KCC000004A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000004A_C01 KCC000004A_c01
ctcgctctcgtgGGCGTTACCTCGTTACTCAGAGAACCAACCCTTGCACCCCGCGTTTTC
CCCAAATCTGCCTGAAAGCAAATTGACGCAATAGGTCTCACTCAGTATCTGCTAGGTCTG
TCATCCCGGTGGTTAGGAGCCCCCACTGTTGTAAGCCTAGCGAGGGCGAACCAGGCGCAG
CGACAGCACGCGAGCTCGGTGGAGACTGGAAACCTACGCAAGCATTTGTGGGCCTACGGG
CATCATCGCTCGGAGGAGGGCGCGGACTCCCAGCGGCGCGGGCCATGGCGCTCGCGCCCG
TGCAGCCCATGGCATTCACTGGCAGCCGGCGAAGTTGTGCGGCATTCTTAGGTGGTGTCG
GTGCAGCTGGCGGCCGCTCTGTCCGAGGAGGCCAGCAGCCCTCATCCTTCGGAGGTCTGC
GCCGCGCCTGCCGGCGGGCTGGTGCGGAGTTCCGGCATGGTGGCGGTGGTGGCGGCGGCA
CTGCTGGTGATGAGCCGGAGTACCTGCCGCAATGGCTGAGCCTGGCTGGCAACGTTTGGC
AAGCACGAGCGCGACCTGTGGACAGCCCCATCCCAGCAGTGTGCACCTGGTGCATGAGGA
CGTGCTGCTGCCGCGACGGTGCACATTGCGGCGCCGCCTGGTGCGGGACAGCCCGCGTCA
GGAGGACCCAGGGGCGGTGCTGACGCTGGTCGACATCATGGCCGCCTTAACCGACATGAA
GACGGAGGTTTTGCAGGGGCTGCAAGGGTTGATGGAGGACCTGGTGGGACTGAGGGAAAA
CCTGTTGGGAGTGAAATGATGACT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000004A_C01 KCC000004A_c01
         (804 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|ZP_00009817.1| COG2885: Outer membrane protein and related p...    47  5e-10
ref|XP_330525.1| predicted protein [Neurospora crassa] gi|289256...    54  3e-09
emb|CAC39318.1| VMP3 protein [Volvox carteri f. nagariensis]           46  3e-08
gb|AAK61381.1| basic proline-rich protein [Sus scrofa]                 50  3e-08
gb|AAK61383.1| basic proline-rich protein [Sus scrofa]                 45  1e-07

>ref|ZP_00009817.1| COG2885: Outer membrane protein and related
           peptidoglycan-associated (lipo)proteins
           [Rhodopseudomonas palustris]
          Length = 689

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 35/103 (33%), Positives = 39/103 (36%), Gaps = 1/103 (0%)
 Frame = -3

Query: 478 PPPPPPPCRNSAPAR-RQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPVNAMGC 302
           PPP P P    APA  + A   PP      PP    PP  P PP+ A      P      
Sbjct: 56  PPPGPRP----APAPPKAAPSAPPPPPAAAPPHVAPPPPPPAPPRAAP-----PPPPPAA 106

Query: 301 TGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAP 173
             A A  RA   P PPPS  A  P         PP+ +  A P
Sbjct: 107 APAPAPKRAEPPPPPPPSHSAPPPPPPHAAPPPPPAPKPSAPP 149

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 43/163 (26%), Positives = 54/163 (32%), Gaps = 7/163 (4%)
 Frame = -3

Query: 652 AVPHQAAPQCAPSRQQHVLMHQVHTAGMGLSTGRARACQTLPARLSHCGRYSGSSPAVPP 473
           A PH A P   P+  +         A    +  RA      P   SH         A PP
Sbjct: 81  APPHVAPPPPPPAPPRAAPPPPPPAAAPAPAPKRAEPPPPPPP--SHSAPPPPPPHAAPP 138

Query: 472 PPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPVNAMGCTGA 293
           PPP P  ++ P    A R         P R   PPA   P +       +P NA+    A
Sbjct: 139 PPPAPKPSAPPTAAPAERPAAPPPAAAPVRPPAPPAGEAPQRRGPPPGAVPPNAVPPNAA 198

Query: 292 S-------AMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRA 185
           +       A  +  G  R PP      P NA     +PP   A
Sbjct: 199 APDAAKPDAAKQPPGERRGPPPGAPGTPPNATAPGMTPPPGEA 241

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 38/122 (31%), Positives = 45/122 (36%), Gaps = 6/122 (4%)
 Frame = -3

Query: 487 PAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTP---PKNAAQLRRLPV 317
           P   PPPPPP    APA ++A   PP       P    P AAP P   PK +A     P 
Sbjct: 95  PRAAPPPPPPAAAPAPAPKRAEPPPPPPPSHSAPPPPPPHAAPPPPPAPKPSAPPTAAPA 154

Query: 316 NAMGCTGASAMARAAGSPRPPPSDDA---RRPTNACVGFQSPPSSRAVAAPGSPSLGLQQ 146
                  A   A A   P  PP+ +A   R P    V   + P + A      P    Q 
Sbjct: 155 ER---PAAPPPAAAPVRPPAPPAGEAPQRRGPPPGAVPPNAVPPNAAAPDAAKPDAAKQP 211

Query: 145 WG 140
            G
Sbjct: 212 PG 213

 Score = 44.3 bits (103), Expect(2) = 5e-10
 Identities = 35/113 (30%), Positives = 40/113 (34%), Gaps = 6/113 (5%)
 Frame = -3

Query: 487 PAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAA------PTPPKNAAQLRR 326
           PA PPP   P R  AP   +A +R     G  PP    P AA      P   K     RR
Sbjct: 157 PAAPPPAAAPVRPPAPPAGEAPQRRGPPPGAVPPNAVPPNAAAPDAAKPDAAKQPPGERR 216

Query: 325 LPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGS 167
            P    G  G    A A G   PP     R P         PP++    AP +
Sbjct: 217 GP--PPGAPGTPPNATAPGMTPPPGEAPRRGPPPPPAAANPPPAAAPTPAPSA 267

 Score = 42.0 bits (97), Expect(2) = 5e-10
 Identities = 29/70 (41%), Positives = 30/70 (42%), Gaps = 3/70 (4%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAG---CPAPGGAAMCT 618
           P   P   P PP   AAPA  P       P     SAPP  PP A     PAP  +A  T
Sbjct: 91  PPAPPRAAPPPPPPAAAPAPAPKRAEPPPPPPPSHSAPPPPPPHAAPPPPPAPKPSAPPT 150

Query: 617 VAAAARPHAP 588
            A A RP AP
Sbjct: 151 AAPAERPAAP 160

 Score = 40.4 bits (93), Expect(2) = 2e-05
 Identities = 38/136 (27%), Positives = 46/136 (32%), Gaps = 24/136 (17%)
 Frame = -3

Query: 496 GSSPAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPV 317
           G +P   PPPPP   N  PA               P  +  P AAPT P N +     PV
Sbjct: 239 GEAPRRGPPPPPAAANPPPAAAPT-----------PAPSAAPQAAPTSPANPSGPAVAPV 287

