KCC000001A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000001A_C01 KCC000001A_c01
TTAACATAGCGGCTGCATAGAAGCCGTCACCCCTTCCCCTGAGTGGGCCTTTGTAGAACA
AGGCGTGAAAAATGGTGAAGTTTCACCATGGACGGAGATCCGTGCGCTCATGGAGCAAGC
CTCACAACATCCGCAACATGAGTGTGATTGCTCATGTGGACCACGGCAAGTCGACCCTCA
CCGACTCGCTGGTGGCTGCGGCCGGTATCATGGCCGTCGGAGCAGGCCGGCGACGCCCGC
CTGACGGACACCCGCGCCGACGAGCAGGAGCGCGGTATTACCATCAAGTCGACCGGCATT
TCGCTCTACTACCAGATGACCGATGACGACCTGAAGAACTTCACTGGTCAGCGTGATGGC
AACGACTATCTGGTGAACCTGATTGACTCGCCCGGTCACGTCGACTTCTCTTCGGAGGTG
ACCGCCGCGCTGCGCCATTACCGATGGCGCTCTGGTCGTCGTGGATTGCGTGGAGGGTGT
GTGCGTGCAGACCGAGACTGTGCTGCGCCAGGCCCTGGCTGAGCGCATTCGCCCGGTGCT
GACCGTCAACAAGATGGACCGCTGCTTCCTGGAGCTGATGCTGGAGGGTGAGGAGGCCTA
CAGCCACCTACCTGCGTGTGATTGAGAACGCCAACGTCATCATGGCCACCTACCAGGATG
AGGCCATGGGCGACATCCAGGTCTACCCCGACAAGTCGACCGTGTCCTTCTCCGCCGGTC
TGCACGGCTGGGCTTTCACCCTGACCACCTTCGCGCGCATGTACGCGTCGAAGTTCGGCA
CTGATGAGGCCCGCATGATCACCAAGCTGTGGGGCGACAACTTCTTCGACCCCGCCACCA
AGAAGTGGACCACCAAGCAGACCGACTCGCCCAGCTGCAAGCGCGGCTTCGTGCAGTTCA
TCTACGAGCCCATCAAGCAGATCATCGAGCTGGCCATGAAGGACGCCAAGGACAAGCTGT
GGCCCATGCTGGAGAAGCTGAACGTGATCGGCCGCCTCAAGTCTGACGACAAGGAGCTGA
GCGGCAAGCCCCTGATGAAGCGCATCATGCAGAGCTGGCTGCCCGCCAACGAGGCGCTGC
TGGAGATGATCGTCTACCACCTGCCCTCGCCCGCTAAGGCCCAGCGCTACCGCGTGGACG
TGCTGTACGAGGGTCCCCTGGACGACACCTACGCCACCGCCATCCGCAACTGCGACCCCA
ACGGTCCCCTGATGGTGTACATCTCCAAGATGATTCCCACCGCCGACAAGGGCCGCTTCT
TCGCCTTCGGCCGTGTGTACTCCGGCAAGGTGGCCACCGGCGCCAAGGTCCGCATCATGG
GCGCCAACTACATCCCCGGCGAGAAGAAGGACCTGTACAACAAGTCGGTGCAGCGCACCG
TGCTGTGCATGGGCCGCAAGCAGGAGGCCGTGGAGGACGTGCCCTGCGGTAACACCGTGG
CGCTGGTGGGCCTGGACCAGTACATCACCAAGACCGCCACCATCACCAAGGAGGGCTGCG
ACGACGCCTTCCCCATGAAGGCCATGAAGTTCTCCGTGTCGCCCGTCGTGCGTGTGGCCG
TGGAGCCCAAGAACGCCTCGGACCTGCCCAAGCTGGTGGAGGGCCTGAAGCGCCTGGCCC
GCTCGGACCCCATGGTGCAGTGCATTATCGAGGAGACCGGCGAGCACATTATTGCCGGTG
CCGGTGAGCTGCATCTGGAGATTTGCCTGAAGGATCTGCAGGACGACTTCATGGGCGGCG
CTGAGATCAAGATCTCGGAGCCCGTGGTGTCTTTCCGCGAGACCGTGACCGCCCAGTCGG
ACCACACCGTCATGTCCAAGTCGCCCAACAAGCACAACCGCCTGTACATCCAGGCCCGCC
CCATGGAGGACGGCCTGGCTGAGGCTATCGAGTCTGGCCGCGTGGGCCCCCGCGACGACC
CCAAGATTCGCTCCAAGATCCTGTCAGAGGAGTTCGGCTGGGACAAGGAGATCGCCAAGA
