KCC000002A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000002A_C02 KCC000002A_c02
ctcgcccatggatgcataaacatccaatagtgtagcatgtagcgctgtatcggcggtagg
cgatgctccaggtctcactcCAGCCATGGCACTTGACCAATTTCATGAAACGCCCGTATA
AATAGGCCCCGCCCCCGCACCGCTTTCTCATCTCATGAAGTCTATTACCATTAAAGCAAC
CAATACAACACAGCACCTACTCGCTACGCAAGCACTACTGTCGTCCCTGCCTCTGAGGGA
CTTGTTCTATGTTAACACCCTTAAGCTATCCTATCATCAACACCGTCTCGGTCAAGTCTG
CCAGCGCTTCACGCCATGAGCCCAGATGCTGCTGGAGAAGACAATGCGCCGGGGCCTCGC
CACGGTCTCGGCCGCGGCGAGCTCCGCTGTTGGCCGGCCCATCCCCATGGGCTGTTAGGC
CGTCTTTGACGCTTGGAAACGTTCGTGGCATGCGCCTGGGTGTTCCGGAGCTGGCCTTCA
GGCAAGTCGCCGATGCGCTCGAAATGGCCGCTGCCAGCGCGGCCGCTGAGGCCCTCCCGG
TGGCACCCAGCCACAGCTGCGCTGCTGACCCCGACAAGCACCCGCACCTGCCCGACCCCC
GCCCGAAGCCGGCCGTGGACGCGGGCATCAACGTCCAGAAGTATGTGCAGGACAACTACA
CCGCTTACGCCGGCAACTCGTCCTTCCTGGGCTGGCCCCACTGACAACACCAAGAAGCTG
TGGAGCGAGCTGGAGAAGATGATTGCCACCGAGATCGAGAAGGGCGTGATGGACGTGGAC
CCCTCCAAGCCCTCCACCATCACCGCCTTCCCGCCCGGGTACATCGACAAGGACCTGGAG
ACGGTGGTGGGGCTGCAGACCGACGCGCCGCTCAAGCGCGCCATCAAGCCCCTGGGCGGC
GTCAACATGGTCAAGGCGGCGCTGGAGTCGTACGGCTACACGCCCGACCCCGAGGGTGGC
CCGCCTGTACAGCACGGTGCGCAAGACGCACAACAGCGGCGTGTTTGACGCCTACACGGA
CGAGATGCGTGCCGCGCGCAAGAGCGGCATCCTGTCCGGCCTGCCCGACGGCTACGGCCG
CGGCCGCATCATTGGCGACTACCGCCGCGTGGCGCTGTACGGCGTGGACGCGCTGATCAA
GGCCAAGAAGACCGACCTGAAGCACAACCTGCTGGGCGTGATGGACGAGGAGAAGATCCG
CCTGCGCGAGGAGGTGAACGAGCAGATCCGCGCGCTCAGCGAGCTCAAGGAGATGGGCGC
CGCCTACGGCTTCGACCTGAGCCGCCCCGCCGCCAACTCGCGCGAGGCGGTGCAGTGGCT
GTACTTCGGCTACCTGGGCGCCGTCAAGGAGCAGGACGGCGCCGCCATGAGCCTGGGCCG
CATCGACGCCTTCCTGGACACCTACTTTGAGCGCGACCTCAAGGCCGGCACCATCACCGA
GGCCGAGGTGCAGGAGCTGATCGACCACTTCGTCATGAAGCTGCGCATCGTGCGCCAGCT
GCGCACGCCCGAGTACAACGCGCTGTTTGCCGGCGACCCCACCTGGGTCACCTGCGTGCT
GGGCGGCACTGACGCCAGCGGCAAGGCCATGGTCACCAAGACCAGCTTCCGCCTGCTCAA
CACCCTGTACAACCTGGGTCCCGCGCCCGAGCCCAACCTGACGGTGCTGTGGAACGACAA
CCTGCCCGCGCCCTTCAAGGAGTTCTGCGCCAAGGTATCGCTGGACACCAGCTCCATCCA
GTACGAGTCCGACAACCTCATGAGCAAGCTGTTTGGCTCCGACTACTCCATCGCCTGCTG
CGTGTCGGCCATGCGCGTGGGCAAGGACATGCAGTATTTTGGCTGCGCGCGCCAACCTGC
CCAAGCTGCTGCTGTACACGCTCAACGGCGGCCGCGACGAGGTGTCGGGCGACCAGGTGG
GGCCCAAGTTCTGCGCCGGTGCGCAGCCCCACCGCGCCGTTGGACTATGAGGAGTGTCAA
GGCCAAGATCGAGGACGGCATGGAGTGGCTGGCCTCCATGTACGCGAACACCATGAACAT
CATCCACTACATGCACGACAAGTACGACTACGAGCGGCTGCAGATGTGCGCTGCACGACA
CGCACGTGCGGCGCCTGCTGGCGTTCGGCATCAGCGGCCTGTCCGTGGTGACCGACTCGC
TGTCGGCCATCAAGTACGCCCAGGTGACGCCCGTGATTGACGAGCGCGGCCTGATGACGG
ACTTCAAGGTGGAGGGCAGCTTCCCCAAGTACGGCAACGACGATGACCGCGTGGACGAGA
TCGCCGAGTGGGTGGTGTCCACCTTCTCCAGCAAGCTGGCCAAGCAGCACACCTACCGCA
ACTCGGTGCCCACGCTGTCGGTGCTGACCATCACCTCCAACGTGGTGTACGGCAAGAAGA
CCGGCTCCACCCCCGACGGCCGCAAGAAGGGCGAGCCCTTCGCGCCCGGCGCCAACCCGC
TGCACGGCCGCGACGCCCACGGCGCTCTGGCCTCGCTCAACTCGGTGGCCAAGCTGCCCT
ACACCATGTGCCTGGACGGCATCTCCAACACCTTCTCGCTCATCCCCCAGGTGCTGGGCA
GGGGCGGCGAGCACGAGCGCGCCACCAACCTGGCCTCCATCCTGGACGGCTACTTTGCCA
ACGGCGGCCACCACATCAACGTCAACGTGCTCAACCGCTCCATGCTCATGGACGCCGTGG
AGCACCCCGAGAAGTACCCCAACCTCACCATCCGCGTGTCCGGGTACGCTGTGCACTTCG
CGCGCCTCACGCGCGAGCAGCAGCTGGAGGTGATCGCGCGCACCTTCCACGACACCATGT
AAGGAAGTGGCGGCCGGGGCGAGAGCAAGGAGGCGAGCCAGTGACACGGTCTGCTGTGCT
ATAATCTGACGGTTGGCGCAGCGTGCGCAAGGAATGGGGGCAGCATCCATGCTAGGCCGG
AGCTGCAAGGCGATGGTCTGGCCTTGTCTAAGCTTACGCATTGGCAAGACGTAGAAACAT
GCGTGGGCGGCTTTACATGCCAAGGAACGAAGCATCAGAAGGAAGGCCGCATGGAGGCCA
CGTGCGAGGGTTAGTCGGATATTGCCGTGCCCGCCCCGTACTGCGTCGTTGTAGCGGGCG
GACTTAAAACGGGCGATACAGCAGTTACATCCGTGTGTGATGAACCACCGTACCATTTAT
CATTTTAGAGTGTGTGCAGAGTGCAAGCTTATGAAGAATAATACTGGGTAGGGGCGTTGT
GGTTCAGGGGTGATTGCGTGGTACGCGCCCAATCGGCGCTGTGTGATTGAGAGGACGTGA
TCCTGACACAGGGCATATTGATAAGTCAATGACAGCGAGGCGGCCTGGTTAGGGTGCCTT
CTGCCTTGGATAAGCCCTAACTGTGGTTCTTTCGCTGTGTTAGGGTTAGGTGTGACTTGC
ATGGTGCATTGAGCCGGGTGAGCGAGCGTGTGCAAACTTCGTACGGCCAGTGAGCCAGAG
ATGCGTCGAGGCGATGAGCTACTCAAGCAATCGTGTAACTCGATTCTCGCT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000002A_C02 KCC000002A_c02
         (3531 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_654440.1| PFL, Pyruvate formate lyase [Bacillus anthracis...   455  0.0
ref|NP_830328.1| Formate acetyltransferase [Bacillus cereus ATCC...   454  0.0
ref|NP_763769.1| formate acetyltransferase [Staphylococcus epide...   434  0.0
ref|NP_370750.1| formate acetyltransferase [Staphylococcus aureu...   434  0.0
sp|Q46266|PFL_CLOPA FORMATE ACETYLTRANSFERASE (PYRUVATE FORMATE-...   434  0.0

