KCC000003A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000003A_C01 KCC000003A_c01
TTGTGATTGGTTTTATTGTTGGGTGGCGAGACGAGGGGCCGCAGCCGCCCATAGCGAAGT
GCGTTTCTTGTGCCTACACCTGGGTTGATCGCACCGTGCCGTTGACTAGAATTACGCTCT
TATAGCATTTGTGGGAGTCTCCACATTAGCGACAGTCAACAGAGGCGCCTCCGGGATGCT
CGCGTCGCAGAAGCTCGCCCACCGGGCCGGACTGGAGGAGAGGCGTGCTTGCATCGGTCC
ACATGTGAGCCGAAGCCAACAGCGCGTGGTTGGGCGTGTCGCGAAAGCTTGCCCCGCACG
TCTCCCGGGGCCTCCGGCGAATGCGATTCGCCAGACTTCCGTCGTCCGCAAGCTGCTGCG
CGTTGCAGCTGCAGCAAGCACTGTGTCTGGAGCTGCTGCGGAGAAGCCCACCGGCGTGAG
GGGGGCGCACTGGCAGGTGCACAAATTCGGCGGCACTTGCATGGCCAGCGCCGACAGGAT
TCGCGCGACTGCCGAGCTGATGGCATCGACTGTGGGCCCGGATTCCTCCACCTGCGTCGT
CGTCAGTGCCATGGGGAACCACCCGACCAGCCCAATTAAGGTCACGGACCTCATCCTCAA
CATGATCAAGAAGGCGTCGCGGCAGGACGCGGCCTTCCTGGTTGATCTGGCGGCACTGCA
GGAGAAGCACGTGGACACAGCGAAGCTGCTGCTGGGCCAGTCGCCCGAGCTGACCCAGTT
CGTGTCCAGCCTCATGGATGATATCACCAACCTGAAGGCCATGCTTCAGGCCATGAGCAT
TGCCGGCATGTCCACGGACGCCTTCAGCGACTTCGTGGTGGGCCACGGCGAGCTGTGGAG
CGGCCGCCTGTTCGCGCTGTGCTGCAAGCAGCTGGGTGCGGACGTGGAGTTCATGGACAC
GCGCGACGTGCTGGTGGTGACGCCCACCAGCGACGGCGCCAGTGTGGACCTGGACGAGGC
GGTCAGCAACGGCCGCATGGACGCCTGGTTCAAGGCCAAGGGGAACAAGAAGCTGATTGT
GGCCACCGGCTTCATCGCGCGCAGCCGCGAGGGCACCGCCACCACCCTGAAGCGCAACGG
CTCGGACTTCTCCGCCACCATCATGGGCGCGCTGCTGCGCTGCCGCCACATCACCATCTG
GACGGACGTGGACGGCGTGTACTCGGCGGACCCGCGCAAGGTGCCCGAGGCCGTGTGCCT
GCCCTCCATGACCTACCACGAGGCCTGGGAGCTGAGCTACTTTGGCGCCAACGTGCTGCA
CCCGCGCACCACCCTGCCCGCCATGAAGTACCACATCCCCATCACCATCCGCAACTTCTT
CAACCAGTCCGCGCCGGGCACGCGCATCAGCGACGTGGCCTCGGACGCCGAGGTGTACGG
CGGCAAGAACACCATCAAGGGGTTCGCCACCATTGACAACGTGACGCTGATCAACGTGGA
GGGCACGGGCATGGTGGGCGTGCCCGGCATCGCCAGCCGCATC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000003A_C01 KCC000003A_c01
         (1483 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_193706.1| aspartate kinase/homoserine dehydrogenase (ak-h...   363  4e-99
dbj|BAC43372.1| putative aspartate kinase-homoserine dehydrogena...   355  2e-96
ref|NP_174408.1| aspartate kinase/homoserine dehydrogenase (ak-h...   355  2e-96
gb|AAF24602.1|AC007654_18 T19E23.1 [Arabidopsis thaliana]             355  2e-96
pir||S46497 aspartate kinase (EC 2.7.2.4) / homoserine dehydroge...   353  6e-96