AGATCTGGTGCTTCGCCCCCGACACCAACGGCGCCAACATGATGATTGACGTGACCAAGG
GTGTGCAGTACCTGAACGAGATCAAGGACTCTTGCGTTGCCGCCATGCAGTGGGCGTGCA
AGGAGGGTGTCCTGGCGGAGGAGAACATGCGCGGCATCGTCTTCGAGTTCATGGATGTGG
TGCTGCACACCGACGCCATTCACCGCGGTGGTGGCCAGATCATCCCCACCGCCCGCCGCG
TGATCTACGCCGCCGAGCTGACCGCCCAGCCCCGCCTGTGCGAGCCCGTCTACCTGGTGG
AGATCCAGGCGCCTGAGCAGGCGCTGGGCGGCATCTACTCCACCCTGAACACCAAGCGCG
GCATGGTGTTCGAGGAGATGCAGCGCCCCGGTACCCCCATGTACAACATCAAGGCCTACC
TGCCCGTCGTGGAGTCGTTCGGCTTCACCTCGGTGCTGCGCGCCAACACCGCTGGCCAGG
CCTTCCCCCAGTGCGTGTTCGACCACTGGGACGTCATGCCCATGAACCCGCTGGACAAGG
GCACCCAGGCCAACACCCTGGTCACCAACATCCGCACCCGCAAGGGCCTCAAGCCCGAGC
CCGCTCCCCTGTCCGAGTACGAGGACAAGCTCTAAATGCGCGGCCTGCTTGCGATTGCGG
CCTGTCTTCGTTCATGGGGACAGGCGCGCGCAGCGGCGGCGGTGGAGCCGGGTGCTGGGG
CCCGCCTGGCAGCGCTGTCGCAGCGGCGGCGTGACCAACGGCAGCGGCGGCATGTGGTTC
TTGGGTGATCGAGGAGGATCCAGCAGCGGCGGCGGGGGCTCCTAGCAGGCGCTGGGGCGG
CGGCGAGCGGCTTTGCGGCTGTGGCGTGGCGGCACTGGCGCGGCGGTAGGGTCTTGAGGT
GTGCGCACCTCCTGCAGTCCGGTTATGCACGTGCGGTCTGTAGCGGGCTGGCGGATGTCG
TAACGACAGCTAGCGAAGGTTGCGCTGTGATGCCGAGCAAGTGGCGCTGAACGTGTGTGG
GCCGACGGGGTTGTAGCGAACCGGGACCAGCTCGGGGCTGATTGTGTGTTGTTAAGAACA
CAGTAGGGGTAGCACTTTCATTAGCCAGGTACCGAAGCCGCGGGCAGGAATGACTCGGGC
GCGCATGGTTCAGGCGTCTTGCAGGTGTGTGAGAACTCTCAAAGTGTGCGGTGGACTAGT
GGCGGTGACGCCGTAGGTGGGTGGCGGTAAATAGCGCTTGCGCGCCTGTTCTTGCCGACC
CGGCAGGGCGGGGCTGCAGCAACGTGATGGTGCAACGCCTGCCGTAAATGGTCCATATGC
GGAACAGTGCGCAGACTCGTCTGAGTGATCGTGTGACACAAGTAGGTTACGGGTTGACCA
ATGACATGCGCAAGGGGTTTCGCACGCAAAGGGTTGGCACCAAATGCCACCCGCGCTATT
CGGGATTCGAGATGTTCGCTGCACGCGACTAGCGGCAGATCAAAGAACAAGCGAAAGAAA
AAAAAAAACAACAACAACC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000001A_C01 KCC000001A_c01
         (3499 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P28996|EF2_CHLKE Elongation factor 2 (EF-2) gi|421771|pir||S3...  1107  0.0
emb|CAE01288.1| OSJNBa0020P07.5 [Oryza sativa (japonica cultivar...  1068  0.0
pir||A96602 elongation factor EF-2 [imported] - Arabidopsis thal...  1060  0.0
ref|NP_849818.1| elongation factor -related [Arabidopsis thalian...  1060  0.0
sp|O23755|EF2_BETVU Elongation factor 2 (EF-2) gi|7443464|pir||T...  1058  0.0

