    TP +AA
Sbjct: 346 TPATAATAATAATAATAATAATPARAARAATPATAATAATA--ATAATAATAATPARAA 402

 Score = 34.7 bits (78), Expect = 2.8
 Identities = 49/227 (21%), Positives = 89/227 (38%), Gaps = 3/227 (1%)
 Frame = +2

Query: 62  SASGAKP*MSAS-ASPRRRARPNQCSPRSRQSVGTSLLSAFRGSALRCCTATSPVGHTSP 238
           +A+ A P  +A+ A+P   A P   +P +  +  T+  +A   +  R   A +P    +P
Sbjct: 290 AATAATPARAATPATPATAATP--ATPATAATAATAATAATAATPARAARAATPATAATP 347

Query: 239 SSKQRSCSRCSA*PSRLRAGRSQSHSLCGQRRSLAAWSRCF*PSATRISAHLLGR*PALS 418
           ++   + +  +A  +   A  +++      R +  A +     +AT  +A         +
Sbjct: 348 ATAATAATAATAATAATAATPARA-----ARAATPATAATAATAATAATAATAATPARAA 402

Query: 419 RSAAPSSQW--GRLAICRAGIRYGTRYPSQRCCGSRRAGSGLTSRTPRSRSARASPRQPA 592
           R+A P++       A         T   +     +  A +  T+ TP +R+ARA+     
Sbjct: 403 RAATPATPATPATPATPATAATAATAATAATAATAATAATAATAPTP-ARAARAATPATG 461

Query: 593 AQRRTLVDAPATAAASARCTAASSPAAASRRRPGRYGLAATGHRPAA 733
           A   T   AP    A+   TAA++   A    P       T   PAA
Sbjct: 462 ATPAT---APTAGTAATAATAATAATPARASTPATAATPVTAATPAA 505

 Score = 33.1 bits (74), Expect = 8.1
 Identities = 50/214 (23%), Positives = 85/214 (39%)
 Frame = +2

Query: 89  SASASPRRRARPNQCSPRSRQSVGTSLLSAFRGSALRCCTATSPVGHTSPSSKQRSCSRC 268
           + +A+P R AR    +P +  +  T+   A   +A    TA +P      ++   + +  
Sbjct: 213 ATAATPARAARA--ATPATAPTPATAATPATAATAATAPTAATPARAARAATPATAATLA 270

Query: 269 SA*PSRLRAGRSQSHSLCGQRRSLAAWSRCF*PSATRISAHLLGR*PALSRSAAPSSQWG 448
           +A      A  + + +      + A  +R   P+    +A      PA   +AA ++   
Sbjct: 271 TAATPATPATPATA-ATDATAATAATPARAATPATPATAAT-----PATPATAATAATAA 324

Query: 449 RLAICRAGIRYGTRYPSQRCCGSRRAGSGLTSRTPRSRSARASPRQPAAQRRTLVDAPAT 628
             A      R               A +  T+ T  + +  A+P + AA+  T    PAT
Sbjct: 325 TAATAATPARAARAATPATAATPATAATAATAATAATAATAATPAR-AARAAT----PAT 379

Query: 629 AAASARCTAASSPAAASRRRPGRYGLAATGHRPA 730
           AA +A  TAA++  AA+   P R   AAT   PA
Sbjct: 380 AATAA--TAATAATAATAATPARAARAATPATPA 411

>pir||B89716 protein F45B8.3 [imported] - Caenorhabditis elegans
          Length = 211

 Score = 63.2 bits (152), Expect = 7e-09
 Identities = 49/142 (34%), Positives = 57/142 (39%), Gaps = 11/142 (7%)
 Frame = -3

Query: 1024 CRWPRPPSSLATTMLA*TVPPVAVPAPPPPGS--TGLSQHPGRCRYSPPAPT----PPTP 863
            C  PRP  S         VPP  +P PPPP S   G S  P  C   PPAP     PP P
Sbjct: 71   CGAPRPSPSCCPY-----VPPAPLPPPPPPASPCCGPSPVPAPCCPPPPAPAAPCCPPPP 125