>ref|NP_193706.1| aspartate kinase/homoserine dehydrogenase (ak-hsdh) bifunctional
            enzyme, putative [Arabidopsis thaliana]
            gi|7434564|pir||T04752 aspartate kinase (EC 2.7.2.4) /
            homoserine dehydrogenase (EC 1.1.1.3) T16H5.70 -
            Arabidopsis thaliana gi|3250680|emb|CAA19688.1| aspartate
            kinase-homoserine dehydrogenase-like protein [Arabidopsis
            thaliana] gi|7268767|emb|CAB78973.1| aspartate
            kinase-homoserine dehydrogenase-like protein [Arabidopsis
            thaliana]
          Length = 916

 Score =  363 bits (932), Expect = 4e-99
 Identities = 200/378 (52%), Positives = 259/378 (67%), Gaps = 4/378 (1%)
 Frame = +2

Query: 362  VAAAASTVSGAAA----EKPTGVRGAHWQVHKFGGTCMASADRIRATAELMASTVGPDSS 529
            ++A A+TVSG +     ++    +G  W VHKFGGTC+ ++ RIR  AE++ +       
Sbjct: 62   LSATATTVSGVSTVNLVDQVQIPKGEMWSVHKFGGTCVGNSQRIRNVAEVIIND--NSER 119

Query: 530  TCVVVSAMGNHPTSPIKVTDLILNMIKKASRQDAAFLVDLAALQEKHVDTAKLLLGQSPE 709
              VVVSAM        KVTD++ ++I+KA  +D ++L  L A+ EKH  TA+ LL    +
Sbjct: 120  KLVVVSAMS-------KVTDMMYDLIRKAQSRDDSYLSALEAVLEKHRLTARDLL-DGDD 171

Query: 710  LTQFVSSLMDDITNLKAMLQAMSIAGMSTDAFSDFVVGHGELWSGRLFALCCKQLGADVE 889
            L  F+S L +DI+NLKAML+A+ IAG ++++FSDFV GHGELWS ++ +   ++ G + +
Sbjct: 172  LASFLSHLHNDISNLKAMLRAIYIAGHASESFSDFVAGHGELWSAQMLSYVVRKTGLECK 231

Query: 890  FMDTRDVLVVTPTSDGASVDLDEAVSNGRMDAWFKAKGNKKLIVATGFIARSREGTATTL 1069
            +MDTRDVL+V PTS    VD D   S  R+D WF    +K +I+ATGFIA + +   TTL
Sbjct: 232  WMDTRDVLIVNPTSSN-QVDPDFGESEKRLDKWFSLNPSK-IIIATGFIASTPQNIPTTL 289

Query: 1070 KRNGSDFSATIMGALLRCRHITIWTDVDGVYSADPRKVPEAVCLPSMTYHEAWELSYFGA 1249
            KR+GSDFSA IMGALLR R +TIWTDVDGVYSADPRKV EAV L +++Y EAWE+SYFGA
Sbjct: 290  KRDGSDFSAAIMGALLRARQVTIWTDVDGVYSADPRKVNEAVILQTLSYQEAWEMSYFGA 349

Query: 1250 NVLHPRTTLPAMKYHIPITIRNFFNQSAPGTRISDVASDAEVYGGKNTIKGFATIDNVTL 1429
            NVLHPRT +P M+Y+IPI IRN FN SAPGT I     D         +KGFATIDN+ L
Sbjct: 350  NVLHPRTIIPVMRYNIPIVIRNIFNLSAPGTIICQPPEDDYDLKLTTPVKGFATIDNLAL 409

Query: 1430 INVEGTGMVGVPGIASRI 1483
            INVEGTGM GVPG AS I
Sbjct: 410  INVEGTGMAGVPGTASDI 427

>dbj|BAC43372.1| putative aspartate kinase-homoserine dehydrogenase [Arabidopsis
            thaliana]
          Length = 911

 Score =  355 bits (910), Expect = 2e-96
 Identities = 195/356 (54%), Positives = 244/356 (67%), Gaps = 1/356 (0%)
 Frame = +2

Query: 419  RGAHWQVHKFGGTCMASADRIRATAELMASTVGPDSST-CVVVSAMGNHPTSPIKVTDLI 595
            +G  W VHKFGGTC+ +++RI+  A   A  V  DS    VVVSAM        KVTD++
Sbjct: 80   KGDSWAVHKFGGTCVGNSERIKDVA---AVVVKDDSERKLVVVSAMS-------KVTDMM 129