Query: 316 -----------------------NAMGCTGAS-AMARAAGSPRPPPSDDARRPTNACVGF 209
                                     G  GA  A+A   G P+P P    + P    V  
Sbjct: 288 ARPSGERGPQPGAPAGGPPPRPQAGPGAPGAGPAVAPPPGQPQPVPPQPGQPPAGPAVAP 347

Query: 208 QSPPSSRAVAAPGSPS 161
            +PP   AV AP  P+
Sbjct: 348 PAPPPP-AVTAPIPPA 362

 Score = 40.4 bits (93), Expect = 0.034
 Identities = 41/169 (24%), Positives = 59/169 (34%), Gaps = 10/169 (5%)
 Frame = -3

Query: 631 PQCAPSRQQHVLMHQVHTAGMGLSTGRARACQTLPARLSHCGRYSGSSPAVPPPPP---- 464
           P  A S    +L+ Q    G   +    +A +  P           ++P+ PPPPP    
Sbjct: 23  PAAAESASAPMLLAQAVQGGPAPAPSEEKAKEAPPPGPRPAPAPPKAAPSAPPPPPAAAP 82

Query: 463 ----PPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPVNAMGCTG 296
               PP    AP R  A   PP       P  +R    P PP + +     P +A     
Sbjct: 83  PHVAPPPPPPAPPR--AAPPPPPPAAAPAPAPKRAEPPPPPPPSHSAPPPPPPHA----- 135

Query: 295 ASAMARAAGSPRPPPSDDARRPTNACVGFQ--SPPSSRAVAAPGSPSLG 155
                    +P PPP+     P  A    +  +PP + A   P +P  G
Sbjct: 136 ---------APPPPPAPKPSAPPTAAPAERPAAPPPAAAPVRPPAPPAG 175

 Score = 40.0 bits (92), Expect = 0.044
 Identities = 37/132 (28%), Positives = 47/132 (35%), Gaps = 4/132 (3%)
 Frame = -2

Query: 788 PTGFPSVPPGPPST----LAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMC 621
           P   PS PP PP+     +A P  PP+  R   P   PA+AP   P  A  P P      
Sbjct: 67  PKAAPSAPPPPPAAAPPHVAPPPPPPAPPRAAPPPPPPAAAPAPAPKRAEPPPP------ 120

Query: 620 TVAAAARPHAPGAHCWDGAVHRSRSCLPNVASQAQPLRQVLRLITSSAAATTATMPELRT 441
              + + P  P  H         +   P  A+ A+            AA   A  P    
Sbjct: 121 PPPSHSAPPPPPPHAAPPPPPAPKPSAPPTAAPAE----------RPAAPPPAAAPVRPP 170

Query: 440 SPPAGAAQTSEG 405
           +PPAG A    G
Sbjct: 171 APPAGEAPQRRG 182

 Score = 40.0 bits (92), Expect(2) = 2e-06
 Identities = 33/112 (29%), Positives = 39/112 (34%)
 Frame = -3

Query: 490 SPAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPVNA 311
           +P  PP    P     P     R  PP      PP    P  AP+    AA     P N 
Sbjct: 222 APGTPPNATAPGMTPPPGEAPRRGPPPPPAAANPPPAAAPTPAPSAAPQAAPTS--PANP 279

Query: 310 MGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSPSLG 155
            G    + +AR +G   P P   A  P         PP  R  A PG+P  G
Sbjct: 280 SG-PAVAPVARPSGERGPQPGAPAGGP---------PP--RPQAGPGAPGAG 319

 Score = 37.7 bits (86), Expect = 0.22
 Identities = 41/151 (27%), Positives = 48/151 (31%), Gaps = 10/151 (6%)
 Frame = -3

Query: 646 PHQAAPQCAPSRQQHVLMHQVHTAGMGLSTGRARACQTLPARLSHCGRYSGSSPAVP--- 476
           P  AAP  APS            A     T  A       A ++      G  P  P   
Sbjct: 256 PPAAAPTPAPS-----------AAPQAAPTSPANPSGPAVAPVARPSGERGPQPGAPAGG 304

Query: 475 PPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPA-------APTPPKNAAQLRRLPV 317
           PPP P     AP    A   PP      PP+  +PPA       AP PP   A +   P 
Sbjct: 305 PPPRPQAGPGAPGAGPAVAPPPGQPQPVPPQPGQPPAGPAVAPPAPPPPAVTAPIPPAPP 364

Query: 316 NAMGCTGASAMARAAGSPRPPPSDDARRPTN 224
                T  +  A+A G          RR  N
Sbjct: 365 PPQALTPIAPGAQAPGPRNMSDFRGQRREVN 395

 Score = 34.3 bits (77), Expect(2) = 2e-06
 Identities = 23/69 (33%), Positives = 27/69 (38%), Gaps = 7/69 (10%)
 Frame = -2

Query: 767 PPGPPSTLAAPAKPPSSCRLRRP*CRPASAP-------PLGPPDAGCPAPGGAAMCTVAA 609
           PP PPS  A P  PP +     P  +P++ P       P  PP A  P    A     A 
Sbjct: 119 PPPPPSHSAPPPPPPHAAPPPPPAPKPSAPPTAAPAERPAAPPPAAAPVRPPAPPAGEAP 178

Query: 608 AARPHAPGA 582
             R   PGA
Sbjct: 179 QRRGPPPGA 187

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 24/67 (35%), Positives = 26/67 (37%), Gaps = 2/67 (2%)
 Frame = -2

Query: 782 GFPSVPPGPPSTLAAP--AKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAA 609
           G P   PG P    AP    PP     R P   PA+A P  P  A  PAP  A      +
Sbjct: 217 GPPPGAPGTPPNATAPGMTPPPGEAPRRGPPPPPAAANP-PPAAAPTPAPSAAPQAAPTS 275

Query: 608 AARPHAP 588
            A P  P
Sbjct: 276 PANPSGP 282

 Score = 30.0 bits (66), Expect(2) = 2e-05
 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 2/68 (2%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPP--LGPPDAGCPAPGGAAMCTV 615
           P   PS PP   +    PA PP +    RP   PA   P   GPP    P          
Sbjct: 141 PAPKPSAPP-TAAPAERPAAPPPAAAPVRPPAPPAGEAPQRRGPPPGAVPPNAVPPNAAA 199

Query: 614 AAAARPHA 591
             AA+P A
Sbjct: 200 PDAAKPDA 207

>ref|XP_330525.1| predicted protein [Neurospora crassa] gi|28925602|gb|EAA34623.1|
           predicted protein [Neurospora crassa]
          Length = 452

 Score = 53.9 bits (128), Expect(2) = 3e-09
 Identities = 40/126 (31%), Positives = 56/126 (43%), Gaps = 11/126 (8%)
 Frame = -3