>ref|NP_654440.1| PFL, Pyruvate formate lyase [Bacillus anthracis A2012]
            gi|30260668|ref|NP_843045.1| formate acetyltransferase
            [Bacillus anthracis str. Ames] gi|30254036|gb|AAP24531.1|
            formate acetyltransferase [Bacillus anthracis str. Ames]
          Length = 749

 Score =  455 bits (1171), Expect(4) = 0.0
 Identities = 230/385 (59%), Positives = 285/385 (73%), Gaps = 8/385 (2%)
 Frame = +2

Query: 956  VARLYSTVRKTHNSGVFDAYTDEMRAARKSGILSGLPDGYGRGRIIGDYRRVALYGVDAL 1135
            ++R++   RKTHN GVFDAYT EMRAARKSG+++GLPD YGRGRIIGDYRRVALYGVD L
Sbjct: 134  LSRIFRDWRKTHNQGVFDAYTPEMRAARKSGVITGLPDAYGRGRIIGDYRRVALYGVDHL 193

Query: 1136 IKAKKTDLKHNLLG-VMDEEKIRLREEVNEQIRALSELKEMGAAYGFDLSRPAANSREAV 1312
            I+AKK DL  NL G VM E+ +RLREE++EQIRAL ELK+M A++GFD+S+PA N++EA 
Sbjct: 194  IEAKKADL--NLTGGVMSEDTMRLREELSEQIRALQELKQMAASHGFDISKPATNAQEAF 251

Query: 1313 QWLYFGYLGAVKEQDGAAMSLGRIDAFLDTYFERDLKAGTITEAEVQELIDHFVMKLRIV 1492
            QWLYF YL A+KEQ+GAAMSLGR   FLD Y ERDL  GT+TE +VQE++DHF+MKLR+V
Sbjct: 252  QWLYFAYLAAIKEQNGAAMSLGRTSTFLDIYIERDLANGTLTEEDVQEIVDHFIMKLRLV 311

Query: 1493 RQLRTPEYNALFAGDPTWVTCVLGGTDASGKAMVTKTSFRLLNTLYNLGPAPEPNLTVLW 1672
            +  RTP+YN LF+GDPTWVT  +GG    G+ +VTK SFR L+TL NLGPAPEPNLTVLW
Sbjct: 312  KFARTPDYNELFSGDPTWVTESIGGMALDGRPLVTKNSFRFLHTLDNLGPAPEPNLTVLW 371

Query: 1673 NDNLPAPFKEFCAKVSLDTSSIQYESDNLMSKLFGSDYSIACCVSAMRVGKDMQYFGCAR 1852
            +  LP  FK +CAK+S+ TS+IQYE+D++M   +G DY IACCVSAMR+GK MQ+FG AR
Sbjct: 372  SKQLPQNFKNYCAKMSIKTSAIQYENDDIMRADYGDDYGIACCVSAMRIGKQMQFFG-AR 430

Query: 1853 QPAQAAAVHAQRRPRRGVGRPGGAQVLRRCAAPPRRWTMRS-------VKAKIEDGMEWL 2011
                 A ++A           GG     +    P    + S       V  K +  MEWL
Sbjct: 431  ANLAKALLYAIN---------GGKDEKSKAQVGPEYAPITSEVLDYEEVMHKFDMTMEWL 481

Query: 2012 ASMYANTMNIIHYMHDKYDYERLQM 2086
            A +Y NT+N+IHYMHDKY YER++M
Sbjct: 482  AGLYLNTLNVIHYMHDKYSYERIEM 506

 Score =  341 bits (875), Expect(4) = 0.0
 Identities = 169/244 (69%), Positives = 199/244 (81%)
 Frame = +3

Query: 2088 ALHDTHVRRLLAFGISGLSVVTDSLSAIKYAQVTPVIDERGLMTDFKVEGSFPKYGNDDD 2267
            ALHDT+V R +A GI+GLSVV DSLSAIKYA+V P+ DE G+  DF++EG FPKYGN+DD
Sbjct: 507  ALHDTNVLRTMATGIAGLSVVADSLSAIKYAKVKPIRDENGIAVDFEIEGDFPKYGNNDD 566

Query: 2268 RVDEIAEWVVSTFSSKLAKQHTYRNSVPTLSVLTITSNVVYGKKTGSTPDGRKKGEPFAP 2447
            RVDEIA  +V TF +KL K  TYRNSV T+S+LTITSNVVYGKKTG+TPDGR+ GEPFAP
Sbjct: 567  RVDEIAVNLVKTFMNKLRKHKTYRNSVHTMSILTITSNVVYGKKTGNTPDGRRTGEPFAP 626

Query: 2448 GANPLHGRDAHGALASLNSVAKLPYTMCLDGISNTFSLIPQVLGRGGEHERATNLASILD 2627
            GANP+HGRD  GALASL SVAKLPY    DGISNTFS+IP+ LG+  E  +  NL S+LD
Sbjct: 627  GANPMHGRDTKGALASLLSVAKLPYEDAQDGISNTFSIIPKALGKEDE-VQVRNLVSMLD 685

Query: 2628 GYFANGGHHINVNVLNRSMLMDAVEHPEKYPNLTIRVSGYAVHFARLTREQQLEVIARTF 2807
            GY    GHH+N+NV NR  LMDA+EHPEKYP LTIRVSGYAV+F +LTREQQ++VI RT 
Sbjct: 686  GYAVKEGHHLNINVFNRETLMDAMEHPEKYPQLTIRVSGYAVNFIKLTREQQIDVINRTM 745

Query: 2808 HDTM 2819
            H++M
Sbjct: 746  HESM 749

 Score = 87.4 bits (215), Expect(4) = 0.0
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query: 691 AGPTDNTKKLWSELEKMIATEIEKG-VMDVDPSKPSTITAFPPGYIDKDLETVVGLQTDA 867
           AG T+ TK+LW ++  +   E E G V+D+D    S+IT+  PGY++K+ E VVG QTD 
Sbjct: 45  AGATEATKQLWDQVMDLTTKERENGGVLDMDTKIVSSITSHEPGYLNKETEKVVGFQTDK 104

Query: 868 PLKRAIKPLGGVNMVKAALESYGYTPDPE 954
           P KR+++P GG+ M + A ESYGY  D E
Sbjct: 105 PFKRSLQPYGGIRMAEQACESYGYEMDKE 133

 Score = 23.1 bits (48), Expect(4) = 0.0
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +3