Query: 596  LNMIKKASRQDAAFLVDLAALQEKHVDTAKLLLGQSPELTQFVSSLMDDITNLKAMLQAM 775
             ++I +A  +D ++L  L+ + EKH  TA  LL    EL+ F++ L DDI NLKAML+A+
Sbjct: 130  YDLIHRAESRDDSYLSALSGVLEKHRATAVDLL-DGDELSSFLARLNDDINNLKAMLRAI 188

Query: 776  SIAGMSTDAFSDFVVGHGELWSGRLFALCCKQLGADVEFMDTRDVLVVTPTSDGASVDLD 955
             IAG +T++FSDFVVGHGELWS ++ A   ++ G D  +MD RDVLVV PTS    VD D
Sbjct: 189  YIAGHATESFSDFVVGHGELWSAQMLAAVVRKSGLDCTWMDARDVLVVIPTSSN-QVDPD 247

Query: 956  EAVSNGRMDAWFKAKGNKKLIVATGFIARSREGTATTLKRNGSDFSATIMGALLRCRHIT 1135
               S  R++ WF  + + K+I+ATGFIA + +   TTLKR+GSDFSA IM AL R   +T
Sbjct: 248  FVESEKRLEKWF-TQNSAKIIIATGFIASTPQNIPTTLKRDGSDFSAAIMSALFRSHQLT 306

Query: 1136 IWTDVDGVYSADPRKVPEAVCLPSMTYHEAWELSYFGANVLHPRTTLPAMKYHIPITIRN 1315
            IWTDVDGVYSADPRKV EAV L +++Y EAWE+SYFGANVLHPRT +P MKY IPI IRN
Sbjct: 307  IWTDVDGVYSADPRKVSEAVVLKTLSYQEAWEMSYFGANVLHPRTIIPVMKYDIPIVIRN 366

Query: 1316 FFNQSAPGTRISDVASDAEVYGGKNTIKGFATIDNVTLINVEGTGMVGVPGIASRI 1483
             FN SAPGT I     D + +     +KGFATIDN+ L+NVEGTGM GVPG AS I
Sbjct: 367  IFNLSAPGTMICRQIDDEDGFKLDAPVKGFATIDNLALVNVEGTGMAGVPGTASAI 422

>ref|NP_174408.1| aspartate kinase/homoserine dehydrogenase (ak-hsdh) bifunctional
            enzyme [Arabidopsis thaliana] gi|25288158|pir||E86438
            hypothetical protein F28K20.19 - Arabidopsis thaliana
            gi|4512620|gb|AAD21689.1| Identical to gb|X71364 gene for
            aspartate kinase homoserine dehydrogenase from
            Arabidopsis thaliana
          Length = 911

 Score =  355 bits (910), Expect = 2e-96
 Identities = 195/356 (54%), Positives = 244/356 (67%), Gaps = 1/356 (0%)
 Frame = +2

Query: 419  RGAHWQVHKFGGTCMASADRIRATAELMASTVGPDSST-CVVVSAMGNHPTSPIKVTDLI 595
            +G  W VHKFGGTC+ +++RI+  A   A  V  DS    VVVSAM        KVTD++
Sbjct: 80   KGDSWAVHKFGGTCVGNSERIKDVA---AVVVKDDSERKLVVVSAMS-------KVTDMM 129

Query: 596  LNMIKKASRQDAAFLVDLAALQEKHVDTAKLLLGQSPELTQFVSSLMDDITNLKAMLQAM 775
             ++I +A  +D ++L  L+ + EKH  TA  LL    EL+ F++ L DDI NLKAML+A+
Sbjct: 130  YDLIHRAESRDDSYLSALSGVLEKHRATAVDLL-DGDELSSFLARLNDDINNLKAMLRAI 188

Query: 776  SIAGMSTDAFSDFVVGHGELWSGRLFALCCKQLGADVEFMDTRDVLVVTPTSDGASVDLD 955
             IAG +T++FSDFVVGHGELWS ++ A   ++ G D  +MD RDVLVV PTS    VD D
Sbjct: 189  YIAGHATESFSDFVVGHGELWSAQMLAAVVRKSGLDCTWMDARDVLVVIPTSSN-QVDPD 247

Query: 956  EAVSNGRMDAWFKAKGNKKLIVATGFIARSREGTATTLKRNGSDFSATIMGALLRCRHIT 1135
               S  R++ WF  + + K+I+ATGFIA + +   TTLKR+GSDFSA IM AL R   +T
Sbjct: 248  FVESEKRLEKWF-TQNSAKIIIATGFIASTPQNIPTTLKRDGSDFSAAIMSALFRSHQLT 306