Query: 862  PATPSRCWPATSRRMPPTPATRSTAAALP-----SRCLSWRPAAASRPRCRSVPRCSQTV 698
            P TPS         +P  P  +  AAA+P       C    P   + P C+  PR +  V
Sbjct: 126  PPTPSPLVCCKQAPVPENPCCQIVAAAMPPPPSAPACCVAAP-VPTNPCCQPAPRPAPCV 184

Query: 697  ATRTPPTGCSWAARCCAPR*GC 632
             +   P  C    RC AP   C
Sbjct: 185  CSAPRPVPC----RCGAPPMEC 202

>dbj|BAC58076.2| large tegument protein [Cercopithecine herpesvirus 1]
          Length = 3326

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 63/212 (29%), Positives = 81/212 (37%), Gaps = 6/212 (2%)
 Frame = -3

Query: 1015 PRPPSSLATTMLA*TVPP-----VAVPAPPPPGSTGLSQHPGRCRYSPPAPTPPTPPATP 851
            P PP     T  + T  P      A PAPPP  +TG              PT PT PATP
Sbjct: 2795 PHPPGPETPTPTSPTANPHATTASATPAPPPVAATG--------------PTRPTSPATP 2840

Query: 850  SRCWPATSR-RMPPTPATRSTAAALPSRCLSWRPAAASRPRCRSVPRCSQTVATRTPPTG 674
            +    A  R   PP PA  +  AA  +      PAA + P   + P      A    P  
Sbjct: 2841 TPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA 2900

Query: 673  CSWAARCCAPR*GCRSRWSVDKSPALCSRLAWRSPSAATAGCATRQAAAGTPRAAAALRW 494
             +  A   AP     +  +   +PA  +  A  +P+A  A  A   AA   P A AA   
Sbjct: 2901 PAAPAAPAAP--AAPAAPAAPAAPAAPAAPAAPAPAAVPAAPAA-PAAPAAPAAPAAPAA 2957

Query: 493  VAGPVADPSPAYCEPSPLRAWRCAPRQRRSAT 398
             A P A  +PA   P+ +     AP    +AT
Sbjct: 2958 PAAPAAPAAPAAPAPAAVPVVVPAPTATLTAT 2989

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 53/159 (33%), Positives = 59/159 (36%), Gaps = 8/159 (5%)
 Frame = -3

Query: 964 PVAVPAPPPPGST----GLSQHPGRCRYSPPAP-TPPTPPATPSRCWPATSRRMPPTPAT 800
           P A P PP P S     G    PG    +PP P  PPTP A P+   P T+   PPTPA 
Sbjct: 404 PAAGPRPPTPASRPPTPGAPPTPG----APPTPGAPPTPGAPPTPAGPTTASSEPPTPAG 459

Query: 799 R-STAAALPSRCLSWRPAAASRPRCRSVPRCSQTVATRTPPTGCSWAARCCAPR*GCRSR 623
           R  T A  P       P  A RP     P          PPT    A R   P      R
Sbjct: 460 RPPTPAGRPPTPAGRPPTPAGRP---PTPAGRPPTPAGRPPTP---AGRPPTP----AGR 509

Query: 622 WSVDKSPALCSRLAWRSPSAATAGCATRQ--AAAGTPRA 512
                +P   S     +P  A A  +  Q  AAA T  A
Sbjct: 510 PPTPANPTASSEPPTPNPEGAPAPSSNEQPPAAASTDEA 548

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 91/351 (25%), Positives = 115/351 (31%), Gaps = 21/351 (5%)
 Frame = -3

Query: 1009 PPSSLATTMLA*TVPPVAVPAPPPPGSTGLSQHPGRCRYSPPAPTPPTPPATPSRCWPAT 830
            P  ++A    A   P  A PA P   +   +        +P AP  P  PA P+      
Sbjct: 2840 PTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPA 2899

