KCC000005A_c28
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000005A_C28 KCC000005A_c28
GGACATGAACATGCTCGGCGGACTGTGCGAGACTGCTTGCGAGTGGTCTTTGTATGTTGT
CATTGTGACATGTCCACGGTGATTCTGGATCGCCGGGGACGTAAGCTGGGGGGACCGCGT
GCCCGCGGTTTCGTGTGCCCCGCAGCCGGTTGCCGGAGACAAGCGTCACATTCAGGCGTG
CCCTTGAGACGAGCTGCACGTAGAAGCTACTCACCTGGATGCTGATGAGCTGTGTGGGGC
TTTCGGGCGCGTTTGAGCCCCTTTCGCTATGGACTTGTGGACAGGCGGTCACACATGGTG
ACAGCCTCGGGACTGCAAGTTTTCGTCCTCTCTGCTGTGGGGGGAAGTGGTGTGACCGGT
GGCGGCGCCGTGCAAAGCCGGCAGAATGACACGACAGCTGTCGCGCCATTATGCCGGCAT
GGCATTTCGCCGGCAGCAGGGGCTAACCGTGCCATGGTTGTGGGGGTTAGTTCGTGCCAT
GCAGCGGGATGAGGCTGTCGCCCGGCTATAAGGGCGCAGCGCCGGCCTGTACCGGCGCTG
CTTTCTCGTTACTCCCAACTGTGCATAGGTTTACTCTTATGTGCACCAACAACGGATCGA
CGTCTGTAACGAACTCTGGTGGACAGCGCACTGGGTTCCGGAAGTCATCTGTTGGGGCGT
CTTCGGGTTGCAGCCAAGTCTAGGCGCGCAGGCGCATAGCAACGTCACTCTAGCCTAGCA
ACCACGCATCACCGTCAGCTGAGCTGCCAAACGGACTAGTTAGGCGAGGAGACAGCCGCC
GGCTTCGCAAGTCTCGGATACCGGTTCTCGAGCGCGCTGCTTGGGCAGCCTGCGGAGGCG
CCGGTCGGCCTATCCTGCAGCCACCAAGTAACGAGAAAGCAGCCGGCAACTACAGCTGTG
GTGACGGCGACGTGGGAGCTCGCGGCGAGCCGACAACATCACCGACGCTCGGGGACGCCT
CCATTAGTCCTGCTTAGCGGCATTATGGAAACTTTGCCATGTATTGACACTCTTGGCTGC
AGAAGAGTTGTCTTTCCGTGTTTGGTAGCACTGGCCACTGTGGGCAACGGACCTAGAGAG
TTCTCTAAACAGTAGAAGAATTCCAACAGTGAGGATCCTGGCCATTCATGGAGAGCGGCT
TTATGGAGTTATTGAGCCGCGTCGAGGGTGGTGAATGGACATGAACATGCTCGGCGGACT
GTGCGAGACTGCTTGCGAGTGGTCTTTGTATGTTGTCATTGTGACATGTCCACGGTGATT
CTGGATGCGCGTCTGACATCGCCGGGGACGTAAGCTGGGGGGACCGCGTGCCCGCGGTTT
TGTGTGCCCCGCAGCCGGTGGCCGGAGACAAGCGTCACATTCAGGCGTGCCCTTGAGACG
AGCTGCACATAGAAGCTACTCACCTGGATGCTGATGAGCTGTGTGGGGCTTTCGGGCGCG
TTTGAGCCCCTTTCGCTATGGACTTGTGGACAGGCGGTCACACATGGTGACAGCCTCGGG
ACTGCAAGTATTCGTCCTCTCTGCTGTGGGGGGAAGTGGTGTGACCGGTGGCGGCGCCGT
GCAAAGCCGGCAGAATGACACGACAGCTGTCGCGCCATTCTGCCGGCATGGCATTTCGCC
GGCAGCAGGGGCTAACCGTGCCATGGTTGTGGGGGTTAGTTCGTGCCGTGCAGCGAGATG
AGGCTGTCGCCCGGCTATAAGGGCGCAGCGCCGGCCTGTACCGGCGCTGCTTTCTCGTTA
CTCCCAACTGTGCATAGGTTTACTCTTATGTGCACCAACAACGGATCGACGTCTGTAACG
AACTCTGGTGGACAGCGCACTGGGTTCCGGAAGTCATCTGTTGGGGCGTCTTCGGGTTGC
AGCCAAGTCTAGGCGCGCAGGCGCATAGCAACGTCACTCTAGCCCAAGCAACCACGTATC
ACCGTCAGCTGAGCTGCCAAACGGACGAGTTAGGCGAGGAGACAGCCGCCGGCTTCGCAA
GTCTCGGATACCGGTTCTCGAGCACGCTGCTCGGGCAGCCTGCGGAGGCGCCGGTCGGCC
TATCCTGCAGCCACCAAGTAACGAGAAAGCAGCCGGCAACTACAGCTGTGGTGACGGCGA
CGTGGGAGCTCGCGGCGAGCCGACAACATCACCGACGCTCGGGGACGCCTCCATTAGTCC
TGCTTAGCTGCATTATGGAAACTTTGCCATGTATTGACACTCTTGGCTGCAGAAGAGTTG
TCTTTCCGTGTTTGGTAGCACTGGCCACTGTGGGCAACGGGCCTAGAGAGTTCTCTAAAC
AGTAGAAGAATTCCAACAGTGAGGATCCTGGCCATTCATGGAGAGCGGCTTTATGGAGTT
ATnGAGCCGCGTTGAGGGTGGTGAATGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000005A_C28 KCC000005A_c28
         (2368 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_149539.2| similar to hypothetical protein XP_149539 [Mus ...    39  0.32
ref|ZP_00089937.1| COG0513: Superfamily II DNA and RNA helicases...    39  0.55
pir||T43481 probable mucin DKFZp434C196.1 - human (fragment) gi|...    39  0.55
dbj|BAC33003.1| unnamed protein product [Mus musculus]                 38  0.72
gb|AAF64523.1| cervical mucin MUC5B [Homo sapiens]                     37  1.2