Query: 1136 IWTDVDGVYSADPRKVPEAVCLPSMTYHEAWELSYFGANVLHPRTTLPAMKYHIPITIRN 1315
            IWTDVDGVYSADPRKV EAV L +++Y EAWE+SYFGANVLHPRT +P MKY IPI IRN
Sbjct: 307  IWTDVDGVYSADPRKVSEAVVLKTLSYQEAWEMSYFGANVLHPRTIIPVMKYDIPIVIRN 366

Query: 1316 FFNQSAPGTRISDVASDAEVYGGKNTIKGFATIDNVTLINVEGTGMVGVPGIASRI 1483
             FN SAPGT I     D + +     +KGFATIDN+ L+NVEGTGM GVPG AS I
Sbjct: 367  IFNLSAPGTMICRQIDDEDGFKLDAPVKGFATIDNLALVNVEGTGMAGVPGTASAI 422

>gb|AAF24602.1|AC007654_18 T19E23.1 [Arabidopsis thaliana]
          Length = 735

 Score =  355 bits (910), Expect = 2e-96
 Identities = 195/356 (54%), Positives = 244/356 (67%), Gaps = 1/356 (0%)
 Frame = +2

Query: 419  RGAHWQVHKFGGTCMASADRIRATAELMASTVGPDSST-CVVVSAMGNHPTSPIKVTDLI 595
            +G  W VHKFGGTC+ +++RI+  A   A  V  DS    VVVSAM        KVTD++
Sbjct: 80   KGDSWAVHKFGGTCVGNSERIKDVA---AVVVKDDSERKLVVVSAMS-------KVTDMM 129

Query: 596  LNMIKKASRQDAAFLVDLAALQEKHVDTAKLLLGQSPELTQFVSSLMDDITNLKAMLQAM 775
             ++I +A  +D ++L  L+ + EKH  TA  LL    EL+ F++ L DDI NLKAML+A+
Sbjct: 130  YDLIHRAESRDDSYLSALSGVLEKHRATAVDLL-DGDELSSFLARLNDDINNLKAMLRAI 188

Query: 776  SIAGMSTDAFSDFVVGHGELWSGRLFALCCKQLGADVEFMDTRDVLVVTPTSDGASVDLD 955
             IAG +T++FSDFVVGHGELWS ++ A   ++ G D  +MD RDVLVV PTS    VD D
Sbjct: 189  YIAGHATESFSDFVVGHGELWSAQMLAAVVRKSGLDCTWMDARDVLVVIPTSSN-QVDPD 247

Query: 956  EAVSNGRMDAWFKAKGNKKLIVATGFIARSREGTATTLKRNGSDFSATIMGALLRCRHIT 1135
               S  R++ WF  + + K+I+ATGFIA + +   TTLKR+GSDFSA IM AL R   +T
Sbjct: 248  FVESEKRLEKWF-TQNSAKIIIATGFIASTPQNIPTTLKRDGSDFSAAIMSALFRSHQLT 306

Query: 1136 IWTDVDGVYSADPRKVPEAVCLPSMTYHEAWELSYFGANVLHPRTTLPAMKYHIPITIRN 1315
            IWTDVDGVYSADPRKV EAV L +++Y EAWE+SYFGANVLHPRT +P MKY IPI IRN
Sbjct: 307  IWTDVDGVYSADPRKVSEAVVLKTLSYQEAWEMSYFGANVLHPRTIIPVMKYDIPIVIRN 366

Query: 1316 FFNQSAPGTRISDVASDAEVYGGKNTIKGFATIDNVTLINVEGTGMVGVPGIASRI 1483
             FN SAPGT I     D + +     +KGFATIDN+ L+NVEGTGM GVPG AS I
Sbjct: 367  IFNLSAPGTMICRQIDDEDGFKLDAPVKGFATIDNLALVNVEGTGMAGVPGTASAI 422

>pir||S46497 aspartate kinase (EC 2.7.2.4) / homoserine dehydrogenase (EC 1.1.1.3)
            precursor - Arabidopsis thaliana
          Length = 911

 Score =  353 bits (905), Expect = 6e-96
 Identities = 194/356 (54%), Positives = 243/356 (67%), Gaps = 1/356 (0%)
 Frame = +2