Query: 829  SRRMPPTPATRSTAAALPSRCLSWRPAAASRPRCRSVPRCSQTVATRTPPTGCSWAARCC 650
            +   P  PA  +  AA  +      PAA + P   +VP      A    P   +  A   
Sbjct: 2900 APAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPAAPAAPAAPAAPAAPAAPAAPA 2959

Query: 649  APR*GCRSRWSVDKSPALCSRLAWRSPSAATAGCATRQAAAGTPRAAAALRWVAGPVADP 470
            AP        +   +PA  +  A   P    A  AT  A   T  A AA    A PV  P
Sbjct: 2960 AP--------AAPAAPAAPAPAA--VPVVVPAPTATLTATTTTSPAPAAT--PASPVPTP 3007

Query: 469  S----------PAYCEPSPLRAWRCAPRQRRSATK*MRRNARRRWLKASAPCCQRPPL-- 326
            +          PA+ +PS       AP          RR A  R   A      RPP   
Sbjct: 3008 TSSLPTPPSKPPAFFQPSLATGGSVAPGGD------FRRRAPSRPTAAVPAAPSRPPARR 3061

Query: 325  --------PTKRVALAPARAKARRSC*AARAASLL*TRAGVTDGRSSSAAPE-RRAAKCA 173
                     T+  AL P    AR     A A       A V +  +    P+ R  +  A
Sbjct: 3062 LARPAVSRSTESFALPPDEL-ARPRTPEAPAPPTETEEAPVAERPAPPEPPQGRPPSPAA 3120

Query: 172  QQAGPN*LAAPWAALVGARPSTRARRRGHLWLCPRRGVRCRVSLQPAGPPR 20
              AGP       AA  G      A R G   L P R    R  + P  PPR
Sbjct: 3121 PDAGP-------AAASGPSGGVPAPRLGA--LVPGRVAVPRRQIPPPAPPR 3162

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 95/354 (26%), Positives = 115/354 (31%), Gaps = 40/354 (11%)
 Frame = -3

Query: 1042 PLAKLRCRWPRPPSSLATTMLA*TVP-PVAVPAPPPPGSTGLSQHPGRCRYSPPAPTPPT 866
            P  + R R P  P   A        P P A P+  PP     + HP       P P PP 
Sbjct: 2659 PAVQSRARRPDAPPQSARPRTPRDDPGPPAAPSTLPPSPPPPAPHP-------PDPPPPD 2711

Query: 865  PPATPSRCW-----PATSRRMPPTPAT-------RSTAAALPSR-------CLSWRPAAA 743
            P   P+         A S   PP P T       R   A  P R           RPA +
Sbjct: 2712 PSPRPNELGGGETAAAPSAPDPPPPQTVRAPERPRDDRAPAPGRVSLPRRASRQGRPAPS 2771

Query: 742  S---RPRCRSV--------------PRCSQTVATRTPPTG---CSWAARCCAPR*GCRSR 623
            S   RPR R+               P   +T  T T PT     + A+   AP     + 
Sbjct: 2772 SPLQRPRRRAARPAVGSLTNLADPHPPGPET-PTPTSPTANPHATTASATPAPPPVAATG 2830

Query: 622  WSVDKSPALCSRLAWRSPSAATAGCATRQAAAGTPRAAAALRWVAGPVADPSPAYCEPSP 443
             +   SPA        +P+ A AG A+   A   P A AA    A P A  +PA      
Sbjct: 2831 PTRPTSPAT------PTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPA 2884

Query: 442  LRAWRCAPRQRRSATK*MRRNARRRWLKASAPCCQRPPLPTKRVALAPARAKARRSC*AA 263
              A   AP                    A+      P  P    A A   A A  +  AA
Sbjct: 2885 APAAPAAP--------------------AAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA 2924