Query: 502 YSGSSPAVPPPPP----PPCRNSAPARRQARRRPPKDEGCWP---PRTERPPAAPTPPKN 344
           +S + P+ PPPPP    PP  ++AP+   A   PP      P   P   +PP  P P  +
Sbjct: 235 HSSAPPSAPPPPPSFAPPPPSSAAPSLPPAPPPPPPTAAPRPPPAPSRSQPPPPPPPSSS 294

Query: 343 AAQL-RRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQS---PPSSRAVAA 176
            + L + + V A     +SA + AA  P PPP     R T +     +   PP     +A
Sbjct: 295 TSNLSQNIAVQAAIRAASSASSPAAPPPPPPPPSAPPRSTASSPSHSAPAPPPPPPPSSA 354

Query: 175 PGSPSL 158
           P  PSL
Sbjct: 355 PVPPSL 360

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 27/71 (38%), Positives = 33/71 (46%)
 Frame = -3

Query: 562 STGRARACQTLPARLSHCGRYSGSSPAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPR 383
           S+  +   Q +  + +     S SSPA PPPPPPP   SAP R  A    P      PP 
Sbjct: 292 SSSTSNLSQNIAVQAAIRAASSASSPAAPPPPPPP--PSAPPRSTA--SSPSHSAPAPPP 347

Query: 382 TERPPAAPTPP 350
              P +AP PP
Sbjct: 348 PPPPSSAPVPP 358

 Score = 37.0 bits (84), Expect = 0.37
 Identities = 26/92 (28%), Positives = 32/92 (34%)
 Frame = -3

Query: 472 PPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPVNAMGCTGA 293
           PPPPP     P    +R+         PP    PP +  PP  ++    LP         
Sbjct: 212 PPPPPVGKKPPPPPGSRKPSAAIHSSAPPSAPPPPPSFAPPPPSSAAPSLP--------- 262

Query: 292 SAMARAAGSPRPPPSDDARRPTNACVGFQSPP 197
                   +P PPP   A RP  A    Q PP
Sbjct: 263 -------PAPPPPPPTAAPRPPPAPSRSQPPP 287

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 32/108 (29%), Positives = 37/108 (33%)
 Frame = -3

Query: 487 PAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPVNAM 308
           P  PPPPPPP              PP   G  PP    PP    P +  A L        
Sbjct: 2   PPPPPPPPPP--------------PPGMGG--PPPPPPPPPGALPGRPPAGLPNRGALLT 45

Query: 307 GCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
             T   A+ +A  + R  P      PT+   G    PS  A   PG P
Sbjct: 46  DITKGKALKKAVTNDRSAP---IIAPTSGS-GPGPSPSGGAPPVPGLP 89

 Score = 29.6 bits (65), Expect(2) = 3e-09
 Identities = 22/72 (30%), Positives = 31/72 (42%), Gaps = 2/72 (2%)
 Frame = -2

Query: 797 ISLPTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCT 618
           +S P   P   P  P   +AP   PS   L++     +S PP  P     P P G+   +
Sbjct: 172 VSAPRPPPGAAPTIPGRPSAPTFHPSMPNLKKTANGASSKPPPPPVGKKPPPPPGSRKPS 231

Query: 617 VA--AAARPHAP 588
            A  ++A P AP
Sbjct: 232 AAIHSSAPPSAP 243

>emb|CAC39318.1| VMP3 protein [Volvox carteri f. nagariensis]
          Length = 687

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 35/109 (32%), Positives = 41/109 (37%)
 Frame = -3

Query: 487 PAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPVNAM 308
           P+ PP PPPP   S P  R     PP      PP + RPP +P PP         P    
Sbjct: 476 PSAPPSPPPP---SPPPPRPP---PPSPVPPTPPPSPRPPPSPRPPNP-------PPRPP 522

Query: 307 GCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSPS 161
                        SPRPPP D +  P        SPPS     +P  P+
Sbjct: 523 SPRPPPRPPPRPSSPRPPPPDPSPPP-------PSPPSPPTSPSPPDPA 564

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 34/109 (31%), Positives = 43/109 (39%)
 Frame = -3

Query: 487 PAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPVNAM 308
           P+  PPP PP R S+P      R PP D    PP    PP +P+PP  A     LP    
Sbjct: 522 PSPRPPPRPPPRPSSP------RPPPPDPSPPPPSPPSPPTSPSPPDPA--WANLP---- 569

Query: 307 GCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSPS 161
             T     +    SP PP  D    P  +      PP +    +P  P+
Sbjct: 570 --TSPDPPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPN 616

 Score = 42.7 bits (99), Expect(2) = 3e-08
 Identities = 32/107 (29%), Positives = 39/107 (35%)
 Frame = -3

Query: 499 SGSSPAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLP 320
           S   P+ PPP PPP     P+       PP      PP    PP  P PP       R P
Sbjct: 591 SAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPP 650

Query: 319 VNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVA 179
                     +       PRPPP+  +  PT+      SPP   AV+
Sbjct: 651 T-----PPPPSPPPPRPPPRPPPTRRSPPPTS------SPPPPVAVS 686

 Score = 37.7 bits (86), Expect(2) = 3e-08
 Identities = 20/63 (31%), Positives = 26/63 (40%)
 Frame = -2

Query: 776 PSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAAAARP 597
           P+ PP PPS    P  PP     R P   P+  PP  P     P+P   A   +  +  P
Sbjct: 515 PNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDP 574

Query: 596 HAP 588
            +P
Sbjct: 575 PSP 577

 Score = 36.2 bits (82), Expect = 0.64
 Identities = 34/116 (29%), Positives = 41/116 (35%), Gaps = 4/116 (3%)
 Frame = -3

Query: 499 SGSSPAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLP 320
           S   P+ PPP PPP     P+       PP      PP    PP +P PP         P
Sbjct: 586 SPDPPSAPPPSPPP-----PSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPP------P 634

Query: 319 VNAMGCTGASAMARAAGSPR----PPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
            N          +    SPR    PPPS    RP       + PP+ R+     SP
Sbjct: 635 PN------PPPPSPPPPSPRPPTPPPPSPPPPRPPP-----RPPPTRRSPPPTSSP 679

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 27/107 (25%), Positives = 32/107 (29%)
 Frame = -3

Query: 493 SSPAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPVN 314
           S P  P PP P   N   +       PP  +   P     PP +P PP         P N
Sbjct: 553 SPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPPSPPPPSPP------PPN 606

Query: 313 AMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAP 173
               +           P P P   +  P N       PPS R    P
Sbjct: 607 PPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPP 653

>gb|AAK61381.1| basic proline-rich protein [Sus scrofa]
          Length = 566

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 43/148 (29%), Positives = 53/148 (35%), Gaps = 6/148 (4%)
 Frame = -3

Query: 571 MGLSTGRARACQTLPARLSHCGRYSGSSPAVPPPPPPPCRNSAPARRQARRRPPKD---E 401
           + LS+ R+       A  +   ++    P   PP PPP   S     Q R RPP D   +
Sbjct: 11  LALSSARSPFFDLEDANSNSAEKFLRPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQ 70

Query: 400 GCWPPRTERPPAAP---TPPKNAAQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRP 230
           G  PP    PP  P    PP   A     P       G      A    RPPP      P
Sbjct: 71  GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---P 127