>sp|P28996|EF2_CHLKE Elongation factor 2 (EF-2) gi|421771|pir||S32819 translation
            elongation factor eEF-2 - Chlorella kessleri
            gi|167245|gb|AAA33028.1| elongation factor 2
            gi|228693|prf||1808323A elongation factor 2
          Length = 845

 Score = 1107 bits (2863), Expect(3) = 0.0
 Identities = 533/668 (79%), Positives = 595/668 (88%)
 Frame = +3

Query: 609  YLRVIENANVIMATYQDEAMGDIQVYPDKSTVSFSAGLHGWAFTLTTFARMYASKFGTDE 788
            Y RVIENANVIMATY DE +GD Q +P+  TVSFSAGLHGWAFTLT FA MYA+KFGTD 
Sbjct: 178  YRRVIENANVIMATYADEHLGDTQTHPEAGTVSFSAGLHGWAFTLTVFANMYAAKFGTDT 237

Query: 789  ARMITKLWGDNFFDPATKKWTTKQTDSPSCKRGFVQFIYEPIKQIIELAMKDAKDKLWPM 968
             RM+ KLWGDNFFD  T+KWT K T + +CKRGF QFIYEPIK +IE AM D KDKL+ +
Sbjct: 238  KRMMEKLWGDNFFDATTRKWTKKHTGADTCKRGFCQFIYEPIKTVIEAAMNDNKDKLFDL 297

Query: 969  LEKLNVIGRLKSDDKELSGKPLMKRIMQSWLPANEALLEMIVYHLPSPAKAQRYRVDVLY 1148
            L+KLNV  +LK +D+EL GKPLMKR+MQ+WLPA+EALLEM+++HLPSPAKAQ+YRVDVLY
Sbjct: 298  LKKLNVYSKLKPEDRELMGKPLMKRVMQTWLPAHEALLEMMIWHLPSPAKAQKYRVDVLY 357

Query: 1149 EGPLDDTYATAIRNCDPNGPLMVYISKMIPTADKGRFFAFGRVYSGKVATGAKVRIMGAN 1328
            EGPLDDTYATA+RNCD +GPLM+Y+SKMIP ADKGRF+AFGRV+SG++ATG KVRIMG N
Sbjct: 358  EGPLDDTYATAVRNCDADGPLMMYVSKMIPAADKGRFYAFGRVFSGRIATGRKVRIMGPN 417

Query: 1329 YIPGEKKDLYNKSVQRTVLCMGRKQEAVEDVPCGNTVALVGLDQYITKTATITKEGCDDA 1508
            Y+PG+KKDLY K+VQRTVLCMGR+QEAVEDVPCGNTVALVGLDQ+ITK AT+T E C+DA
Sbjct: 418  YVPGQKKDLYVKTVQRTVLCMGRRQEAVEDVPCGNTVALVGLDQFITKNATLTDEKCEDA 477

Query: 1509 FPMKAMKFSVSPVVRVAVEPKNASDLPKLVEGLKRLARSDPMVQCIIEETGEHIIAGAGE 1688
              +KAMKFSVSPVVRVAVEPK ASDLPKLVEGLKRLA+SDPMVQC IEETGEHIIAGAGE
Sbjct: 478  HTIKAMKFSVSPVVRVAVEPKVASDLPKLVEGLKRLAKSDPMVQCTIEETGEHIIAGAGE 537

Query: 1689 LHLEICLKDLQDDFMGGAEIKISEPVVSFRETVTAQSDHTVMSKSPNKHNRLYIQARPME 1868
            LHLEICLKDLQDDFMGGAEI++SEPVVSFRETV   SDH VMSKSPNKHNRLY+QARPME
Sbjct: 538  LHLEICLKDLQDDFMGGAEIRVSEPVVSFRETVIGTSDHVVMSKSPNKHNRLYMQARPME 597