Query: 262  RAASLL*TRAGVTDGRSSSAAPERRAAKCAQQAGPN*LAAPWAALVGARPSTRA 101
             AA      A V    ++ AAP   AA  A  A     AAP A    A P+  A
Sbjct: 2925 PAAPAAPAPAAVPAAPAAPAAPAAPAAPAAPAAP----AAPAAPAAPAAPAPAA 2974

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 39/120 (32%), Positives = 46/120 (37%), Gaps = 7/120 (5%)
 Frame = -3

Query: 1015 PRPPSSLATTMLA*TVPPVAVP----APPPPGSTGLSQHPGRCRYSPPAPTPPTPPATPS 848
            PRPP+  +        P    P    APP PG+      P      PP  TP   P TP+
Sbjct: 408  PRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPP--TPAGRPPTPA 465

Query: 847  RCWPATSRRMPPTPATR-STAAALPSRCLSWRPAAASRPRCRS--VPRCSQTVATRTPPT 677
               P T    PPTPA R  T A  P       P  A RP   +   P  +   A+  PPT
Sbjct: 466  G-RPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPANPTASSEPPT 524

 Score = 42.0 bits (97), Expect = 0.018
 Identities = 80/315 (25%), Positives = 100/315 (31%), Gaps = 10/315 (3%)
 Frame = -3

Query: 1015 PRPPSSLATTMLA*TVPPVAVPAPPPPGSTGLSQHP------GRCRYSPPAPTPPTPPAT 854
            P PP++          PP   P P  P     ++ P       R R     P PP  P+T
Sbjct: 2633 PLPPAARPAAPDRSVPPPRPAPRPSEPAVQSRARRPDAPPQSARPRTPRDDPGPPAAPST 2692

Query: 853  --PSRCWPATSRRMPPTPATRSTAAALPSRCLSWRPAAASRPRCRSVPRCSQTVATRTPP 680
              PS   PA     PP P        L     +  P+A   P  ++V    +    R P 
Sbjct: 2693 LPPSPPPPAPHPPDPPPPDPSPRPNELGGGETAAAPSAPDPPPPQTVRAPERPRDDRAPA 2752

Query: 679  TGCSWAARCCAPR*GCRSRWSVDKSPALCSRLAWRSPSAATAGCATRQAAAGTPRAAAAL 500
             G     R   PR   R       SP    R   R  +    G  T  A    P      
Sbjct: 2753 PG-----RVSLPRRASRQGRPAPSSPLQRPR---RRAARPAVGSLTNLADPHPPGPETPT 2804

Query: 499  RWVAGPVADP--SPAYCEPSPLRAWRCAPRQRRSATK*MRRNARRRWLKASAPCCQRPPL 326
                 P A+P  + A   P+P       P +  S        A      A+A     PP 
Sbjct: 2805 --PTSPTANPHATTASATPAPPPVAATGPTRPTSP-------ATPTPTVAAAGRASAPPA 2855

Query: 325  PTKRVALAPARAKARRSC*AARAASLL*TRAGVTDGRSSSAAPERRAAKCAQQAGPN*LA 146
            P    A A   A A  +  AA AA             ++ AAP   AA  A  A P   A
Sbjct: 2856 PAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA-PAAPAAPA 2914

Query: 145  APWAALVGARPSTRA 101
            AP A    A P+  A
Sbjct: 2915 APAAPAAPAAPAAPA 2929

 Score = 37.4 bits (85), Expect = 0.43
 Identities = 56/217 (25%), Positives = 79/217 (35%), Gaps = 24/217 (11%)
 Frame = -3

Query: 1015 PRPPSSLATTMLA*TVPPVAVPAPPPPGSTGLSQHPGRCRYSPPAPTPPTPPATPSRCWP 836
            P  P++ A           A PA P P +  +         +    T P P ATP+   P
Sbjct: 2946 PAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPVVVPAPTATLTATTTTSPAPAATPASPVP 3005