>ref|XP_149539.2| similar to hypothetical protein XP_149539 [Mus musculus]
            gi|26339602|dbj|BAC33472.1| unnamed protein product [Mus
            musculus]
          Length = 230

 Score = 39.3 bits (90), Expect = 0.32
 Identities = 49/171 (28%), Positives = 65/171 (37%), Gaps = 1/171 (0%)
 Frame = -2

Query: 2058 LGGCRIGRPAPPQAARAACSRTGIRDLRSRRLSPRLTRPFGSSADGDTWLLGLE*RCYAP 1879
            LGG    RP P Q+ RAA    G     S R +PR             + L L  R +  
Sbjct: 62   LGGWLAARPRPAQSQRAAAVAPG-----SCRGAPRARLRAKLLVAWHLYALPLRSRAFGC 116

Query: 1878 ARLDLAATRRRPNR*LPEPSALSTRVRYRRRSVVGAHKSKPMHSWE*RESSAGTGRRCAL 1699
                L AT R   R LP   A +   R  RR    A + + +H    R + +  G R   
Sbjct: 117  LLPRLPATGRARQRALPLVPAAAAAARRGRRRPARAGRVRGVH----RRTGSYAGDRGGH 172

Query: 1698 IAGRQPHLA-ARHELTPTTMARLAPAAGEMPCRQNGATAVVSFCRLCTAPP 1549
              GR+ HL  A   L    +    P A ++P  Q+   A+    R  T PP
Sbjct: 173  DGGRRLHLCHAGGHLPAGGLHHREPHAPDLPATQSAQAALK---RKATRPP 220

>ref|ZP_00089937.1| COG0513: Superfamily II DNA and RNA helicases [Azotobacter
           vinelandii]
          Length = 630

 Score = 38.5 bits (88), Expect = 0.55
 Identities = 42/123 (34%), Positives = 55/123 (44%), Gaps = 11/123 (8%)
 Frame = -2

Query: 549 TRKQRRYRPALR--------PYSRATASSRCMARTNPHNHGTVSPCCRRNAMPA*WRDSC 394
           +R++ R RPA R        P SRA  S R   R NP      SPCCRR A+P   R+S 
Sbjct: 490 SREKTRRRPAARNATRRPRAPVSRAARSRR--PRRNPPASRR-SPCCRRIAIP---RNSS 543

Query: 393 RVILPALHGAATGHTTSPHSREDENLQSRGCHHV*PPVHKSIAKG---AQTRPKAPHSSS 223
             I      A T    +  SR    +++R      P V ++  KG   A+ R  A  S+ 
Sbjct: 544 TTISTTSATAPTTSAPTRTSRSAAAVRARTARR--PAVVRARGKGRGKAKVRASAARSAR 601

Query: 222 ASR 214
           ASR
Sbjct: 602 ASR 604

 Score = 38.5 bits (88), Expect = 0.55
 Identities = 42/123 (34%), Positives = 55/123 (44%), Gaps = 11/123 (8%)
 Frame = -1

Query: 1738 TRKQRRYRPALR--------PYSRATASSRCTARTNPHNHGTVSPCCRRNAMPAEWRDSC 1583
            +R++ R RPA R        P SRA  S R   R NP      SPCCRR A+P   R+S 
Sbjct: 490  SREKTRRRPAARNATRRPRAPVSRAARSRR--PRRNPPASRR-SPCCRRIAIP---RNSS 543