Query: 621 AGINVQKYVQDNYTAYAGNSSFL 689
           A I+V+ ++ +N   Y G+ SFL
Sbjct: 22  AEIDVRDFILNNVNVYEGDESFL 44

>ref|NP_830328.1| Formate acetyltransferase [Bacillus cereus ATCC 14579]
            gi|29894238|gb|AAP07529.1| Formate acetyltransferase
            [Bacillus cereus ATCC 14579]
          Length = 749

 Score =  454 bits (1168), Expect(3) = 0.0
 Identities = 230/379 (60%), Positives = 283/379 (73%), Gaps = 2/379 (0%)
 Frame = +2

Query: 956  VARLYSTVRKTHNSGVFDAYTDEMRAARKSGILSGLPDGYGRGRIIGDYRRVALYGVDAL 1135
            ++R++   RKTHN GVFDAYT EMR ARKSG+++GLPD YGRGRIIGDYRRVALYG+D L
Sbjct: 134  LSRIFREWRKTHNQGVFDAYTPEMRNARKSGVITGLPDAYGRGRIIGDYRRVALYGIDHL 193

Query: 1136 IKAKKTDLKHNLLG-VMDEEKIRLREEVNEQIRALSELKEMGAAYGFDLSRPAANSREAV 1312
            I+AKK DL  NL G VM E+ +RLREE++EQ+RAL ELKEM A++GFD+S+PA N++EA 
Sbjct: 194  IEAKKADL--NLTGGVMSEDTMRLREELSEQMRALQELKEMAASHGFDISKPATNAQEAF 251

Query: 1313 QWLYFGYLGAVKEQDGAAMSLGRIDAFLDTYFERDLKAGTITEAEVQELIDHFVMKLRIV 1492
            QWLYF YL A+KEQ+GAAMSLGR   FLD Y ERDL  GT+TE EVQE++DHF+MKLR+V
Sbjct: 252  QWLYFAYLAAIKEQNGAAMSLGRTSTFLDIYIERDLANGTLTEEEVQEIVDHFIMKLRLV 311

Query: 1493 RQLRTPEYNALFAGDPTWVTCVLGGTDASGKAMVTKTSFRLLNTLYNLGPAPEPNLTVLW 1672
            +  RTP+YN LF+GDPTWVT  +GG    G+ +VTK SFR L+TL NLGPAPEPNLTVLW
Sbjct: 312  KFARTPDYNELFSGDPTWVTESIGGMALDGRPLVTKNSFRFLHTLDNLGPAPEPNLTVLW 371

Query: 1673 NDNLPAPFKEFCAKVSLDTSSIQYESDNLMSKLFGSDYSIACCVSAMRVGKDMQYFGCAR 1852
            +  LP  FK +CAK+S+ TS+IQYE+D++M   +G DY IACCVSAMR+GK MQ+FG AR
Sbjct: 372  SKQLPENFKNYCAKMSIKTSAIQYENDDIMRPEYGDDYGIACCVSAMRIGKQMQFFG-AR 430

Query: 1853 QPAQAAAVHAQRRPRRGVGRPGGAQVLRRCA-APPRRWTMRSVKAKIEDGMEWLASMYAN 2029
                 A ++A      G      AQV    A           V  K +  MEWLA +Y N
Sbjct: 431  ANLAKALLYA---INGGKDEKSKAQVGPEYAPITSEVLNYEEVMHKFDMTMEWLAGLYLN 487

Query: 2030 TMNIIHYMHDKYDYERLQM 2086
            T+N+IHYMHDKY YER++M
Sbjct: 488  TLNVIHYMHDKYSYERIEM 506

 Score =  340 bits (871), Expect(3) = 0.0
 Identities = 168/244 (68%), Positives = 199/244 (80%)
 Frame = +3

Query: 2088 ALHDTHVRRLLAFGISGLSVVTDSLSAIKYAQVTPVIDERGLMTDFKVEGSFPKYGNDDD 2267
            ALHDT+V R +A GI+GLSVV DSLSAIKYA+V P+ DE G+  DF++EG FPKYGN+DD
Sbjct: 507  ALHDTNVLRTMATGIAGLSVVADSLSAIKYAKVKPIRDENGIAVDFEIEGDFPKYGNNDD 566

Query: 2268 RVDEIAEWVVSTFSSKLAKQHTYRNSVPTLSVLTITSNVVYGKKTGSTPDGRKKGEPFAP 2447
            RVDEIA  +V TF +KL K  TYRNSV T+S+LTITSNVVYGKKTG+TPDGR+ GEPFAP
Sbjct: 567  RVDEIAVNLVKTFMNKLRKHTTYRNSVHTMSILTITSNVVYGKKTGNTPDGRRTGEPFAP 626

Query: 2448 GANPLHGRDAHGALASLNSVAKLPYTMCLDGISNTFSLIPQVLGRGGEHERATNLASILD 2627
            GANP+HGRD  GALASL SVAKLPY    DGISNTFS+IP+ LG+  +  +  NL S+LD
Sbjct: 627  GANPMHGRDTKGALASLLSVAKLPYEDAQDGISNTFSIIPKALGK-EDDVQVRNLVSMLD 685

Query: 2628 GYFANGGHHINVNVLNRSMLMDAVEHPEKYPNLTIRVSGYAVHFARLTREQQLEVIARTF 2807
            GY    GHH+N+NV NR  LMDA+EHPEKYP LTIRVSGYAV+F +LTREQQ++VI RT 
Sbjct: 686  GYAVKEGHHLNINVFNRETLMDAMEHPEKYPQLTIRVSGYAVNFIKLTREQQIDVINRTM 745

Query: 2808 HDTM 2819
            H++M
Sbjct: 746  HESM 749

 Score = 87.0 bits (214), Expect(3) = 0.0
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query: 691 AGPTDNTKKLWSELEKMIATEIEKG-VMDVDPSKPSTITAFPPGYIDKDLETVVGLQTDA 867
           A  T+ TK+LW ++  +   E E G V+D+D    S+IT+  PGY++KD+E VVG QTD 
Sbjct: 45  AEATEATKQLWDQVMDLTTKERENGGVLDMDTKIVSSITSHDPGYLNKDIEKVVGFQTDK 104

Query: 868 PLKRAIKPLGGVNMVKAALESYGYTPDPE 954
           P KR+++P GG+ M + A ESYGY  D E
Sbjct: 105 PFKRSLQPYGGIRMAEQACESYGYEMDKE 133

>ref|NP_763769.1| formate acetyltransferase [Staphylococcus epidermidis ATCC 12228]
            gi|27314674|gb|AAO03811.1|AE016744_214 formate
            acetyltransferase [Staphylococcus epidermidis ATCC 12228]
          Length = 748

 Score =  434 bits (1117), Expect(4) = 0.0
 Identities = 219/381 (57%), Positives = 274/381 (71%), Gaps = 2/381 (0%)
 Frame = +2

Query: 950  PRVARLYSTVRKTHNSGVFDAYTDEMRAARKSGILSGLPDGYGRGRIIGDYRRVALYGVD 1129
            P   ++++  RKTHN GVFDAY+ EM   RK+GI++GLPD YGRGRIIGDYRRVALYGVD
Sbjct: 131  PETEKIFTEYRKTHNQGVFDAYSREMLNCRKAGIITGLPDAYGRGRIIGDYRRVALYGVD 190