Query: 835  ATSRRMP-----------PTPATRSTAA-------ALPSRCLSWRPAAASRPRCRSVPRC 710
              +  +P           P+ AT  + A         PSR  +  PAA SRP  R + R 
Sbjct: 3006 TPTSSLPTPPSKPPAFFQPSLATGGSVAPGGDFRRRAPSRPTAAVPAAPSRPPARRLARP 3065

Query: 709  SQTVATRT---PPTGCSWAARCCAPR*GCRSRWS-VDKSPALCSRLAWR--SPSAATAGC 548
            + + +T +   PP   +      AP     +  + V + PA       R  SP+A  AG 
Sbjct: 3066 AVSRSTESFALPPDELARPRTPEAPAPPTETEEAPVAERPAPPEPPQGRPPSPAAPDAGP 3125

Query: 547  ATRQAAAGTPRAAAALRWVAGPVADPSPAYCEPSPLR 437
            A     +G   A      V G VA P      P+P R
Sbjct: 3126 AAASGPSGGVPAPRLGALVPGRVAVPRRQIPPPAPPR 3162

>ref|NP_780438.1| RIKEN cDNA 5033413A03 [Mus musculus] gi|26354955|dbj|BAC41104.1|
            unnamed protein product [Mus musculus]
          Length = 2607

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 101/347 (29%), Positives = 139/347 (39%), Gaps = 12/347 (3%)
 Frame = +2

Query: 2    SPESLV------SRRSSGLQRNSTTNSASGAKP*MSASASPRRRARPNQCSPRSRQSVGT 163
            SPESL       SRR       S   S   AK   S S +P  RA  ++ SP +++    
Sbjct: 339  SPESLKPTPAPGSRREISSSPTSKNRSHGRAKRDKSHSHTPSHRAGRSR-SPATKRGRSR 397

Query: 164  SLLSAFRGSALRCCTATSPVGHTSPSSKQRSCSRCSA*PSRLRAGRSQSHSLCGQRRSLA 343
            S     RG +     + SP    S S+++   SR     S  R GRS+S    G  RS  
Sbjct: 398  SRTPTKRGHS----RSRSPQWRRSRSAQRWGKSR-----SPQRRGRSRSPQRPGWSRSRN 448

Query: 344  AWSRCF*PSATRISAHLLGR*PAL---SRSAAPSSQWGRLAICRAGIRYGTRYPSQRCCG 514
               R    SA R  +H   R PA    SRS  P+ +    +   A  R  +R P++R   
Sbjct: 449  TQRRGRSRSARRGRSH--SRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPARRRSR 506

Query: 515  SR---RAGSGLTSRTPRSRSARASPRQPAAQRRTLVDAPATAAASARCTAASSPAAASRR 685
            SR   R G    SRTP  R +R   R P  +R         +  S   T A     +  R
Sbjct: 507  SRTPARRGRS-RSRTPTRRRSRT--RSPVRRRSRSRSQARRSGRSRSRTPARRSGRSRSR 563

Query: 686  RPGRYGLAATGHRPAARSARRRWTP*QAAARKSSRCRPRRRRRWHPTTRCGPTAARGRWW 865
             P R G + +   PA RSAR R        R  SR   RRR R     R G + +R    
Sbjct: 564  TPARRGRSRS-RTPARRSARSRSRTPARRGRSRSRTPARRRSRSRSLVRRGRSHSR---- 618

Query: 866  GWWSRRRWGVATAARVLGQASRPRRRRCRNSNRRDGSSQHRRRQR*R 1006
               + +R G + ++      SR  +RR R+++  +    H   +R R
Sbjct: 619  ---TPQRRGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSHVSSRRSR 662

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 97/341 (28%), Positives = 131/341 (37%), Gaps = 37/341 (10%)
 Frame = +2

Query: 89   SASASPRRRARPNQCSPRSRQSVGT---------SLLSAFRGSALRCCTATSPVGH---- 229
            S+ ASP R   P +   +  QS  +         + +S    S+      T   G     
Sbjct: 296  SSEASPTRGCSPPKSPEKPPQSTSSESCPPSPQPTKVSRHASSSPESLKPTPAPGSRREI 355