Query: 1869 DGLAEAIESGRVGPRDDPKIRSKILSEEFGWDKEIAKKIWCFAPDTNGANMMIDVTKGVQ 2048
            DGLAEAI+ G++GPRDDPK+RSKILSEEFGWDKE+AKKI  F PDT G NM+ D+TKGVQ
Sbjct: 598  DGLAEAIDEGKIGPRDDPKVRSKILSEEFGWDKELAKKILAFGPDTTGPNMVTDITKGVQ 657

Query: 2049 YLNEIKDSCVAAMQWACKEGVLAEENMRGIVFEFMDVVLHTDAIHRGGGQIIPTARRVIY 2228
            YLNEIKDS VAA QWA KEGVLAEENMRGIVFE  DVVLH DAIHRGGGQIIPTARR +Y
Sbjct: 658  YLNEIKDSVVAAFQWASKEGVLAEENMRGIVFEVCDVVLHADAIHRGGGQIIPTARRSMY 717

Query: 2229 AAELTAQPRLCEPVYLVEIQAPEQALGGIYSTLNTKRGMVFEEMQRPGTPMYNIKAYLPV 2408
            AA+LTAQPRL EPVYLVEIQ PEQA+GG+YS LN KRGMVFEE+QRPGTP++N+KAYLPV
Sbjct: 718  AAQLTAQPRLLEPVYLVEIQCPEQAMGGVYSVLNQKRGMVFEELQRPGTPIFNLKAYLPV 777

Query: 2409 VESFGFTSVLRANTAGQAFPQCVFDHWDVMPMNPLDKGTQANTLVTNIRTRKGLKPEPAP 2588
            +ESFGFTS LRA TAGQAFPQCVFDHW+ M  +P   G+QANTLV +IR RKGLKPEPA 
Sbjct: 778  IESFGFTSTLRAATAGQAFPQCVFDHWEAMGSDPTQVGSQANTLVMDIRKRKGLKPEPAA 837

Query: 2589 LSEYEDKL 2612
            LSEYEDKL
Sbjct: 838  LSEYEDKL 845

 Score =  133 bits (334), Expect(3) = 0.0
 Identities = 64/72 (88%), Positives = 68/72 (93%)
 Frame = +1

Query: 220 EQAGDARLTDTRADEQERGITIKSTGISLYYQMTDDDLKNFTGQRDGNDYLVNLIDSPGH 399
           EQAGD RLTDTRADEQERGITIKSTGISLYYQMTD+ LK FTG+R GND+L+NLIDSPGH
Sbjct: 49  EQAGDQRLTDTRADEQERGITIKSTGISLYYQMTDEQLKGFTGERQGNDFLINLIDSPGH 108

Query: 400 VDFSSEVTAALR 435
           VDFSSEVTAALR
Sbjct: 109 VDFSSEVTAALR 120

 Score =  103 bits (256), Expect(3) = 0.0
 Identities = 49/55 (89%), Positives = 53/55 (96%)
 Frame = +2

Query: 437 ITDGALVVVDCVEGVCVQTETVLRQALAERIRPVLTVNKMDRCFLELMLEGEEAY 601
           ITDGALVVVDC+EGVCVQTETVLRQAL ERIRPVLT+NK+DRCFLELML+ EEAY
Sbjct: 121 ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTINKIDRCFLELMLDPEEAY 175

 Score = 60.1 bits (144), Expect = 3e-07
 Identities = 33/42 (78%), Positives = 36/42 (85%), Gaps = 1/42 (2%)
 Frame = +3

Query: 123 HNIRNMSVIAHVDHGKSTLTDSLVAAAGIMAV-GAGRRRPPD 245
           +NIRNMSVIAHVDHGKSTLTDSLVAAAGI+A   AG +R  D
Sbjct: 17  NNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAFEQAGDQRLTD 58

>emb|CAE01288.1| OSJNBa0020P07.5 [Oryza sativa (japonica cultivar-group)]
          Length = 843

 Score = 1068 bits (2763), Expect(4) = 0.0
 Identities = 512/669 (76%), Positives = 591/669 (87%)
 Frame = +3