Query: 1130 ALIKAKKTDLKHNLLGVMDEEKIRLREEVNEQIRALSELKEMGAAYGFDLSRPAANSREA 1309
             L++ K  D  + +   M E+ IRLREE+ EQ R+L +LKE+G  YGFD+SRPA N +EA
Sbjct: 191  FLMEQKLKDF-NTMSTEMSEDVIRLREELTEQYRSLQDLKELGQKYGFDISRPATNFKEA 249

Query: 1310 VQWLYFGYLGAVKEQDGAAMSLGRIDAFLDTYFERDLKAGTITEAEVQELIDHFVMKLRI 1489
            VQWLY  YL A+KEQ+GAAMSLGR   FLD Y ERDL+ G ITE EVQE+IDHF+MKLRI
Sbjct: 250  VQWLYLAYLAAIKEQNGAAMSLGRTSTFLDIYAERDLQNGDITEQEVQEIIDHFIMKLRI 309

Query: 1490 VRQLRTPEYNALFAGDPTWVTCVLGGTDASGKAMVTKTSFRLLNTLYNLGPAPEPNLTVL 1669
            V+  RTPEYN LF+GDPTWVT  +GG    G+ MVTK SFR L++L NLGPAPEPNLTVL
Sbjct: 310  VKFARTPEYNELFSGDPTWVTESIGGVGIDGRPMVTKNSFRFLHSLDNLGPAPEPNLTVL 369

Query: 1670 WNDNLPAPFKEFCAKVSLDTSSIQYESDNLMSKLFGSDYSIACCVSAMRVGKDMQYFGCA 1849
            W+  LP  FK +CAK+S+ TSSIQYE+D+LM + +G DY IACCVSAM++GK MQ+FG  
Sbjct: 370  WSTRLPENFKIYCAKMSIKTSSIQYENDDLMRESYGDDYGIACCVSAMKIGKQMQFFGAR 429

Query: 1850 RQPAQAA--AVHAQRRPRRGVGRPGGAQVLRRCAAPPRRWTMRSVKAKIEDGMEWLASMY 2023
               A+A   A++  +  + G       + ++             V  + E  M+WLA +Y
Sbjct: 430  ANLAKALLYAINGGKDEKSGKQVGPSYEGIKSDVL-----DYDEVFERYEKMMDWLAGVY 484

Query: 2024 ANTMNIIHYMHDKYDYERLQM 2086
             N++NIIHYMHDKY YERL+M
Sbjct: 485  INSLNIIHYMHDKYSYERLEM 505

 Score =  338 bits (866), Expect(4) = 0.0
 Identities = 165/244 (67%), Positives = 200/244 (81%)
 Frame = +3

Query: 2088 ALHDTHVRRLLAFGISGLSVVTDSLSAIKYAQVTPVIDERGLMTDFKVEGSFPKYGNDDD 2267
            ALHDT + R +A GI+GLSV  DSLSAIKYAQV P+ +E GL+TDF++EG FPKYGN+D 
Sbjct: 506  ALHDTEIIRTMATGIAGLSVAADSLSAIKYAQVKPIRNEEGLVTDFEIEGDFPKYGNNDS 565

Query: 2268 RVDEIAEWVVSTFSSKLAKQHTYRNSVPTLSVLTITSNVVYGKKTGSTPDGRKKGEPFAP 2447
            RVDEIA  +V  F +KL    TYRNS  T+SVLTITSNVVYGKKTG+TPDGRK GEPFAP
Sbjct: 566  RVDEIAVDLVERFMTKLRSHKTYRNSEHTMSVLTITSNVVYGKKTGNTPDGRKAGEPFAP 625

Query: 2448 GANPLHGRDAHGALASLNSVAKLPYTMCLDGISNTFSLIPQVLGRGGEHERATNLASILD 2627
            GANP+HGRD  GAL+SL+SVAK+PY  C DGISNTFS++P+ LG+  E ++  NL S+LD
Sbjct: 626  GANPMHGRDQKGALSSLSSVAKIPYDCCKDGISNTFSIVPKSLGK-EEADQNKNLTSMLD 684

Query: 2628 GYFANGGHHINVNVLNRSMLMDAVEHPEKYPNLTIRVSGYAVHFARLTREQQLEVIARTF 2807
            GY    GHH+N+NV NR  L+DA+EHPE+YP LTIRVSGYAV+F +LTREQQL+VI+RTF
Sbjct: 685  GYAMQHGHHLNINVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTF 744

Query: 2808 HDTM 2819
            H++M
Sbjct: 745  HESM 748

 Score = 93.2 bits (230), Expect(4) = 0.0
 Identities = 45/88 (51%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = +1

Query: 694 GPTDNTKKLWSELEKMIATEIEKGVM-DVDPSKPSTITAFPPGYIDKDLETVVGLQTDAP 870
           GPT  T+ LW ++ ++   E E+G M D+D    STIT+   GY+DKDLE VVG+QT+ P
Sbjct: 45  GPTKATETLWDQVMQLSKEERERGGMWDMDTKVASTITSHDAGYLDKDLEKVVGVQTEKP 104

Query: 871 LKRAIKPLGGVNMVKAALESYGYTPDPE 954
            KR+++P GG+ M KAA E+YGY  DPE
Sbjct: 105 FKRSMQPFGGIRMAKAACEAYGYELDPE 132

 Score = 26.6 bits (57), Expect(4) = 0.0
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +3

Query: 627 INVQKYVQDNYTAYAGNSSFLGWP 698
           I+V++++Q NY+ Y G+  FL  P
Sbjct: 23  IDVREFIQLNYSLYEGDDEFLEGP 46

>ref|NP_370750.1| formate acetyltransferase [Staphylococcus aureus subsp. aureus Mu50]
            gi|15925929|ref|NP_373462.1| formate acetyltransferase
            [Staphylococcus aureus subsp. aureus N315]
            gi|21281930|ref|NP_645016.1| formate acetyltransferase
            [Staphylococcus aureus subsp. aureus MW2]
            gi|25285935|pir||E89785 formate acetyltransferase
            [imported] - Staphylococcus aureus (strain N315)
            gi|13700141|dbj|BAB41440.1| formate acetyltransferase
            [Staphylococcus aureus subsp. aureus N315]
            gi|14245993|dbj|BAB56388.1| formate acetyltransferase
            [Staphylococcus aureus subsp. aureus Mu50]
            gi|21203365|dbj|BAB94066.1| formate acetyltransferase
            [Staphylococcus aureus subsp. aureus MW2]
          Length = 749

 Score =  434 bits (1117), Expect(3) = 0.0
 Identities = 221/376 (58%), Positives = 273/376 (71%), Gaps = 1/376 (0%)
 Frame = +2

Query: 962  RLYSTVRKTHNSGVFDAYTDEMRAARKSGILSGLPDGYGRGRIIGDYRRVALYGVDALIK 1141
            ++++  RKTHN GVFDAY+ EM   RK+G+++GLPD YGRGRIIGDYRRVALYGVD L++
Sbjct: 136  KIFTDYRKTHNQGVFDAYSREMLNCRKAGVITGLPDAYGRGRIIGDYRRVALYGVDFLME 195

Query: 1142 AKKTDLKHNLLGVMDEEKIRLREEVNEQIRALSELKEMGAAYGFDLSRPAANSREAVQWL 1321
             K  D  + +   M E+ IRLREE++EQ RAL ELKE+G  YGFDLSRPA N +EAVQWL
Sbjct: 196  EKMHDF-NTMSTEMSEDVIRLREELSEQYRALKELKELGQKYGFDLSRPAENFKEAVQWL 254