Query: 230  -TSPSSKQRSCSRCSA*PSRL-----RAGRSQSHSLC-GQRRSLAAWSRCF*PSATRISA 388
             +SP+SK RS  R     S       RAGRS+S +   G+ RS     R           
Sbjct: 356  SSSPTSKNRSHGRAKRDKSHSHTPSHRAGRSRSPATKRGRSRSRTPTKR----------G 405

Query: 389  HLLGR*PALSRSAAPSSQWGRLAICRAGIRYGTRYPSQRCCGSRRAGSGLTSRTPRSRSA 568
            H   R P   RS + + +WG+    R+  R G     QR   SR   +    R+  +R  
Sbjct: 406  HSRSRSPQWRRSRS-AQRWGK---SRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRG 461

Query: 569  RASPRQPAAQRRTLVDAPATAAASARCTAA---SSPAAASRRR-----PGRYGLAA---- 712
            R+  R PA + R+    PA    S   T A   S     +RRR     P R G +     
Sbjct: 462  RSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPARRRSRSRTPARRGRSRSRTP 521

Query: 713  TGHRPAARSARRRWTP*QAAARKSSRCRPRRRRRWHPTTRCGPTAARGRWWGWWSRRRWG 892
            T  R   RS  RR +  ++ AR+S R R R   R    +R    A RGR       RR  
Sbjct: 522  TRRRSRTRSPVRRRSRSRSQARRSGRSRSRTPARRSGRSRSRTPARRGRSRSRTPARRSA 581

Query: 893  VAT----AARVLGQASRPRRRRCRN-SNRRDGSSQHRRRQR 1000
             +     A R   ++  P RRR R+ S  R G S  R  QR
Sbjct: 582  RSRSRTPARRGRSRSRTPARRRSRSRSLVRRGRSHSRTPQR 622

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 95/356 (26%), Positives = 125/356 (34%), Gaps = 23/356 (6%)
 Frame = +2

Query: 2    SPESLVSRRSSGLQRN-----STTNSASGAKP*-------MSASASPRRRARPNQCSPRS 145
            SPE     RSS  +R+     + T S  G  P         S S S R + R  +   RS
Sbjct: 1592 SPEPTEKSRSSRRRRSVSSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRS 1651

Query: 146  RQSVGTSLLSAFRGSALRCCTAT-SPVGHTSPSSKQRSCSRCSA*PSRLRAGRSQ----S 310
              S  TS       S  R         G+ S S  ++  SR S   SR R GRS+    S
Sbjct: 1652 GSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPTRQESSRTS---SRRRRGRSRTPLTS 1708

Query: 311  HSLCGQRRSLAAWSRCF*PSATRISAHLLGR*PALSRSAAPSSQWGRLAICRAGIRYGTR 490
                  R S A W R    S +R S     R    SRS  P        I R   R    
Sbjct: 1709 RKRSRSRTSPAPWKR----SRSRASPATHRR----SRSITP-------LISRRRSR---- 1749

Query: 491  YPSQRCCGSRRAGSGLTSRTPRSRSARASPRQ------PAAQRRTLVDAPATAAASARCT 652
              S+    SRR    +  R  RSR++  S R+      P  +RR+    P    + +R  
Sbjct: 1750 --SRTSPVSRRRSRSVNRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTRRRSRSRTP 1807

Query: 653  AASSPAAASRRRPGRYGLAATGHRPAARSARRRWTP*QAAARKSSRCRPRRRRRWHPTTR 832
              +   + SR  P     + +   P  R   R  T      R  SR  P  RRR    +R
Sbjct: 1808 PVTRRRSRSRTPPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRR--SRSR 1865

Query: 833  CGPTAARGRWWGWWSRRRWGVATAARVLGQASRPRRRRCRNSNRRDGSSQHRRRQR 1000
              P   R        R R     A R   ++  P   R R+ +R   + + R R R
Sbjct: 1866 TSPVTRR--------RSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSR 1913