Query: 606  TYLRVIENANVIMATYQDEAMGDIQVYPDKSTVSFSAGLHGWAFTLTTFARMYASKFGTD 785
            T+ RVIENANVIMATY+D  +GD+QVYP+K TV+FSAGLHGWAFTL++FA+MYASKFG D
Sbjct: 177  TFSRVIENANVIMATYEDTLLGDVQVYPEKGTVAFSAGLHGWAFTLSSFAKMYASKFGVD 236

Query: 786  EARMITKLWGDNFFDPATKKWTTKQTDSPSCKRGFVQFIYEPIKQIIELAMKDAKDKLWP 965
            E++M+ +LWG+NFFDPATKKWT K T S +CKRGFVQF YEPIKQII   M D KDKLWP
Sbjct: 237  ESKMMERLWGENFFDPATKKWTNKSTGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWP 296

Query: 966  MLEKLNVIGRLKSDDKELSGKPLMKRIMQSWLPANEALLEMIVYHLPSPAKAQRYRVDVL 1145
            ML+KL V+  +K+D+K+L GK LMKR+MQ+WLPA+ ALLEM++YHLPSP+KAQ+YRV+ L
Sbjct: 297  MLQKLGVV--MKADEKDLMGKALMKRVMQTWLPASNALLEMMIYHLPSPSKAQKYRVENL 354

Query: 1146 YEGPLDDTYATAIRNCDPNGPLMVYISKMIPTADKGRFFAFGRVYSGKVATGAKVRIMGA 1325
            YEGPLDD YATAIRNCDP GPLM+Y+SKMIP +DKGRFFAFGRV+SG+VATG KVRIMG 
Sbjct: 355  YEGPLDDVYATAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGRVATGMKVRIMGP 414

Query: 1326 NYIPGEKKDLYNKSVQRTVLCMGRKQEAVEDVPCGNTVALVGLDQYITKTATITKEGCDD 1505
            NY+PG+KKDLY KSVQRTV+ MG+KQE+VEDVPCGNTVA+VGLDQ+ITK AT+T E   D
Sbjct: 415  NYVPGQKKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVAMVGLDQFITKNATLTNEKEAD 474

Query: 1506 AFPMKAMKFSVSPVVRVAVEPKNASDLPKLVEGLKRLARSDPMVQCIIEETGEHIIAGAG 1685
            A P++AMKFSVSPVVRVAV+ K ASDLPKLVEGLKRLA+SDPMV C IEE+GEHIIAGAG
Sbjct: 475  ACPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAG 534

Query: 1686 ELHLEICLKDLQDDFMGGAEIKISEPVVSFRETVTAQSDHTVMSKSPNKHNRLYIQARPM 1865
            ELHLEICLKDLQ+DFMGGAEI +S PVVSFRETV  +S  TVMSKSPNKHNRLY++ARP+
Sbjct: 535  ELHLEICLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPL 594

Query: 1866 EDGLAEAIESGRVGPRDDPKIRSKILSEEFGWDKEIAKKIWCFAPDTNGANMMIDVTKGV 2045
            E+GLAEAI+ GR+GPRDDPK+RSKILSEEFGWDK++AKKIWCF P+T G NM++D+ KGV
Sbjct: 595  EEGLAEAIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGV 654

Query: 2046 QYLNEIKDSCVAAMQWACKEGVLAEENMRGIVFEFMDVVLHTDAIHRGGGQIIPTARRVI 2225
            QYLNEIKDS VA  QWA KEG LAEENMRGI FE  DVVLH DAIHRGGGQ+IPTARRVI
Sbjct: 655  QYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVI 714

Query: 2226 YAAELTAQPRLCEPVYLVEIQAPEQALGGIYSTLNTKRGMVFEEMQRPGTPMYNIKAYLP 2405
            YA++LTA+PRL EPVYLVEIQAPE ALGGIY  LN KRG VFEEMQRPGTP+YNIKAYLP
Sbjct: 715  YASQLTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLP 774

Query: 2406 VVESFGFTSVLRANTAGQAFPQCVFDHWDVMPMNPLDKGTQANTLVTNIRTRKGLKPEPA 2585
            V+ESFGF+S LRA T+GQAFPQCVFDHWD+M  +PL+  +QAN LV +IR RKGLK +  
Sbjct: 775  VIESFGFSSQLRAATSGQAFPQCVFDHWDMMTSDPLEVSSQANQLVLDIRKRKGLKEQMT 834