Query: 1322 YFGYLGAVKEQDGAAMSLGRIDAFLDTYFERDLKAGTITEAEVQELIDHFVMKLRIVRQL 1501
            Y  YL A+KEQ+GAAMSLGR   FLD Y ERDLKAG ITE+EVQE+IDHF+MKLRIV+  
Sbjct: 255  YLAYLAAIKEQNGAAMSLGRTSTFLDIYAERDLKAGVITESEVQEIIDHFIMKLRIVKFA 314

Query: 1502 RTPEYNALFAGDPTWVTCVLGGTDASGKAMVTKTSFRLLNTLYNLGPAPEPNLTVLWNDN 1681
            RTP+YN LF+GDPTWVT  +GG    G+ +VTK SFR L++L NLGPAPEPNLTVLW+  
Sbjct: 315  RTPDYNELFSGDPTWVTESIGGVGIDGRPLVTKNSFRFLHSLDNLGPAPEPNLTVLWSVR 374

Query: 1682 LPAPFKEFCAKVSLDTSSIQYESDNLMSKLFGSDYSIACCVSAMRVGKDMQYFGCARQPA 1861
            LP  FK +CAK+S+ TSSIQYE+D++M + +G DY IACCVSAM +GK MQ+FG AR   
Sbjct: 375  LPDNFKTYCAKMSIKTSSIQYENDDIMRESYGDDYGIACCVSAMTIGKQMQFFG-ARANL 433

Query: 1862 QAAAVHAQRRPRRGVGRPGGAQVLRRC-AAPPRRWTMRSVKAKIEDGMEWLASMYANTMN 2038
                ++A      G     GAQV                V  K +  M+WLA +Y N++N
Sbjct: 434  AKTLLYA---INGGKDEKSGAQVGPNFEGINSEVLEYDEVFKKFDQMMDWLAGVYINSLN 490

Query: 2039 IIHYMHDKYDYERLQM 2086
            +IHYMHDKY YER++M
Sbjct: 491  VIHYMHDKYSYERIEM 506

 Score =  335 bits (858), Expect(3) = 0.0
 Identities = 163/244 (66%), Positives = 200/244 (81%)
 Frame = +3

Query: 2088 ALHDTHVRRLLAFGISGLSVVTDSLSAIKYAQVTPVIDERGLMTDFKVEGSFPKYGNDDD 2267
            ALHDT + R +A GI+GLSV  DSLSAIKYAQV P+ +E GL+ DF++EG FPKYGN+DD
Sbjct: 507  ALHDTEIVRTMATGIAGLSVAADSLSAIKYAQVKPIRNEEGLVVDFEIEGDFPKYGNNDD 566

Query: 2268 RVDEIAEWVVSTFSSKLAKQHTYRNSVPTLSVLTITSNVVYGKKTGSTPDGRKKGEPFAP 2447
            RVD+IA  +V  F +KL    TYR+S  T+SVLTITSNVVYGKKTG+TPDGRK GEPFAP
Sbjct: 567  RVDDIAVDLVERFMTKLRSHKTYRDSEHTMSVLTITSNVVYGKKTGNTPDGRKAGEPFAP 626

Query: 2448 GANPLHGRDAHGALASLNSVAKLPYTMCLDGISNTFSLIPQVLGRGGEHERATNLASILD 2627
            GANP+HGRD  GAL+SL+SVAK+PY  C DGISNTFS++P+ LG+  E ++  NL S+LD
Sbjct: 627  GANPMHGRDQKGALSSLSSVAKIPYDCCKDGISNTFSIVPKSLGKEPE-DQNRNLTSMLD 685

Query: 2628 GYFANGGHHINVNVLNRSMLMDAVEHPEKYPNLTIRVSGYAVHFARLTREQQLEVIARTF 2807
            GY    GHH+N+NV NR  L+DA+EHPE+YP LTIRVSGYAV+F +LTREQQL+VI+RTF
Sbjct: 686  GYAMQCGHHLNINVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTF 745

Query: 2808 HDTM 2819
            H++M
Sbjct: 746  HESM 749

 Score = 98.2 bits (243), Expect(3) = 0.0
 Identities = 50/114 (43%), Positives = 68/114 (58%), Gaps = 1/114 (0%)
 Frame = +1

Query: 616 WTRASTSRSMCRTTTPLTPATRPSWAGPTDNTKKLWSELEKMIATEIEKGVM-DVDPSKP 792
           W R    R   +    L        AGPT+ T KLW ++ ++   E E+G M D+D    
Sbjct: 20  WNRHVDVREFIQLNYTLYEGNDSFLAGPTEATSKLWEQVMQLSKEERERGGMWDMDTKVA 79

Query: 793 STITAFPPGYIDKDLETVVGLQTDAPLKRAIKPLGGVNMVKAALESYGYTPDPE 954
           STIT+   GY+DKDLET+VG+QT+ P KR+++P GG+ M KAA E+YGY  D E
Sbjct: 80  STITSHDAGYLDKDLETIVGVQTEKPFKRSMQPFGGIRMAKAACEAYGYELDEE 133

>sp|Q46266|PFL_CLOPA FORMATE ACETYLTRANSFERASE (PYRUVATE FORMATE-LYASE)
            gi|2127346|pir||JC6010 formate C-acetyltransferase (EC
            2.3.1.54) - Clostridium pasteurianum
            gi|1072361|emb|CAA63748.1| pyruvate-formate-lyase
            [Clostridium pasteurianum]
          Length = 740

 Score =  434 bits (1116), Expect(4) = 0.0
 Identities = 221/381 (58%), Positives = 276/381 (72%), Gaps = 7/381 (1%)
 Frame = +2

Query: 965  LYSTVRKTHNSGVFDAYTDEMRAARKSGILSGLPDGYGRGRIIGDYRRVALYGVDALIKA 1144
            +++  RKTHN GVFDAY++E R AR +G+L+GLPD YGRGRIIGDYRRVALYG+D LI+ 
Sbjct: 129  IFTNYRKTHNQGVFDAYSEETRIARSAGVLTGLPDAYGRGRIIGDYRRVALYGIDFLIQE 188

Query: 1145 KKTDLKHNLLGVMDEEKIRLREEVNEQIRALSELKEMGAAYGFDLSRPAANSREAVQWLY 1324
            KK DL  NL G M +E IRLREEV+EQIRAL E+K+M  +YG D+SRPA N++EA Q+LY
Sbjct: 189  KKKDLS-NLKGDMLDELIRLREEVSEQIRALDEIKKMALSYGVDISRPAVNAKEAAQFLY 247

Query: 1325 FGYLGAVKEQDGAAMSLGRIDAFLDTYFERDLKAGTITEAEVQELIDHFVMKLRIVRQLR 1504
            FGYL  VKE +GAAMSLGR   FLD Y ERDL+ G ITE E QE+ID F++KLR+VR LR
Sbjct: 248  FGYLAGVKENNGAAMSLGRTSTFLDIYIERDLEQGLITEDEAQEVIDQFIIKLRLVRHLR 307

Query: 1505 TPEYNALFAGDPTWVTCVLGGTDASGKAMVTKTSFRLLNTLYNLGPAPEPNLTVLWNDNL 1684
            TPEYN LFAGDPTWVT  + G    G+++VTK SFR L+TL NLG APEPN+TVLW++NL
Sbjct: 308  TPEYNELFAGDPTWVTESIAGVGIDGRSLVTKNSFRYLHTLINLGSAPEPNMTVLWSENL 367

Query: 1685 PAPFKEFCAKVSLDTSSIQYESDNLMSKLFGSDYSIACCVSAMRVGKDMQYFG--CARQP 1858
            P  FK+FCA++S+ T SIQYE+D++M  ++G DY+IACCVSAMRVGKDMQ+FG  C    
Sbjct: 368  PESFKKFCAEMSILTDSIQYENDDIMRPIYGDDYAIACCVSAMRVGKDMQFFGARCNLAK 427