 Score = 38.5 bits (88), Expect = 0.19
 Identities = 74/310 (23%), Positives = 107/310 (33%), Gaps = 17/310 (5%)
 Frame = -3

Query: 967  PPVAVPAPPPPGSTGLSQHPGRCRYSPPAPTPPTPPATPSRCWPATSRRMPPTPATRSTA 788
            P  A+P+   P +      P R    P +P  P    +   C P+      P P   S  
Sbjct: 282  PLAAIPSSQEPVNPSSEASPTRGCSPPKSPEKPPQSTSSESCPPS------PQPTKVSRH 335

Query: 787  AALPSRCLSWRPAAASRPRCRSVP--------RCSQTVATRTPPTGCSWAARCCAPR*G- 635
            A+     L   PA  SR    S P        R  +  +    P+  +  +R  A + G 
Sbjct: 336  ASSSPESLKPTPAPGSRREISSSPTSKNRSHGRAKRDKSHSHTPSHRAGRSRSPATKRGR 395

Query: 634  CRSRWSVDKSPALCSRLAWRSPSAATAGCATRQAAAGTPRAAAALRWVAGPVADPSPAYC 455
             RSR    +  +      WR                   R+ +A RW  G    P     
Sbjct: 396  SRSRTPTKRGHSRSRSPQWR-------------------RSRSAQRW--GKSRSPQRRGR 434

Query: 454  EPSPLR-AWRCAPRQRRSATK*MRRNARRRWLKASAPCCQ---RPPLPTKR---VALAPA 296
              SP R  W    R R +  +   R+ARR    + +P  +   R   P +R    +  PA
Sbjct: 435  SRSPQRPGW---SRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPA 491

Query: 295  RAKARRSC*AARAASLL*TRAGVTDGRSSSAAPERRAAKCAQQAGPN*LAAPWAALVG-A 119
            R ++R    A R +    +R     GRS S  P RR ++          +   A   G +
Sbjct: 492  RRRSRSRTPARRRSR---SRTPARRGRSRSRTPTRRRSRTRSPVRRRSRSRSQARRSGRS 548

Query: 118  RPSTRARRRG 89
            R  T ARR G
Sbjct: 549  RSRTPARRSG 558

 Score = 38.1 bits (87), Expect = 0.25
 Identities = 95/366 (25%), Positives = 130/366 (34%), Gaps = 31/366 (8%)
 Frame = +2

Query: 2    SPESLVSRRSSGLQRNST-----TNSASGAKP*MSAS-ASPRRRARPNQCSPRSRQSVGT 163
            SP+S    R+   QR+ +      +S S   P +S S +SP  + +P       R   GT
Sbjct: 1422 SPDSKPKTRTPLRQRSHSGSSPEVDSKSRHSPRLSRSGSSPEMKDKPRVLQ---RAQSGT 1478

Query: 164  SLLSAFRGSALRCCTATSPVGHTS----PSSKQRSCSRCSA*PSRLRAGRSQSHSLCGQR 331
                  +  A R     S  G +S    PS +  S S  S  P      R+      G R
Sbjct: 1479 DSSPEHKIPAPRALPRHSRSGSSSKERGPSPEGSSSSESS--PEHAPKSRTARR---GSR 1533

Query: 332  RSLAAWSRCF*PSATRISAHLLGR*PALSRSAAPSSQWGRLAICRAGIRYGT-----RYP 496
             S+   ++   P   R S       P L+R A  S +  R A     IR  T     R P
Sbjct: 1534 SSIEPKTKSRTPPRRRSSRSS----PELTRKARVSRR-SRSASSSPEIRSRTPPRRRRSP 1588

Query: 497  S---------QRCCGSRRAGSGLTSRTPRSRSARASPRQPAAQRRTLVDAPATAAASARC 649
            S          R    RR+ S   ++T   R    SP+    QR            + R 
Sbjct: 1589 SVSSPEPTEKSRSSRRRRSVSSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRR 1648