Query: 1582 RVILPALHGAATGHTTSPHSREDEYLQSRGCHHV*PPVHKSIAKG---AQTRPKAPHSSS 1412
              I      A T    +  SR    +++R      P V ++  KG   A+ R  A  S+ 
Sbjct: 544  TTISTTSATAPTTSAPTRTSRSAAAVRARTARR--PAVVRARGKGRGKAKVRASAARSAR 601

Query: 1411 ASR 1403
            ASR
Sbjct: 602  ASR 604

>pir||T43481 probable mucin DKFZp434C196.1 - human (fragment)
            gi|6599134|emb|CAB63715.1| hypothetical protein [Homo
            sapiens]
          Length = 580

 Score = 38.5 bits (88), Expect = 0.55
 Identities = 85/339 (25%), Positives = 117/339 (34%), Gaps = 5/339 (1%)
 Frame = -2

Query: 2148 ASPSVGDVVGSPRAPTSPSPQL*LPAAFSLLGGCRIGRP--APPQAARAACSRTGIRDLR 1975
            ASP+      SPR P+  SP   LP A S +G      P   PP+A     S TG     
Sbjct: 85   ASPTRKPPRASPRTPSRASPTRRLPRA-SPMGSPHRASPMRTPPRA-----SPTGTPSTA 138

Query: 1974 SRRLSPRLTRPFGSSADGDTWLLGLE*RCYA---PARLDLAATRRRPNR*LPEPSALSTR 1804
            S   +P    P G+         G   R +A   P+   L  T  R +     P A  TR
Sbjct: 139  SPTGTPSSASPTGTPPRASP--TGTPPRAWATRSPSTASLTRTPSRASLTRWPPRASPTR 196

Query: 1803 VRYRRRSVVGAHKSKPMHSWE*RESSAGTGRRCALIAGRQPHLAARHELTPTTMARLAPA 1624
                R S   +H++ P  +      +    R        +  L   H  +PT   R+ P 
Sbjct: 197  TP-PRESPRMSHRASPTRTPPRASPTRRPPRASPTRTPPRESLRTSHRASPT---RMPPR 252

Query: 1623 AGEMPCRQNGATAVVSFCRLCTAPPPVTPLPPTAERTNTCSPEAVTMCDRLSTSP*RKGL 1444
            A   P R+    +         +PP  +P+ P      T  P A       +T+P R  L
Sbjct: 253  AS--PTRRPPRASPTG------SPPRASPMTPPRASPRT-PPRASP-----TTTPSRASL 298

Query: 1443 KRARKPHTAHQHPGE*LLCAARLKGTPECDACLRPPAAGHTKPRARGPPSLRPRRCQTRI 1264
             R     +    P      A+ +K          PP A  T   +R  P+  P R     
Sbjct: 299  TRTPSWASPTTTPSR----ASLMKMESTVSITRTPPRASPTGTPSRASPTGTPSRASLTG 354

Query: 1263 QNHRGHVTMTTYKDHSQAVSHSPPSMFMSIHHPRRGSIT 1147
               R  +T T     S+A     PS    I  P R S+T
Sbjct: 355  SPSRASLTGTP----SRASLIGTPSRASLIGTPSRASLT 389

>dbj|BAC33003.1| unnamed protein product [Mus musculus]
          Length = 230

 Score = 38.1 bits (87), Expect = 0.72
 Identities = 49/171 (28%), Positives = 65/171 (37%), Gaps = 1/171 (0%)
 Frame = -2

Query: 2058 LGGCRIGRPAPPQAARAACSRTGIRDLRSRRLSPRLTRPFGSSADGDTWLLGLE*RCYAP 1879
            LGG    RP P Q+ RAA    G     S R +PR             + L L  R +  
Sbjct: 62   LGGWLAARPRPAQSQRAAAVAPG-----SCRGAPRARLRAKLLVAWHLYALPLRSRAFGC 116

Query: 1878 ARLDLAATRRRPNR*LPEPSALSTRVRYRRRSVVGAHKSKPMHSWE*RESSAGTGRRCAL 1699
                L AT R   R LP   A +   R  RR    A + + +H    R + +  G R   
Sbjct: 117  LLPRLPATGRARQRALPLVPAAAAAARRGRRRPARAGRVRGVH----RRTGSYAGDRGGH 172

Query: 1698 IAGRQPHLA-ARHELTPTTMARLAPAAGEMPCRQNGATAVVSFCRLCTAPP 1549
              GR+ HL  A   L    +    P A ++P  Q+   A+    R  T PP
Sbjct: 173  DGGRRLHLCHAGGHLPAGGLHHREPHAPDLPGTQSAQAALK---RKATRPP 220