Query: 1859 AQAAAVHAQRRPRRGVG-----RPGGAQVLRRCAAPPRRWTMRSVKAKIEDGMEWLASMY 2023
                A++     ++G+       P   +VL              VK      +E++A +Y
Sbjct: 428  CLLLAINGGVDEKKGIKVVPDIEPITDEVL----------DYEKVKENYFKVLEYMAGLY 477

Query: 2024 ANTMNIIHYMHDKYDYERLQM 2086
             NTMNIIH+MHDKY YE  QM
Sbjct: 478  VNTMNIIHFMHDKYAYEASQM 498

 Score =  323 bits (829), Expect(4) = 0.0
 Identities = 162/245 (66%), Positives = 192/245 (78%), Gaps = 1/245 (0%)
 Frame = +3

Query: 2088 ALHDTHVRRLLAFGISGLSVVTDSLSAIKYAQVTPVIDERGLMTDFKVEGSFPKYGNDDD 2267
            ALHDT V RL+AFGI+G SV  DSLSAI+YA+V P I E G+  DF  EG FPKYGNDDD
Sbjct: 499  ALHDTKVGRLMAFGIAGFSVAADSLSAIRYAKVKP-IRENGITVDFVKEGDFPKYGNDDD 557

Query: 2268 RVDEIAEWVVSTFSSKLAKQHTYRNSVPTLSVLTITSNVVYGKKTGSTPDGRKKGEPFAP 2447
            RVD IA  +V  FS +L K  TYRN+  TLSVLTITSNV+YGKKTG+TPDGRK GEP AP
Sbjct: 558  RVDSIAVEIVEKFSDELKKHPTYRNAKHTLSVLTITSNVMYGKKTGTTPDGRKVGEPLAP 617

Query: 2448 GANPLHGRDAHGALASLNSVAKLPYTMCLDGISNTFSLIPQVLGRGGEHE-RATNLASIL 2624
            GANP+HGRD  GALASLNSVAK+PY  C DG+SNTFS++P  L  G +H+ R  NL SI+
Sbjct: 618  GANPMHGRDMEGALASLNSVAKVPYVCCEDGVSNTFSIVPDAL--GNDHDVRINNLVSIM 675

Query: 2625 DGYFANGGHHINVNVLNRSMLMDAVEHPEKYPNLTIRVSGYAVHFARLTREQQLEVIART 2804
             GYF  G HH+NVNVLNR  L+DA+ +P+KYP LTIRVSGYAV+F RL+++ Q EVI+RT
Sbjct: 676  GGYFGQGAHHLNVNVLNRETLIDAMNNPDKYPTLTIRVSGYAVNFNRLSKDHQKEVISRT 735

Query: 2805 FHDTM 2819
            FH+ +
Sbjct: 736  FHEKL 740

 Score = 96.3 bits (238), Expect(4) = 0.0
 Identities = 41/82 (50%), Positives = 57/82 (69%)
 Frame = +1

Query: 694 GPTDNTKKLWSELEKMIATEIEKGVMDVDPSKPSTITAFPPGYIDKDLETVVGLQTDAPL 873
           GPT+ TKK+W +   +I  E++KG++DVD    S I +F PGY+DKD E +VG QTDAPL
Sbjct: 39  GPTEKTKKVWDKAVSLILEELKKGILDVDTETISGINSFKPGYLDKDNEVIVGFQTDAPL 98

Query: 874 KRAIKPLGGVNMVKAALESYGY 939
           KR   P GG+ M + +L+ YG+
Sbjct: 99  KRITNPFGGIRMAEQSLKEYGF 120

 Score = 29.6 bits (65), Expect(4) = 0.0
 Identities = 11/24 (45%), Positives = 16/24 (65%)
 Frame = +3