Query: 650  TAASSPAAASRRRPGRYGLAATGHRPAARSARRRWTP*QAAARKSSRCRPRRRRRWHPTT 829
              + S  + SRRR      +    R    S     +P     ++SSR   RRRR    T 
Sbjct: 1649 DRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSP---TRQESSRTSSRRRRGRSRTP 1705

Query: 830  RCGPTAARGRWW-GWWSRRRWGVATAARVLGQASRP----RRRRCRNS--NRRDGSSQHR 988
                  +R R     W R R   + A     ++  P    RR R R S  +RR   S +R
Sbjct: 1706 LTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSITPLISRRRSRSRTSPVSRRRSRSVNR 1765

Query: 989  RRQR*R 1006
            RR R R
Sbjct: 1766 RRSRSR 1771

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 68/270 (25%), Positives = 109/270 (40%), Gaps = 15/270 (5%)
 Frame = -3

Query: 919  SQHPGRCRYSPPAPTPPTPPATPSRCWPATSRRMPPTPATRSTAAALPSRCLSWRPAAAS 740
            S   GR     PA    +   TP+R   + SR    TPA R + +  P+R  S     A 
Sbjct: 457  SARRGRSHSRSPATRGRSRSRTPARRGRSRSR----TPARRRSRSRTPARRRSRSRTPAR 512

Query: 739  RPRCRSVPRCSQTVATRTPPTGCSWAARCCAPR*G--------CRSRWSVDKSPALCSRL 584
            R R RS     +   TR+P    S  +R  A R G         RS  S  ++PA   R 
Sbjct: 513  RGRSRSRTPTRRRSRTRSPVRRRS-RSRSQARRSGRSRSRTPARRSGRSRSRTPARRGRS 571

Query: 583  AWRSPSAATAGCATRQAA---AGTPRAAAALRWVAGPVADPSPAYCEPSPLRAWRCAPRQ 413
              R+P+  +A   +R  A       R  A  R  +  +     ++   +P R  R     
Sbjct: 572  RSRTPARRSARSRSRTPARRGRSRSRTPARRRSRSRSLVRRGRSHSR-TPQRRGRSGSSS 630

Query: 412  RRSATK*MRRNARRRWLKASAPCCQRPPLPTKRV-ALAPARAKA---RRSC*AARAASLL 245
             R   K   R ++RR    S+P  ++  + ++R  +L+  R+KA   RRS   +      
Sbjct: 631  ER---KNKSRTSQRRSRSNSSPEMKKSHVSSRRSRSLSSPRSKAKSLRRSLSGSSPCPKQ 687

Query: 244  *TRAGVTDGRSSSAAPERRAAKCAQQAGPN 155
             ++      RS S+ P++++    +Q+  N
Sbjct: 688  KSQTPTRRSRSGSSPPKQKSKTPPRQSRSN 717

 Score = 33.9 bits (76), Expect = 4.8
 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 4/69 (5%)
 Frame = -3

Query: 868  TPPATPSRCWPATSRRMPPTPATRSTAAALPSRCLSWRPAAASRPRCRSVPRC----SQT 701
            TPP+ PS+    + R   P+PA+R   A+  S      P A  RPR   VP      S++
Sbjct: 2266 TPPSAPSQSRMTSERERAPSPASRMVQASSQSLL----PPAQDRPR-SPVPSAFSDQSRS 2320

Query: 700  VATRTPPTG 674
            VA  TP  G
Sbjct: 2321 VAQTTPVAG 2329



EST assemble image


clone accession position
1 HCL034d04_r AV641480 1 539
2 MXL088a11_r BP098143 96 468
3 MXL015d01_r BP093901 151 405
4 CL19g09_r AV394200 326 839
5 LCL031d05_r AV627742 409 665
6 LCL029b07_r AV627593 475 992
7 MXL063h07_r BP096732 481 846
8 CL21g09_r AV394385 495 971
9 CL01b01_r AV393333 771 1044




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research