>gb|AAF64523.1| cervical mucin MUC5B [Homo sapiens]
          Length = 716

 Score = 37.4 bits (85), Expect = 1.2
 Identities = 39/162 (24%), Positives = 60/162 (36%), Gaps = 12/162 (7%)
 Frame = -1

Query: 1555 AATGHTTSPHSREDEYLQSRGCHHV*PPVHKSIAK--GAQTRPKAPHSSSASR*VASMCS 1382
            AAT +T +P S       + G  H  PPV  + A   G    P +PH+   +   A+  +
Sbjct: 74   AATSNTVTPSS-------ALGTTHT-PPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGT 125

Query: 1381 SSQGHA*M*RLSPATGCGAHKTAGTRSPQLTSPAMSDAHPESPWTCHNDNIQRPLASSLA 1202
                H       P+TG      A T + Q ++PA+S  HP S  T  +            
Sbjct: 126  LGTTHI----TEPSTGTSHTPAATTGTTQHSTPALSSPHPSSSRTTESPPSPGTTTPGHT 181

Query: 1201 QSAEHVHVHSPPSTRLNNSIKPLS----------MNGQDPHC 1106
             +       + PS    +++ P S            G +PHC
Sbjct: 182  TATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPHC 223



EST assemble image


clone accession position
1 HC075g05_r AV637645 1 502
2 CL16b04_r AV394008 85 605
3 HC020g08_r AV633437 111 623
4 HC010e01_r AV632620 131 623
5 HC030h09_r AV634241 152 623
6 MX258a04_r BP092706 164 678
7 CM013e06_r AV387066 213 654
8 HC071b11_r AV637290 219 623
9 LC095d03_r AV625607 232 672
10 MX236a06_r BP091251 264 761
11 HCL013h04_r AV640298 392 625
12 MXL038g02_r BP095244 424 673
13 HC046a08_r AV635410 445 1023
14 CM068e02_r AV391057 540 1123
15 CM049f01_r AV389644 541 814
16 CM027g10_r AV387609 542 957
17 CM067g01_r AV390883 542 1138
18 CM079d01_r AV391967 542 1111
19 CM005e04_r AV386868 542 1095
20 CM070f05_r AV391252 542 1131
21 CM076a03_r AV391703 542 1153
22 CM028a08_r AV387681 542 1047
23 CM003f09_r AV386600 545 1102
24 CM087f09_r AV392425 548 1124
25 CM020d10_r AV397458 548 1131
26 CM045c08_r AV389713 548 1100
27 HC043f09_r AV635234 549 1083
28 HC003g06_r AV632089 549 1069
29 MX040e04_r BP087659 550 963
30 HC046g04_r AV635471 550 1032
31 LC004d02_r AV619141 550 1072
32 HCL008c07_r AV639981 555 1017
33 HC063g08_r AV636755 555 1020
34 HC039h02_r AV634935 555 900
35 LC082f10_r AV624785 555 1081
36 MX259d04_r BP092802 555 1013
37 HC059h10_r AV636470 555 1014
38 HC042c06_r AV635129 555 1036
39 LC071c10_r AV623979 556 1072
40 HC006b03_r AV632272 556 1094
41 HC045h10_r AV635401 557 1022
42 HC088c11_r AV638593 557 1064
43 CM074d09_r AV391580 557 1174
44 LCL084d10_r AV630797 562 1027
45 MX248c10_r BP092010 562 1097
46 HC058d01_r AV636348 562 1055
47 CM042d12_r AV389295 564 875
48 LC011h03_r AV619694 565 1105
49 HC076a01_r AV637665 565 756
50 HC011h09_r AV632732 574 1023
51 CM098c06_r AV392929 574 1019
52 HC013g05_r AV632873 574 1072
53 HC034b02_r AV634493 590 1120
54 CM033f08_r AV388415 633 1115
55 HC038d07_r AV634822 635 1105
56 HC060f10_r AV636530 655 1113
57 CM001g12_r AV386493 741 1291
58 CL23d09_r AV394509 1215 1716
59 CM032a05_r AV388500 1368 1818
60 HC037f09_r AV634771 1644 1861
61 CM019d08_r AV387356 1737 2326
62 HC027h07_r AV633997 1744 2271
63 HC044g05_r AV635313 1744 2212
64 LC051h01_r AV622605 1745 2244
65 HC039c07_r AV634887 1746 2203
66 MX214g04_r BP089839 1748 2044
67 HC088a01_r AV638563 1750 2276
68 MXL005c06_r BP093225 1750 2190
69 MX015d03_r BP086723 1751 2141
70 HC027c07_r AV633946 1755 2267
71 CM093c10_r AV392982 1815 2375




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research