Query: 627 INVQKYVQDNYTAYAGNSSFLGWP 698
           +NV+ ++Q NY  Y G+ SFL  P
Sbjct: 17  VNVRDFIQKNYKEYTGDKSFLKGP 40



EST assemble image


clone accession position
1 HCL096e09_r AV644986 1 412
2 HCL066f03_r AV643270 71 687
3 HCL077e09_r AV643876 81 719
4 CL77d01_r AV397276 89 755
5 HCL084d08_r AV644230 91 702
6 MXL099e06_r BP098813 95 663
7 CL16e01_r AV393992 107 751
8 HCL090d03_r AV644548 157 538
9 MXL016b07_r BP093951 157 765
10 LCL085e07_r AV630872 160 518
11 MXL006c09_r BP093293 160 361
12 LCL088a01_r AV631040 160 643
13 LCL047h11_r AV628845 161 594
14 LCL027h11_r AV627519 164 465
15 LCL060c04_r AV629524 165 667
16 MXL015d12_r BP093909 166 536
17 HCL090c09_r AV644543 169 342
18 HCL007c06_r AV639922 169 667
19 MXL016h06_r BP094007 169 705
20 HCL095c10_r AV644901 169 744
21 MXL034f03_r BP095023 169 601
22 HCL095d08_r AV644910 169 739
23 HCL073h08_r AV643670 169 670
24 LCL027h07_r AV627515 170 536
25 LCL083b08_r AV630716 170 616
26 LCL086d08_r AV630925 170 618
27 CL61b04_r AV396342 171 617
28 HCL034e08_r AV641486 171 742
29 MXL011e05_r BP093651 171 746
30 MXL099b06_r BP098786 171 662
31 HCL100e05_r AV645275 171 596
32 MXL031b10_r BP094856 171 616
33 MXL021c07_r BP094325 171 498
34 MXL041g05_r BP095434 171 399
35 LCL082c08_r AV630662 172 391
36 MXL073f10_r BP097319 172 608
37 MXL012c08_r BP093704 172 397
38 MXL028h11_r BP094759 172 601
39 MXL014g06_r BP093855 172 621
40 MXL022d02_r BP094385 172 535
41 MXL073e07_r BP097314 172 738
42 HCL012f12_r AV640237 172 361
43 MXL048a09_r BP095831 172 590
44 MXL018c03_r BP094105 172 538
45 MXL081d01_r BP097786 172 575
46 MXL074f01_r BP097372 172 581
47 HCL073c04_r AV643641 172 675
48 MXL019f05_r BP094213 172 746
49 MXL082b01_r BP097835 172 547
50 MXL061f06_r BP096605 172 587
51 MXL076d10_r BP097480 172 580
52 MXL070g04_r BP097140 172 555
53 MXL068d05_r BP096995 172 542
54 HCL082g05_r AV644142 173 765
55 LCL071d09_r AV630025 173 537
56 HCL081g09_r AV644099 173 697
57 LCL036f10_r AV628098 173 715
58 MXL058e03_r BP096422 174 566
59 MXL031e05_r BP094878 174 686
60 HCL045b03_r AV642075 174 484
61 MXL076f11_r BP097494 174 581
62 HCL056a03_r AV642680 174 713
63 MXL014c02_r BP093818 174 612
64 MXL071h12_r BP097214 174 642
65 HCL087e12_r AV644385 174 687
66 MXL074a11_r BP097336 175 344
67 MXL081h04_r BP097821 175 685
68 HCL056g02_r AV642723 175 684
69 MXL049f04_r BP095932 175 619
70 MXL014d04_r BP093827 175 704
71 HCL024g04_r AV640921 175 554
72 MXL002f04_r BP093047 175 536
73 HCL065f07_r AV643208 176 687
74 MXL087b08_r BP098105 176 292
75 HCL077c06_r AV643856 176 743
76 MXL085g12_r BP098042 176 572
77 HCL035c04_r AV641520 176 744
78 CL02d10_r AV397604 176 697
79 HCL014b07_r AV640317 176 613
80 MXL039e04_r BP095294 176 614
81 HCL014d02_r AV640329 176 707
82 HCL066d10_r AV643256 176 674
83 MXL041g02_r BP095433 176 714
84 CL06g11_r AV393635 176 722
85 MXL045c04_r BP095652 176 608
86 CL25h02_r AV394541 176 693
87 HCL070g02_r AV643499 176 706
88 HCL057g03_r AV642777 176 705
89 MXL018e06_r BP094127 176 521
90 HCL076b05_r AV643791 176 718
91 LCL023b09_r AV627230 176 359
92 MXL078d04_r BP097604 176 596
93 MXL029a06_r BP094763 177 338
94 CL30a05_r AV394748 177 702
95 HCL049b02_r AV642290 177 763
96 CL76b10_r AV397137 177 697
97 HCL053b12_r AV642519 177 714
98 HCL052d10_r AV642472 177 684
99 HCL087h02_r AV644400 177 673
100 CL20e11_r AV394307 177 729
101 MXL028a02_r BP094714 178 600
102 MXL053d11_r BP096141 178 393
103 MXL051h10_r BP096063 179 551
104 MXL098f07_r BP098761 179 590
105 HCL074c10_r AV643693 179 683
106 MXL023g04_r BP094481 179 705
107 MXL081e07_r BP097801 179 601
108 MXL096a11_r BP098597 179 687
109 HCL087b05_r AV644366 179 681
110 CL37h11_r AV395243 179 761
111 MXL051g05_r BP096053 179 683
112 MXL002e01_r BP093036 179 595
113 HCL053g08_r AV642551 179 733
114 MXL046b09_r BP095709 179 296
115 MXL082h06_r BP097882 179 662
116 MXL017e06_r BP094054 179 542
117 HCL022c12_r AV640782 179 667
118 MXL018f10_r BP094141 179 753
119 HCL036f04_r AV641577 179 755
120 HCL051d05_r AV642413 179 669
121 MXL014e10_r BP093841 179 695
122 MXL054c03_r BP096185 180 693
123 CL18a12_r AV394092 180 719
124 HCL077h12_r AV643895 180 707
125 MXL069g08_r BP097087 180 714
126 HCL055e02_r AV642656 180 721
127 HCL062c07_r AV643017 180 719
128 CL46c03_r AV395643 180 724
129 CL75f06_r AV397081 180 743
130 MXL048d04_r BP095853 180 619
131 MXL019d08_r BP094196 180 744
132 CL38h10_r AV395334 180 748
133 HCL018g11_r AV640592 180 746
134 HCL091h12_r AV644669 180 753
135 HCL088a02_r AV644407 180 763
136 LCL052c08_r AV629115 180 616
137 MXL062c10_r BP096647 180 703
138 MXL026f03_r BP094659 180 463
139 MXL017e07_r BP094055 180 533
140 HCL090g11_r AV644578 180 536
141 HCL029d03_r AV641181 180 537
142 MXL067e11_r BP096951 180 564
143 MXL094b05_r BP098489 180 588
144 MXL058h03_r BP096446 180 659
145 MXL062a12_r BP096631 180 593
146 MXL069g12_r BP097090 180 596
147 MXL070f06_r BP097132 180 599
148 MXL002c04_r BP093020 180 608
149 MXL092e02_r BP098379 180 610
150 HCL032g03_r AV641388 180 627
151 HCL049b05_r AV642293 180 685
152 HCL099h08_r AV645226 180 705
153 HCL017d11_r AV640504 180 602
154 HCL063a12_r AV643062 181 707
155 HCL039b02_r AV641709 181 615
156 MXL067b12_r BP096927 181 661
157 HCL077e11_r AV643878 181 699
158 CL34d05_r AV394906 181 660
159 HCL005a05_r AV639785 181 744
160 HCL006g01_r AV639888 181 554
161 CL27d06_r AV394690 182 752
162 HCL009f04_r AV640064 182 451
163 HCL070f10_r AV643497 182 693
164 CL33a12_r AV394961 183 674
165 MXL076b12_r BP097468 183 589
166 MXL038f02_r BP095236 183 612
167 LCL049e12_r AV628959 183 440
168 LCL078h11_r AV630444 183 489
169 HCL067d05_r AV643311 183 627
170 MXL082d03_r BP097852 183 618
171 CL30h09_r AV394773 185 717
172 MXL024f06_r BP094538 185 442
173 CL23f12_r AV394483 185 662
174 CL22f04_r AV394216 185 753
175 CL73f08_r AV396981 185 726
176 HCL086g05_r AV644342 185 707
177 CL23h11_r AV394495 185 691
178 CL53c07_r AV395982 185 731
179 LCL013d06_r AV626669 185 695
180 HCL063c08_r AV643074 186 764
181 CL28d12_r AV394791 187 714
182 HCL007d10_r AV639932 187 665
183 HCL064e02_r AV643139 187 720
184 MXL058e08_r BP096424 187 743
185 MXL094d06_r BP098508 187 586
186 MXL046b04_r BP095705 187 439
187 MXL036f07_r BP095148 187 609
188 CL18b07_r AV394086 187 772
189 HCL040e04_r AV641802 187 767
190 HCL073c11_r AV643647 187 693
191 MXL010f06_r BP093594 187 535
192 HCL004f03_r AV639763 187 536
193 MXL007c02_r BP093350 187 537
194 CL58f11_r AV396246 187 724
195 MXL031a08_r BP094849 187 622
196 HCL082d11_r AV644126 187 698