Query: 419  RGAHWQVHKFGGTCMASADRIRATAELMASTVGPDSST-CVVVSAMGNHPTSPIKVTDLI 595
            +G  W VHKFGGTC+ +++RI+  A   A  V  DS    VVVSAM        KVTD++
Sbjct: 80   KGDSWAVHKFGGTCVGNSERIKDVA---AVVVKDDSERKLVVVSAMS-------KVTDMM 129

Query: 596  LNMIKKASRQDAAFLVDLAALQEKHVDTAKLLLGQSPELTQFVSSLMDDITNLKAMLQAM 775
             ++I +A  +D ++L  L+ + EKH  TA  LL    EL+ F++ L DDI NLKAML+A+
Sbjct: 130  YDLIHRAESRDDSYLSALSGVLEKHRATAVDLL-DGDELSSFLARLNDDINNLKAMLRAI 188

Query: 776  SIAGMSTDAFSDFVVGHGELWSGRLFALCCKQLGADVEFMDTRDVLVVTPTSDGASVDLD 955
             IAG +T++FSDFVVGHGELWS ++ A   ++ G D  +MD RDVLVV PTS    VD D
Sbjct: 189  YIAGHATESFSDFVVGHGELWSAQMLAAVVRKSGLDCTWMDARDVLVVIPTSSN-QVDPD 247

Query: 956  EAVSNGRMDAWFKAKGNKKLIVATGFIARSREGTATTLKRNGSDFSATIMGALLRCRHIT 1135
               S  R++ WF  + + K+I+ATGFIA + +   TTLKR+GSDFSA IM AL R   +T
Sbjct: 248  FVESEKRLEKWF-TQNSAKIIIATGFIASTPQNIPTTLKRDGSDFSAAIMSALFRSHQLT 306

Query: 1136 IWTDVDGVYSADPRKVPEAVCLPSMTYHEAWELSYFGANVLHPRTTLPAMKYHIPITIRN 1315
            IWTDVDGVYSADPRKV EAV L +++Y EAWE+SYFGANVLHPRT +P MKY IPI IRN
Sbjct: 307  IWTDVDGVYSADPRKVSEAVVLKTLSYQEAWEMSYFGANVLHPRTIIPVMKYDIPIVIRN 366

Query: 1316 FFNQSAPGTRISDVASDAEVYGGKNTIKGFATIDNVTLINVEGTGMVGVPGIASRI 1483
             FN SAPGT I     D + +     +KGFATIDN+ L+NVEG GM GVPG AS I
Sbjct: 367  IFNLSAPGTMICRQIDDEDGFKLDAPVKGFATIDNLALVNVEGAGMAGVPGTASAI 422



EST assemble image


clone accession position
1 MXL038b12_r BP095217 1 387
2 LCL074d08_r AV630153 24 510
3 MXL024g04_r BP094546 24 358
4 MXL024g01_r BP094544 26 311
5 HCL032a12_r AV641351 36 427
6 CL70f02_r AV396845 38 571
7 LCL067d06_r AV629845 38 533
8 LCL054d12_r AV629210 38 528
9 MXL009g07_r BP093535 38 411
10 MXL072c03_r BP097236 38 503
11 CL04b11_r AV393375 38 568
12 CL41a07_r AV395424 38 407
13 HCL043f05_r AV641998 38 571
14 MXL009h08_r BP093545 38 570
15 HCL030a10_r AV641222 41 419
16 MXL031c06_r BP094860 46 346
17 CL62f08_r AV396409 49 579
18 CL51e11_r AV395903 50 558
19 MXL089e12_r BP098220 51 502
20 MXL030c06_r BP094815 51 372
21 HCL092b09_r AV644683 51 509
22 MXL044b07_r BP095582 55 435
23 MXL003h05_r BP093132 61 405
24 MXL087a03_r BP098098 62 570
25 LCL096d10_r AV631579 76 311
26 CL02a08_r AV397608 112 670
27 CL01a08_r AV393315 175 633
28 HCL036f01_r AV641575 230 704
29 HCL070b06_r AV643465 278 759
30 CL29g11_r AV394659 303 780
31 HCL005f11_r AV639828 353 778
32 LCL051e09_r AV629075 416 925
33 HCL045c10_r AV642086 506 975
34 CL05a08_r AV393595 509 958
35 LCL091b03_r AV631265 753 1030
36 LCL066d02_r AV629798 912 1369
37 LCL092b06_r AV631332 1245 1506




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research