Query: 2586 PLSEYEDKL 2612
            PLS++EDKL
Sbjct: 835  PLSDFEDKL 843

 Score =  121 bits (303), Expect(4) = 0.0
 Identities = 57/72 (79%), Positives = 66/72 (91%)
 Frame = +1

Query: 220 EQAGDARLTDTRADEQERGITIKSTGISLYYQMTDDDLKNFTGQRDGNDYLVNLIDSPGH 399
           E AGD R+TDTRADE ERGITIKSTGISL+Y+M+D+ LK + G+RDGN+YL+NLIDSPGH
Sbjct: 49  EVAGDVRMTDTRADEAERGITIKSTGISLFYEMSDESLKLYKGERDGNEYLINLIDSPGH 108

Query: 400 VDFSSEVTAALR 435
           VDFSSEVTAALR
Sbjct: 109 VDFSSEVTAALR 120

 Score =  106 bits (264), Expect(4) = 0.0
 Identities = 51/55 (92%), Positives = 53/55 (95%)
 Frame = +2

Query: 437 ITDGALVVVDCVEGVCVQTETVLRQALAERIRPVLTVNKMDRCFLELMLEGEEAY 601
           ITDGALVVVDC+EGVCVQTETVLRQAL ERIRPVLTVNKMDRCFLEL +EGEEAY
Sbjct: 121 ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAY 175

 Score = 62.0 bits (149), Expect(4) = 0.0
 Identities = 31/37 (83%), Positives = 33/37 (88%)
 Frame = +3

Query: 105 RSWSKPHNIRNMSVIAHVDHGKSTLTDSLVAAAGIMA 215
           R   K +NIRNMSVIAHVDHGKSTLTDSLVAAAGI+A
Sbjct: 11  RIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIA 47

>pir||A96602 elongation factor EF-2 [imported] - Arabidopsis thaliana
            gi|6056373|gb|AAF02837.1|AC009894_8 elongation factor
            EF-2 [Arabidopsis thaliana]
          Length = 846

 Score = 1060 bits (2740), Expect(4) = 0.0
 Identities = 512/669 (76%), Positives = 587/669 (87%)
 Frame = +3

Query: 606  TYLRVIENANVIMATYQDEAMGDIQVYPDKSTVSFSAGLHGWAFTLTTFARMYASKFGTD 785
            T+ RVIENANVIMATY+D  +GD+QVYP+K TV+FSAGLHGWAFTLT FA+MYASKFG  
Sbjct: 180  TFSRVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVV 239

Query: 786  EARMITKLWGDNFFDPATKKWTTKQTDSPSCKRGFVQFIYEPIKQIIELAMKDAKDKLWP 965
            E++M+ +LWG+NFFDPAT+KW+ K T SP+CKRGFVQF YEPIKQII   M D KDKLWP
Sbjct: 240  ESKMMERLWGENFFDPATRKWSGKNTGSPTCKRGFVQFCYEPIKQIIATCMNDQKDKLWP 299

Query: 966  MLEKLNVIGRLKSDDKELSGKPLMKRIMQSWLPANEALLEMIVYHLPSPAKAQRYRVDVL 1145
            ML KL V   +K+D+KEL GKPLMKR+MQ+WLPA+ ALLEM+++HLPSP  AQRYRV+ L
Sbjct: 300  MLAKLGV--SMKNDEKELMGKPLMKRVMQTWLPASTALLEMMIFHLPSPHTAQRYRVENL 357

Query: 1146 YEGPLDDTYATAIRNCDPNGPLMVYISKMIPTADKGRFFAFGRVYSGKVATGAKVRIMGA 1325
            YEGPLDD YA AIRNCDPNGPLM+Y+SKMIP +DKGRFFAFGRV++GKV+TG KVRIMG 
Sbjct: 358  YEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFAGKVSTGMKVRIMGP 417

Query: 1326 NYIPGEKKDLYNKSVQRTVLCMGRKQEAVEDVPCGNTVALVGLDQYITKTATITKEGCDD 1505
            NYIPGEKKDLY KSVQRTV+ MG++QE VEDVPCGNTVA+VGLDQ+ITK AT+T E   D
Sbjct: 418  NYIPGEKKDLYTKSVQRTVIWMGKRQETVEDVPCGNTVAMVGLDQFITKNATLTNEKEVD 477