197 MXL011d12_r BP093647 187 540
198 HCL091a01_r AV644589 187 610
199 HCL084c10_r AV644225 187 695
200 HCL006c10_r AV639865 187 608
201 CL41b12_r AV395431 187 696
202 CL33d11_r AV394945 187 653
203 HCL022h10_r AV640821 187 596
204 MXL033b04_r BP094949 187 612
205 MXL042g02_r BP095496 187 647
206 MXL053f12_r BP096154 187 597
207 CL47d03_r AV395684 187 707
208 HCL049h03_r AV642331 187 762
209 MXL047f08_r BP095805 187 748
210 HCL058f08_r AV642819 187 664
211 HCL060f02_r AV642925 187 717
212 HCL039f11_r AV641746 187 705
213 MXL060c05_r BP096530 187 617
214 MXL019d01_r BP094189 187 765
215 CL09f12_r AV393742 188 765
216 CL19c02_r AV394152 189 719
217 MXL052b04_r BP096068 189 613
218 MXL067d08_r BP096942 189 608
219 MXL025d07_r BP094594 190 612
220 CL15b06_r AV393972 190 724
221 HCL050a01_r AV642336 190 721
222 CL79h08_r AV397156 190 693
223 HCL032c11_r AV641364 190 608
224 MXL069f03_r BP097074 190 690
225 MXL045f05_r BP095673 190 651
226 MXL066a06_r BP096859 190 624
227 HCL086b02_r AV644312 190 679
228 HCL055f11_r AV642667 192 719
229 HCL018f10_r AV640585 192 614
230 HCL069h04_r AV643450 192 683
231 CL24f01_r AV394408 192 722
232 HCL067a07_r AV643288 195 379
233 HCL013h11_r AV640305 195 681
234 HCL036a01_r AV641546 195 745
235 CL44a07_r AV395575 195 722
236 CL73f12_r AV396992 195 372
237 HCL094g04_r AV644857 196 590
238 HCL076g03_r AV643825 197 660
239 HCL010b10_r AV640091 197 596
240 CL01a07_r AV393311 197 754
241 CL25a04_r AV394520 198 766
242 MXL091b02_r BP098297 198 600
243 MXL017d06_r BP094044 198 582
244 HCL059g03_r AV642878 201 744
245 MXL013b09_r BP093755 201 539
246 HCL006f02_r AV639881 202 755
247 HCL017e11_r AV640509 203 693
248 HCL026a03_r AV641001 203 744
249 HCL011f01_r AV640172 204 581
250 MXL047e12_r BP095800 204 616
251 MXL026c08_r BP094643 205 325
252 HCL064b04_r AV643121 205 762
253 CL42d08_r AV395498 205 767
254 HCL099c09_r AV645181 206 622
255 HCL082d08_r AV644124 208 746
256 CL12g12_r AV393811 210 750
257 HCL093e10_r AV644773 213 753
258 HCL065b09_r AV643182 214 740
259 HCL075h04_r AV643779 226 706
260 MXL011d02_r BP093640 229 473
261 HCL007c01_r AV639918 232 695
262 HCL054d07_r AV642596 251 780
263 LCL034h11_r AV627987 252 537
264 HCL002d02_r AV639645 254 765
265 MXL094b08_r BP098491 269 664
266 HCL011g10_r AV640185 271 693
267 HCL060c09_r AV642908 287 818
268 MXL054g08_r BP096218 290 729
269 MXL082g06_r BP097876 290 771
270 MXL068g04_r BP097017 290 812
271 MXL083g05_r BP097933 290 685
272 MXL011c11_r BP093638 293 815
273 MXL015c04_r BP093894 304 586
274 HCL045g02_r AV642105 305 536
275 MXL068d04_r BP096994 306 765
276 LCL059f04_r AV629485 306 744
277 CL17c07_r AV394134 320 877
278 CL31d07_r AV395012 321 864
279 HCL088d01_r AV644430 322 830
280 HCL094g03_r AV644856 328 618
281 LCL052f07_r AV629126 347 862
282 CL47e11_r AV395717 364 919
283 HCL071f08_r AV643556 364 889
284 CL33f02_r AV394991 383 887
285 HCL054e05_r AV642600 392 924
286 CL11h03_r AV393788 394 925
287 HCL021a04_r AV640705 414 932
288 MXL092h09_r BP098409 418 855
289 CL51g01_r AV395908 434 1077
290 LCL047a01_r AV628779 459 918
291 CL50g07_r AV395772 488 1031
292 HCL056a05_r AV642681 492 1035
293 MXL034a06_r BP094992 497 922
294 HCL047c11_r AV642200 497 815
295 MXL082h11_r BP097886 498 877
296 CL04e11_r AV393377 509 1053
297 LCL049b01_r AV628926 519 817
298 HCL042e10_r AV641926 523 1049
299 MXL060e07_r BP096547 532 882
300 LCL080h09_r AV630572 535 919
301 CL13g09_r AV393924 539 953
302 MXL008e11_r BP093450 540 1049
303 MXL042f09_r BP095492 559 967
304 LCL082g10_r AV630694 565 1037
305 LCL014c07_r AV626720 571 810
306 HCL035d01_r AV641523 573 1078
307 HCL018a02_r AV640537 626 1159
308 HCL070c05_r AV643473 649 1160
309 HCL086g06_r AV644343 669 1140
310 CL57a02_r AV396278 669 1226
311 CL01d07_r AV393321 695 1180
312 CL43e02_r AV395521 697 1199
313 MXL070d07_r BP097117 716 1090
314 MXL041d01_r BP095409 716 1185
315 CL22h02_r AV394232 721 1227
316 HCL026a02_r AV641000 725 1173
317 HCL093c12_r AV644755 751 1150
318 HCL015a12_r AV640372 759 933
319 HCL029f09_r AV641202 783 997
320 MX016f03_r BP086778 831 1029
321 MXL016f03_r BP093988 842 1276
322 LCL059d03_r AV629470 952 1364
323 MXL086g12_r BP098089 962 1446
324 CL74g11_r AV396494 1074 1620
325 MXL012a02_r BP093681 1207 1694
326 CL63e01_r AV396544 1278 1847
327 HCL006g12_r AV639896 1299 1676
328 MXL039h11_r BP095324 1302 1787
329 CL23c01_r AV394498 1310 1861
330 LCL050h02_r AV629042 1396 1674
331 MX255c09_r BP092519 1494 1983
332 MXL077c03_r BP097522 1495 1858
333 MX234g03_r BP091162 1507 1785
334 CM099f01_r AV393096 1546 2034
335 CM099e05_r AV393099 1550 2087
336 HC030a09_r AV634165 1652 2197
337 LC022b03_r AV620432 1747 2330
338 HCL066g01_r AV643277 1760 2213
339 CM078g03_r AV391843 1762 2297
340 LC055d07_r AV622842 1798 2367
341 HC053b08_r AV635948 1805 2208
342 HCL099b10_r AV645170 1852 2266
343 MXL024c01_r BP094510 1886 2248
344 MX051b01_r BP088082 1997 2351
345 CM081d06_r AV391894 2011 2612
346 LCL019g01_r AV627007 2030 2510
347 HC008h11_r AV632495 2189 2736
348 MX220g04_r BP090226 2208 2703
349 CM037h07_r AV388904 2218 2683
350 MX102e09_r BP088909 2218 2625
351 MX102f04_r BP088915 2218 2721
352 MX104b03_r BP089040 2218 2609
353 MXL090d01_r BP098260 2231 2722
354 CM070b09_r AV391294 2237 2866
355 LCL022d08_r AV627188 2251 2753
356 CM001d11_r AV386510 2251 2810
357 MX244d05_r BP091793 2272 2784
358 MX026g11_r BP087152 2278 2784
359 HC075h04_r AV637656 2283 2780
360 HC027c11_r AV633950 2299 2801
361 CM100g03_r AV392817 2307 2839
362 HC084a11_r AV638265 2335 2777
363 CM051c08_r AV389850 2341 2888
364 LC039g10_r AV621698 2378 2877
365 HC048d06_r AV635602 2390 2858
366 HC076c11_r AV637692 2390 2811
367 HC090a07_r AV638728 2392 2942
368 HC065c11_r AV636866 2446 2912
369 HC013h05_r AV632881 2558 3011
370 CM063g04_r AV390075 2583 3197
371 HCL083b01_r AV644158 2956 3423
372 CL38e02_r AV395292 3015 3507
373 CM024a07_r AV388275 3018 3598
374 CL77b04_r AV397292 3032 3582
375 CL47b05_r AV395685 3036 3596
376 MX053f02_r BP088187 3049 3415
377 CM082f02_r AV392086 3067 3598
378 CL64c06_r AV396658 3085 3612
379 CM055e12_r AV390188 3089 3596
380 LCL031c02_r AV627729 3093 3407
381 HCL074d04_r AV643698 3113 3596
382 CL34b02_r AV394883 3114 3598
383 HCL066d08_r AV643254 3123 3742
384 HC015e06_r AV633007 3167 3600
385 HCL053e05_r AV642534 3170 3599
386 HCL099c04_r AV645176 3218 3598
387 LCL002f10_r AV626120 3292 3598
388 HCL020b06_r AV640663 3356 3598
389 HCL090f03_r AV644565 3363 3597




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research