Query: 229 TNACVGFQSPPSSRAVAAPGSPSLGLQQ 146
                   +PP +R    P  P+ GLQQ
Sbjct: 128 PGPPPPGPAPPGARPPPGPPPPAGGLQQ 155

 Score = 45.8 bits (107), Expect(2) = 3e-08
 Identities = 36/116 (31%), Positives = 45/116 (38%), Gaps = 2/116 (1%)
 Frame = -3

Query: 496 GSSPAVPPPPP--PPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRL 323
           G+ P  PPPPP   P +  AP+  + +++PP   G  PP    PP  P PP  A    R 
Sbjct: 444 GARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAG--PPPPPPPPPGPPPPGPAPPGAR- 500

Query: 322 PVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSPSLG 155
           P       G      A    RPPP      P        +PP +R    P  P  G
Sbjct: 501 PRPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPPPPG 553

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 35/115 (30%), Positives = 38/115 (32%)
 Frame = -3

Query: 484 AVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRLPVNAMG 305
           A PPP PPP     P       RPP      PP    PP  P PP  A      P  A G
Sbjct: 98  ARPPPGPPPPGPPPPGPAPPGARPPPG----PPPPGPPPPGPAPP-GARPPPGPPPPAGG 152

Query: 304 CTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSPSLGLQQWG 140
                A +      +PPP      P       +S P  R    P SP     Q G
Sbjct: 153 LQQGPAPSHVGPKKKPPPPGAGHPPRPPPPANESQPGPRPPPGPPSPPANDSQEG 207

 Score = 41.2 bits (95), Expect(2) = 2e-06
 Identities = 36/129 (27%), Positives = 47/129 (35%), Gaps = 24/129 (18%)
 Frame = -3

Query: 478 PPPPPPPC----RNSAPARRQARRRPPKDEGCWPPR-----------TERPPAAPTPPKN 344
           PP PPPP     +  AP+    +++PP      PPR              PP  P+PP N
Sbjct: 143 PPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPPANESQPGPRPPPGPPSPPAN 202

Query: 343 AAQLRRLPVNAMGCTGASAMA---------RAAGSPRPPPSDDARRPTNACVGFQSPPSS 191
            +Q    P +A G     A +           AG P PPP      P        +PP +
Sbjct: 203 DSQ-EGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPG-----PAPPGA 256

Query: 190 RAVAAPGSP 164
           R    P  P
Sbjct: 257 RPPPGPPPP 265

 Score = 40.8 bits (94), Expect(2) = 5e-06
 Identities = 31/87 (35%), Positives = 32/87 (36%), Gaps = 6/87 (6%)
 Frame = -3

Query: 493 SSPAVPPPPPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAPTPPKNAAQL 332
           + P  PPPPPP      PA   AR RP      P   G  PP   RPP  P PP      
Sbjct: 477 AGPPPPPPPPPGPPPPGPAPPGARPRPGPPPPGPPPPGPAPPGA-RPPPGP-PPPGPPPP 534

Query: 331 RRLPVNAMGCTGASAMARAAGSPRPPP 251
              P  A    G          PRPPP
Sbjct: 535 GPAPPGARPPPGPPPPPPGPSPPRPPP 561

 Score = 38.9 bits (89), Expect(2) = 3e-06
 Identities = 37/117 (31%), Positives = 41/117 (34%), Gaps = 6/117 (5%)
 Frame = -3

Query: 496 GSSPAVPPPPPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAPTPPKNAAQ 335
           G+ P   PPPP P     PA   AR  P      P   G  PP   RPP  P PP +  Q
Sbjct: 402 GARPPPGPPPPGP-PPPGPAPPGARPLPGPPPPGPPPPGPAPPGA-RPPPPPPPPADEPQ 459

Query: 334 LRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
               P    G          AG P PPP      P        +PP +R    P  P
Sbjct: 460 QGPAP---SGDKPKKKPPPPAGPPPPPPPPPGPPPPG-----PAPPGARPRPGPPPP 508

 Score = 38.9 bits (89), Expect = 0.098
 Identities = 35/119 (29%), Positives = 38/119 (31%), Gaps = 9/119 (7%)
 Frame = -3

Query: 493 SSPAVPPPPPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKNA 341
           + P  PPPPPP      PA   AR  P      P   G  PP    PP  P    PP   
Sbjct: 234 AGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 293

Query: 340 AQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
           A     P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 294 APHGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 349

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 21/53 (39%), Positives = 22/53 (40%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGA 630
           P G P   P PP     P  PP       P   P + PP GPP  G P PG A
Sbjct: 369 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPA 420

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 21/53 (39%), Positives = 22/53 (40%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGA 630
           P G P   P PP     P  PP       P   P + PP GPP  G P PG A
Sbjct: 486 PPGPPPPGPAPPGARPRPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPA 537

 Score = 36.6 bits (83), Expect(2) = 6e-06
 Identities = 19/45 (42%), Positives = 20/45 (44%)
 Frame = -3

Query: 487 PAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTP 353
           P  PPP PPP   + P  R     PP   G  PP   RPP  P P
Sbjct: 524 PGPPPPGPPPPGPAPPGARPPPGPPPPPPGPSPP---RPPPGPPP 565

 Score = 36.6 bits (83), Expect(2) = 5e-06
 Identities = 34/119 (28%), Positives = 40/119 (33%), Gaps = 4/119 (3%)
 Frame = -3

Query: 499 SGSSPAVPP-PPPPPCRNS---APARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQL 332
           S   P  PP PP PP  +S   +P      ++ P   G  P +   PPA P PP      
Sbjct: 186 SQPGPRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPP------ 239

Query: 331 RRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSPSLG 155
              P    G          A  P  PP      P  A  G + PP       PG P  G
Sbjct: 240 ---PPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP---PPPGPPPPG 292

 Score = 36.2 bits (82), Expect(2) = 1e-05
 Identities = 26/68 (38%), Positives = 27/68 (39%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAA 609
           P G P  PP PP        PP +    RP   P   PP GPP  G PAP GA       
Sbjct: 233 PAGPPPPPPPPPGPPPPGPAPPGA----RP---PPGPPPPGPPPPG-PAPPGARPPPGPP 284

Query: 608 AARPHAPG 585
              P  PG
Sbjct: 285 PPGPPPPG 292

 Score = 36.2 bits (82), Expect(2) = 5e-05
 Identities = 34/120 (28%), Positives = 35/120 (28%), Gaps = 12/120 (10%)
 Frame = -3

Query: 487 PAVPPP-PPPPCRNSAPARRQARRRP-----------PKDEGCWPPRTERPPAAPTPPKN 344
           P  PPP PPPP     PA   AR  P           P   G  PP    PP  P P   
Sbjct: 365 PGPPPPGPPPP----GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 420

Query: 343 AAQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
               R LP            A     P PPP   A  P          P  +     G P
Sbjct: 421 PPGARPLPGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPP 480

 Score = 36.2 bits (82), Expect(2) = 5e-06
 Identities = 23/69 (33%), Positives = 25/69 (35%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAA 609
           P G P   P PP     P  PP       P   P + PP GPP        G A   V  
Sbjct: 106 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPAGGLQQGPAPSHVGP 164

Query: 608 AARPHAPGA 582
             +P  PGA
Sbjct: 165 KKKPPPPGA 173

 Score = 35.8 bits (81), Expect(2) = 2e-04
 Identities = 36/118 (30%), Positives = 38/118 (31%), Gaps = 10/118 (8%)
 Frame = -3

Query: 487 PAVPPP-PPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKNAA 338
           P  PPP PPPP     PA   AR  P      P   G  PP    PP  P    PP   A
Sbjct: 281 PGPPPPGPPPP----GPAPHGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 336

Query: 337 QLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
                P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 337 PPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 391

 Score = 35.8 bits (81), Expect(2) = 6e-06
 Identities = 23/67 (34%), Positives = 27/67 (39%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAA 609
           P   P  PP PP+        PS  + ++    PA  PP  PP  G P PG A      A
Sbjct: 443 PGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPA---PPGA 499

Query: 608 AARPHAP 588
             RP  P
Sbjct: 500 RPRPGPP 506

 Score = 35.8 bits (81), Expect = 0.83
 Identities = 32/111 (28%), Positives = 34/111 (29%), Gaps = 3/111 (2%)
 Frame = -3

Query: 487 PAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAP---TPPKNAAQLRRLPV 317
           PA PPPPPPP     P             G  PP    PP  P    PP   A     P 
Sbjct: 233 PAGPPPPPPPPPGPPPP------------GPAPPGARPPPGPPPPGPPPPGPAPPGARPP 280

Query: 316 NAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
                 G      A    RPPP      P        +PP +R    P  P
Sbjct: 281 PGPPPPGPPPPGPAPHGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 328

 Score = 35.0 bits (79), Expect(2) = 0.005
 Identities = 36/118 (30%), Positives = 38/118 (31%), Gaps = 10/118 (8%)
 Frame = -3

Query: 487 PAVPPP-PPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKNAA 338
           P  PPP PPPP     PA   AR  P      P   G  PP    PP  P    PP   A
Sbjct: 302 PGPPPPGPPPP----GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 357

Query: 337 QLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
                P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 358 PPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 412

 Score = 35.0 bits (79), Expect(2) = 1e-05
 Identities = 35/120 (29%), Positives = 39/120 (32%), Gaps = 9/120 (7%)
 Frame = -3

Query: 496 GSSPAVPPPPPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKN 344
           G+ P   PPPP P     PA   AR  P      P   G  PP    PP  P    PP  
Sbjct: 318 GARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 376

Query: 343 AAQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
            A     P       G      A    RPPP      P        +PP +R +  P  P
Sbjct: 377 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPLPGPPPP 433

 Score = 34.7 bits (78), Expect(2) = 3e-06
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 327 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 385

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 386 PGPPPPGPPPPG 397

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 306 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 364

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 365 PGPPPPGPPPPG 376

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 20/53 (37%), Positives = 21/53 (38%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGA 630
           P G P   P PP     P  PP       P     + PP GPP  G P PG A
Sbjct: 264 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APHGARPPPGPPPPGPPPPGPA 315

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 243 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPHGARPP 301

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 302 PGPPPPGPPPPG 313

 Score = 34.7 bits (78), Expect(2) = 0.005
 Identities = 32/118 (27%), Positives = 41/118 (34%), Gaps = 9/118 (7%)
 Frame = -3

Query: 487 PAVPPPPPPPCRNSAPARRQARRRPPKDEGCW---------PPRTERPPAAPTPPKNAAQ 335
           P  PPP PPP   + P  R     PP   G           P +   PP A  PP+    
Sbjct: 123 PGPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPP- 181

Query: 334 LRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSPS 161
               P N            +   PRPPP   +    ++  G  SPPS+       +PS
Sbjct: 182 ----PAN-----------ESQPGPRPPPGPPSPPANDSQEG--SPPSADGPQQGPAPS 222

 Score = 34.7 bits (78), Expect(2) = 3e-08
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 348 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 406

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 407 PGPPPPGPPPPG 418

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 22/57 (38%), Positives = 23/57 (39%), Gaps = 4/57 (7%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGA 630
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA
Sbjct: 85  PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGA 140

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 20/53 (37%), Positives = 21/53 (38%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGA 630
           P   P  P GPP     P  PP           P + PP GPP  G P PG A
Sbjct: 226 PKKKPPPPAGPPPPPPPPPGPPPPGP-----APPGARPPPGPPPPGPPPPGPA 273

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 19/46 (41%), Positives = 20/46 (43%)
 Frame = -2

Query: 767 PPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGA 630
           PPGPP     P  PP           P + PP GPP  G P PG A
Sbjct: 80  PPGPPP----PGPPPPGP------APPGARPPPGPPPPGPPPPGPA 115

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 19/46 (41%), Positives = 20/46 (43%)
 Frame = -2

Query: 767 PPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGA 630
           PPGPP     P  PP           P + PP GPP  G P PG A
Sbjct: 301 PPGPPP----PGPPPPGP------APPGARPPPGPPPPGPPPPGPA 336

 Score = 33.1 bits (74), Expect(2) = 2e-06
 Identities = 28/68 (41%), Positives = 29/68 (42%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAA 609
           P G P  PPGPP     PA P +     RP   P   PP GPP  G PAP GA       
Sbjct: 80  PPGPP--PPGPPPP--GPAPPGA-----RP---PPGPPPPGPPPPG-PAPPGARPPPGPP 126

Query: 608 AARPHAPG 585
              P  PG
Sbjct: 127 PPGPPPPG 134

 Score = 33.1 bits (74), Expect(2) = 0.11
 Identities = 24/68 (35%), Positives = 24/68 (35%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAA 609
           P   P  PP PP     P   P   R R         PP GPP  G PAP GA       
Sbjct: 475 PPAGPPPPPPPPPGPPPPGPAPPGARPR------PGPPPPGPPPPG-PAPPGARPPPGPP 527

Query: 608 AARPHAPG 585
              P  PG
Sbjct: 528 PPGPPPPG 535

 Score = 33.1 bits (74), Expect(2) = 5e-05
 Identities = 24/61 (39%), Positives = 25/61 (40%)
 Frame = -2

Query: 767 PPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAAAARPHAP 588
           PPGPP     P  P  +    RP   P   PP GPP  G PAP GA          P  P
Sbjct: 280 PPGPPP--PGPPPPGPAPHGARP---PPGPPPPGPPPPG-PAPPGARPPPGPPPPGPPPP 333

Query: 587 G 585
           G
Sbjct: 334 G 334

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 6/70 (8%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGP------PDAGCPAPGGAA 627
           P G P  PP PP        PP +    RP   P   PP GP      P  G P PG   
Sbjct: 476 PAGPPPPPPPPPGPPPPGPAPPGA--RPRPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 533

Query: 626 MCTVAAAARP 597
                  ARP
Sbjct: 534 PGPAPPGARP 543

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 33/113 (29%), Positives = 36/113 (31%), Gaps = 2/113 (1%)
 Frame = -3

Query: 496 GSSPAV--PPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRL 323
           G +P    PPP PPP     P       RPP      PP    PP  P PP         
Sbjct: 271 GPAPPGARPPPGPPPPGPPPPGPAPHGARPPPG----PPPPGPPPPGPAPPGARPPPGPP 326

Query: 322 PVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
           P        A   AR    P PPP      P        +PP +R    P  P
Sbjct: 327 PPGPPPPGPAPPGARPPPGP-PPPGPPPPGP--------APPGARPPPGPPPP 370

 Score = 32.0 bits (71), Expect(2) = 5e-06
 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 1/68 (1%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPL-GPPDAGCPAPGGAAMCTVA 612
           P G P  PPGP    A P   P       P   P  A PL GPP  G P PG A      
Sbjct: 390 PPGPP--PPGPAPPGARPPPGPPPPGPPPPGPAPPGARPLPGPPPPGPPPPGPA-----P 442

Query: 611 AAARPHAP 588
             ARP  P
Sbjct: 443 PGARPPPP 450

 Score = 31.6 bits (70), Expect(2) = 2e-04
 Identities = 23/69 (33%), Positives = 26/69 (37%), Gaps = 9/69 (13%)
 Frame = -2

Query: 776 PSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASA---------PPLGPPDAGCPAPGGAAM 624
           P  PPGPPS  A  ++  S      P   PA +         PP GPP    P PG    
Sbjct: 190 PRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPP 249

Query: 623 CTVAAAARP 597
                 ARP
Sbjct: 250 GPAPPGARP 258

 Score = 27.7 bits (60), Expect(2) = 0.005
 Identities = 24/76 (31%), Positives = 28/76 (36%), Gaps = 8/76 (10%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAP----AKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGG 633
           P G P  PP P  +         +PP     + P   P + PP GPP  G P    AP G
Sbjct: 39  PGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGP-APPGARPPPGPPPPGPPPPGPAPPG 97

Query: 632 AAMCTVAAAARPHAPG 585
           A          P  PG
Sbjct: 98  ARPPPGPPPPGPPPPG 113

 Score = 27.3 bits (59), Expect(2) = 0.005
 Identities = 21/76 (27%), Positives = 27/76 (34%), Gaps = 12/76 (15%)
 Frame = -2

Query: 776 PSVPPGPPSTLAAPAKPPSSCR------------LRRP*CRPASAPPLGPPDAGCPAPGG 633
           P  PP PP+  +    PPS+               ++P   P + PP  PP    P P G
Sbjct: 193 PPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKP--PPPAGPPPPPPPPPGPPPPG 250

Query: 632 AAMCTVAAAARPHAPG 585
            A         P  PG
Sbjct: 251 PAPPGARPPPGPPPPG 266

 Score = 24.6 bits (52), Expect(2) = 0.11
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -3

Query: 496 GSSPAVPPPPPPP 458
           G SP  PPP PPP
Sbjct: 553 GPSPPRPPPGPPP 565

>gb|AAK61383.1| basic proline-rich protein [Sus scrofa]
          Length = 676

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 40/142 (28%), Positives = 49/142 (34%), Gaps = 6/142 (4%)
 Frame = -3

Query: 571 MGLSTGRARACQTLPARLSHCGRYSGSSPAVPPPPPPPCRNSAPARRQARRRPPKD---E 401
           + LS+ R+       A  +   ++    P   PP PPP   S     Q R RPP D   +
Sbjct: 11  LALSSARSPFFDLEDANSNAAEKFLRPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQ 70

Query: 400 GCWPPRTERPPAAP---TPPKNAAQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRP 230
           G  PP  E PP  P    PP   A     P       G      A    RPPP      P
Sbjct: 71  GPAPPGAEPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPDARPPPGPP---P 127

Query: 229 TNACVGFQSPPSSRAVAAPGSP 164
                   +PP +R    P  P
Sbjct: 128 PGPPPPGPAPPGARPPPGPPPP 149

 Score = 39.7 bits (91), Expect(2) = 1e-07
 Identities = 33/113 (29%), Positives = 42/113 (36%), Gaps = 2/113 (1%)
 Frame = -3

Query: 496 GSSPAVPPPPP--PPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLRRL 323
           G+ P  PPPPP   P +  AP+  + +++PP   G  PP    P   P PP         
Sbjct: 412 GARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAG--PPPPGPPSPGPAPPGARPPPGPP 469

Query: 322 PVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
           P        A   AR    P PPP      P        +PP +R    P  P
Sbjct: 470 PPGPPPPGPAPPGARPPPGP-PPPGPPPPGP--------APPGARPPPGPPPP 513

 Score = 38.9 bits (89), Expect(2) = 1e-07
 Identities = 25/67 (37%), Positives = 26/67 (38%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAA 609
           P G P   P PP     P  PP       P   P + PP GPP  G P PG A       
Sbjct: 358 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPA-----PP 411

Query: 608 AARPHAP 588
            ARP  P
Sbjct: 412 GARPPPP 418

 Score = 37.7 bits (86), Expect(2) = 1e-05
 Identities = 24/68 (35%), Positives = 28/68 (40%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAA 609
           P   P  PP PP+        PS  + ++    PA  PP GPP  G PAP GA       
Sbjct: 411 PGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPG-PAPPGARPPPGPP 469

Query: 608 AARPHAPG 585
              P  PG
Sbjct: 470 PPGPPPPG 477

 Score = 37.0 bits (84), Expect(2) = 1e-05
 Identities = 35/128 (27%), Positives = 42/128 (32%), Gaps = 14/128 (10%)
 Frame = -3

Query: 496 GSSPAVPPPP------------PPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTP 353
           G  P  PPPP            PPP     P       RPP      PP    PP  P P
Sbjct: 334 GPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG----PPPPGPPPPGPAP 389

Query: 352 PKNAAQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARR--PTNACVGFQSPPSSRAVA 179
           P  A      P       G +        P PPP+D+ ++    +     + PP      
Sbjct: 390 P-GARPPPGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPP 448

Query: 178 APGSPSLG 155
            PG PS G
Sbjct: 449 PPGPPSPG 456

 Score = 36.6 bits (83), Expect(2) = 6e-06
 Identities = 26/72 (36%), Positives = 27/72 (37%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G PS  P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 449 PPGPPSPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 507

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 508 PGPPPPGPPPPG 519

 Score = 36.6 bits (83), Expect(2) = 1e-05
 Identities = 19/45 (42%), Positives = 20/45 (44%)
 Frame = -3

Query: 487 PAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTP 353
           P  PPP PPP   + P  R     PP   G  PP   RPP  P P
Sbjct: 634 PGPPPPGPPPPGPAPPGARPPPGPPPPPPGPSPP---RPPPGPPP 675

 Score = 36.2 bits (82), Expect(2) = 0.023
 Identities = 38/123 (30%), Positives = 41/123 (32%), Gaps = 9/123 (7%)
 Frame = -3

Query: 496 GSSPAVPPPPPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKN 344
           G+ P   PPPP P     PA   AR  P      P   G  PP    PP  P    PP  
Sbjct: 139 GARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 197

Query: 343 AAQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
            A     P       G      A    RPPP      P        +PP +R    PG P
Sbjct: 198 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGAR--PPPGPP 252

Query: 163 SLG 155
            LG
Sbjct: 253 PLG 255

 Score = 35.8 bits (81), Expect(2) = 1e-05
 Identities = 29/68 (42%), Positives = 30/68 (43%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAA 609
           P G P  PPGPP     PA P +     RP   P   PPLGPP  G PAP GA       
Sbjct: 227 PPGPP--PPGPPPP--GPAPPGA-----RP---PPGPPPLGPPPPG-PAPPGARPPPGPP 273

Query: 608 AARPHAPG 585
              P  PG
Sbjct: 274 PPGPPPPG 281

 Score = 35.8 bits (81), Expect(2) = 6e-06
 Identities = 37/121 (30%), Positives = 39/121 (31%), Gaps = 10/121 (8%)
 Frame = -3

Query: 487 PAVPPP-PPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKNAA 338
           P  PPP PPPP     PA   AR  P      P   G  PP    PP  P    PP   A
Sbjct: 550 PGPPPPGPPPP----GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 605

Query: 337 QLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSPSL 158
                P       G      A    RPPP      P        +PP +R    P  P  
Sbjct: 606 PPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPPPP 662

Query: 157 G 155
           G
Sbjct: 663 G 663

 Score = 35.8 bits (81), Expect(2) = 2e-05
 Identities = 34/115 (29%), Positives = 37/115 (31%), Gaps = 3/115 (2%)
 Frame = -3

Query: 499 SGSSPAVPPPP---PPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAPTPPKNAAQLR 329
           SG  P   PPP   PPP    +P       RPP      PP    PP  P PP       
Sbjct: 433 SGDKPKKKPPPPAGPPPPGPPSPGPAPPGARPPPG----PPPPGPPPPGPAPPGARPPPG 488

Query: 328 RLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
             P        A   AR    P PPP      P        +PP +R    P  P
Sbjct: 489 PPPPGPPPPGPAPPGARPPPGP-PPPGPPPPGP--------APPGARPPPGPPPP 534

 Score = 35.4 bits (80), Expect(2) = 1e-05
 Identities = 38/124 (30%), Positives = 41/124 (32%), Gaps = 10/124 (8%)
 Frame = -3

Query: 487 PAVPPP-PPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKNAA 338
           P  PPP PPPP     PA   AR  P      P   G  PP    PP  P    PP   A
Sbjct: 312 PGPPPPGPPPP----GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 367

Query: 337 QLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSPSL 158
                P       G      A    RPPP      P        +PP +R    P  P+ 
Sbjct: 368 PPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPPPPPPAD 424

Query: 157 GLQQ 146
             QQ
Sbjct: 425 EPQQ 428

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 20/53 (37%), Positives = 21/53 (38%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGA 630
           P   P   P PP     P  PP       P   P + PP GPP  G P PG A
Sbjct: 64  PGDGPEQGPAPPGAEPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPA 115

 Score = 35.4 bits (80), Expect(2) = 2e-05
 Identities = 29/68 (42%), Positives = 30/68 (43%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTVAA 609
           P G P  PPGPPS    PA P +     RP   P   PP GPP  G PAP GA       
Sbjct: 444 PAGPP--PPGPPSP--GPAPPGA-----RP---PPGPPPPGPPPPG-PAPPGARPPPGPP 490

Query: 608 AARPHAPG 585
              P  PG
Sbjct: 491 PPGPPPPG 498

 Score = 35.0 bits (79), Expect(2) = 2e-05
 Identities = 36/118 (30%), Positives = 38/118 (31%), Gaps = 10/118 (8%)
 Frame = -3

Query: 487 PAVPPP-PPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKNAA 338
           P  PPP PPPP     PA   AR  P      P   G  PP    PP  P    PP   A
Sbjct: 529 PGPPPPGPPPP----GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 584

Query: 337 QLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
                P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 585 PPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 639

 Score = 35.0 bits (79), Expect(2) = 4e-04
 Identities = 36/118 (30%), Positives = 38/118 (31%), Gaps = 10/118 (8%)
 Frame = -3

Query: 487 PAVPPP-PPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKNAA 338
           P  PPP PPPP     PA   AR  P      P   G  PP    PP  P    PP   A
Sbjct: 466 PGPPPPGPPPP----GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 521

Query: 337 QLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
                P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 522 PPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 576

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 36/118 (30%), Positives = 38/118 (31%), Gaps = 10/118 (8%)
 Frame = -3

Query: 487 PAVPPP-PPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKNAA 338
           P  PPP PPPP     PA   AR  P      P   G  PP    PP  P    PP   A
Sbjct: 81  PGPPPPGPPPP----GPAPPGARPPPGPPPPGPPPPGPAPPDARPPPGPPPPGPPPPGPA 136

Query: 337 QLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
                P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 137 PPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 191

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 127 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 185

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 186 PGPPPPGPPPPG 197

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 106 PPGPPPPGPAPPDARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 164

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 165 PGPPPPGPPPPG 176

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 190 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 248

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 249 PGPPPLGPPPPG 260

 Score = 34.7 bits (78), Expect(2) = 0.038
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 575 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 633

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 634 PGPPPPGPPPPG 645

 Score = 34.7 bits (78), Expect(2) = 2e-05
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 337 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 395

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 396 PGPPPPGPPPPG 407

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 316 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 374

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 375 PGPPPPGPPPPG 386

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 295 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 353

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 354 PGPPPPGPPPPG 365

 Score = 34.7 bits (78), Expect(2) = 8e-05
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 169 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 227

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 228 PGPPPPGPPPPG 239

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 274 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 332

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 333 PGPPPPGPPPPG 344

 Score = 34.7 bits (78), Expect(2) = 1e-05
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 533 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 591

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 592 PGPPPPGPPPPG 603

 Score = 34.7 bits (78), Expect(2) = 1e-05
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 253 PLGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 311

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 312 PGPPPPGPPPPG 323

 Score = 34.7 bits (78), Expect(2) = 6e-05
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 491 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 549

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 550 PGPPPPGPPPPG 561

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 470 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 528

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 529 PGPPPPGPPPPG 540

 Score = 34.7 bits (78), Expect(2) = 8e-05
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 148 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 206

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 207 PGPPPPGPPPPG 218

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 554 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 612

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 613 PGPPPPGPPPPG 624

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 512 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 570

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 571 PGPPPPGPPPPG 582

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 32/114 (28%), Positives = 36/114 (31%), Gaps = 3/114 (2%)
 Frame = -3

Query: 496 GSSPAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAP---TPPKNAAQLRR 326
           G  P  PPPP P   ++ P        PP   G  PP    PP  P    PP   A    
Sbjct: 103 GPPPPGPPPPGPAPPDARPPPGPPPPGPP-PPGPAPPGARPPPGPPPPGPPPPGPAPPGA 161

Query: 325 LPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
            P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 162 RPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 212

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 22/57 (38%), Positives = 23/57 (39%), Gaps = 4/57 (7%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGA 630
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA
Sbjct: 596 PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGA 651

 Score = 34.3 bits (77), Expect(2) = 6e-05
 Identities = 31/86 (36%), Positives = 31/86 (36%), Gaps = 7/86 (8%)
 Frame = -3

Query: 487 PAVPPP-PPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAPTPPKNAAQLR 329
           P  PPP PPPP     PA   AR  P      P   G  PP   RPP  P PP       
Sbjct: 592 PGPPPPGPPPP----GPAPPGARPPPGPPPPGPPPPGPAPPGA-RPPPGP-PPPGPPPPG 645

Query: 328 RLPVNAMGCTGASAMARAAGSPRPPP 251
             P  A    G          PRPPP
Sbjct: 646 PAPPGARPPPGPPPPPPGPSPPRPPP 671

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 232 PPGPPPPGPAPPGARPPPGPPPLGPPPPGP-APPGARPPPGPPPPGPPPPGPAPPGARPP 290

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 291 PGPPPPGPPPPG 302

 Score = 33.9 bits (76), Expect(2) = 1e-05
 Identities = 35/120 (29%), Positives = 38/120 (31%), Gaps = 9/120 (7%)
 Frame = -3

Query: 496 GSSPAVPPPPPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKN 344
           G+ P   PPPP P     PA   AR  P      P   G  PP    PP  P    PP  
Sbjct: 482 GARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 540

Query: 343 AAQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
            A     P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 541 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 597

 Score = 33.9 bits (76), Expect(2) = 8e-05
 Identities = 35/120 (29%), Positives = 38/120 (31%), Gaps = 9/120 (7%)
 Frame = -3

Query: 496 GSSPAVPPPPPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKN 344
           G+ P   PPPP P     PA   AR  P      P   G  PP    PP  P    PP  
Sbjct: 265 GARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 323

Query: 343 AAQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
            A     P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 324 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 380

 Score = 33.9 bits (76), Expect(2) = 1e-04
 Identities = 35/120 (29%), Positives = 38/120 (31%), Gaps = 9/120 (7%)
 Frame = -3

Query: 496 GSSPAVPPPPPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKN 344
           G+ P   PPPP P     PA   AR  P      P   G  PP    PP  P    PP  
Sbjct: 160 GARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 218

Query: 343 AAQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
            A     P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 219 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PLGPPPPGPAPPGARPPPGPPPP 275

 Score = 33.9 bits (76), Expect(2) = 8e-05
 Identities = 32/114 (28%), Positives = 35/114 (30%), Gaps = 3/114 (2%)
 Frame = -3

Query: 496 GSSPAVPPPPPPPCRNSAPARRQARRRPPKDEGCWPPRTERPPAAP---TPPKNAAQLRR 326
           G  P  PPPP P    + P        PP   G  PP    PP  P    PP   A    
Sbjct: 229 GPPPPGPPPPGPAPPGARPPPGPPPLGPP-PPGPAPPGARPPPGPPPPGPPPPGPAPPGA 287

Query: 325 LPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
            P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 288 RPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 338

 Score = 33.9 bits (76), Expect(2) = 1e-04
 Identities = 25/72 (34%), Positives = 26/72 (35%), Gaps = 4/72 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAPAKPPSSCRLRRP*CRPASAPPLGPPDAGCP----APGGAAMC 621
           P G P   P PP     P  PP       P   P + PP GPP  G P    AP GA   
Sbjct: 85  PPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPDARPPPGPPPPGPPPPGPAPPGARPP 143

Query: 620 TVAAAARPHAPG 585
                  P  PG
Sbjct: 144 PGPPPPGPPPPG 155

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 33/114 (28%), Positives = 35/114 (29%), Gaps = 9/114 (7%)
 Frame = -3

Query: 478 PPPPPPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKNAAQLRR 326
           P PPPP      PA   AR  P      P   G  PP    PP  P    PP   A    
Sbjct: 123 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 182

Query: 325 LPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
            P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 183 RPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 233

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 36/119 (30%), Positives = 38/119 (31%), Gaps = 11/119 (9%)
 Frame = -3

Query: 487 PAVPPPP--PPPCRNSAPARRQARRRP------PKDEGCWPPRTERPPAAP---TPPKNA 341
           PA PPPP  P P     PA   AR  P      P   G  PP    PP  P    PP   
Sbjct: 444 PAGPPPPGPPSP----GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 499

Query: 340 AQLRRLPVNAMGCTGASAMARAAGSPRPPPSDDARRPTNACVGFQSPPSSRAVAAPGSP 164
           A     P       G      A    RPPP      P        +PP +R    P  P
Sbjct: 500 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPP---PPGPPPPGPAPPGARPPPGPPPP 555

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 26/66 (39%), Positives = 27/66 (40%), Gaps = 2/66 (3%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAP--AKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMCTV 615
           P G P  PPGPP    AP  A+PP       P   P  APP   P  G P PG       
Sbjct: 591 PPGPP--PPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPA 647

Query: 614 AAAARP 597
              ARP
Sbjct: 648 PPGARP 653

 Score = 32.3 bits (72), Expect = 9.2
 Identities = 23/55 (41%), Positives = 24/55 (42%), Gaps = 2/55 (3%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLA--APAKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGA 630
           P G P  PPGP    A   P  PP       P   P + PP GPP  G P PG A
Sbjct: 211 PPGPP--PPGPAPPGARPPPGPPPPGPPPPGP-APPGARPPPGPPPLGPPPPGPA 262

 Score = 31.2 bits (69), Expect(2) = 4e-04
 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 13/70 (18%)
 Frame = -2

Query: 767 PPGPPSTLAAPAKP-PSSCRLRRP*CRPASAPPLG------------PPDAGCPAPGGAA 627
           PPGPP     P  P P   R   P   PA  P  G            PP AG P PG  +
Sbjct: 395 PPGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPS 454

Query: 626 MCTVAAAARP 597
                  ARP
Sbjct: 455 PGPAPPGARP 464

 Score = 24.6 bits (52), Expect(2) = 0.038
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -3

Query: 496 GSSPAVPPPPPPP 458
           G SP  PPP PPP
Sbjct: 663 GPSPPRPPPGPPP 675

 Score = 23.9 bits (50), Expect(2) = 0.023
 Identities = 20/68 (29%), Positives = 23/68 (33%), Gaps = 4/68 (5%)
 Frame = -2

Query: 788 PTGFPSVPPGPPSTLAAP----AKPPSSCRLRRP*CRPASAPPLGPPDAGCPAPGGAAMC 621
           P G P  PP P  +         +PP     + P      APP   P  G P PG     
Sbjct: 39  PGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGP------APPGAEPPPGPPPPGPPPPG 92

Query: 620 TVAAAARP 597
                ARP
Sbjct: 93  PAPPGARP 100



EST assemble image


clone accession position
1 LCL086e07_r AV630934 1 478
2 CL01a09_r AV393317 13 164
3 HCL030g12_r AV641271 24 503
4 CM025g08_r AV388124 386 809




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research