Query: 1506 AFPMKAMKFSVSPVVRVAVEPKNASDLPKLVEGLKRLARSDPMVQCIIEETGEHIIAGAG 1685
            A P++AMKFSVSPVVRVAV+ K ASDLPKLVEGLKRLA+SDPMV C +EE+GEHI+AGAG
Sbjct: 478  AHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTMEESGEHIVAGAG 537

Query: 1686 ELHLEICLKDLQDDFMGGAEIKISEPVVSFRETVTAQSDHTVMSKSPNKHNRLYIQARPM 1865
            ELHLEICLKDLQDDFMGGAEI  S+PVVSFRETV  +S  TVMSKSPNKHNRLY++ARPM
Sbjct: 538  ELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVCDRSTRTVMSKSPNKHNRLYMEARPM 597

Query: 1866 EDGLAEAIESGRVGPRDDPKIRSKILSEEFGWDKEIAKKIWCFAPDTNGANMMIDVTKGV 2045
            E+GLAEAI+ GR+GPRDDPKIRSKIL+EEFGWDK++AKKIW F P+T G NM++D+ KGV
Sbjct: 598  EEGLAEAIDDGRIGPRDDPKIRSKILAEEFGWDKDLAKKIWAFGPETTGPNMVVDMCKGV 657

Query: 2046 QYLNEIKDSCVAAMQWACKEGVLAEENMRGIVFEFMDVVLHTDAIHRGGGQIIPTARRVI 2225
            QYLNEIKDS VA  QWA KEG LAEENMRGI FE  DVVLH+DAIHRGGGQ+IPTARRVI
Sbjct: 658  QYLNEIKDSVVAGFQWASKEGPLAEENMRGICFEVCDVVLHSDAIHRGGGQVIPTARRVI 717

Query: 2226 YAAELTAQPRLCEPVYLVEIQAPEQALGGIYSTLNTKRGMVFEEMQRPGTPMYNIKAYLP 2405
            YA+++TA+PRL EPVY+VEIQAPE ALGGIYS LN KRG VFEEMQRPGTP+YNIKAYLP
Sbjct: 718  YASQITAKPRLLEPVYMVEIQAPEGALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLP 777

Query: 2406 VVESFGFTSVLRANTAGQAFPQCVFDHWDVMPMNPLDKGTQANTLVTNIRTRKGLKPEPA 2585
            VVESFGF+S LRA T+GQAFPQCVFDHW++M  +PL+ GTQA+ LV +IR RKGLK    
Sbjct: 778  VVESFGFSSQLRAATSGQAFPQCVFDHWEMMSSDPLEPGTQASVLVADIRKRKGLKEAMT 837

Query: 2586 PLSEYEDKL 2612
            PLSE+EDKL
Sbjct: 838  PLSEFEDKL 846

 Score =  128 bits (321), Expect(4) = 0.0
 Identities = 61/72 (84%), Positives = 67/72 (92%)
 Frame = +1

Query: 220 EQAGDARLTDTRADEQERGITIKSTGISLYYQMTDDDLKNFTGQRDGNDYLVNLIDSPGH 399
           E AGD R+TDTRADE ERGITIKSTGISLYY+MTD+ LK+FTG RDGN+YL+NLIDSPGH
Sbjct: 52  EVAGDVRMTDTRADEAERGITIKSTGISLYYEMTDESLKSFTGARDGNEYLINLIDSPGH 111

Query: 400 VDFSSEVTAALR 435
           VDFSSEVTAALR
Sbjct: 112 VDFSSEVTAALR 123

 Score =  105 bits (261), Expect(4) = 0.0
 Identities = 50/55 (90%), Positives = 53/55 (95%)
 Frame = +2

Query: 437 ITDGALVVVDCVEGVCVQTETVLRQALAERIRPVLTVNKMDRCFLELMLEGEEAY 601
           ITDGALVVVDC+EGVCVQTETVLRQAL ERIRPVLTVNKMDRCFLEL ++GEEAY
Sbjct: 124 ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAY 178

 Score = 62.4 bits (150), Expect(4) = 0.0
 Identities = 30/31 (96%), Positives = 31/31 (99%)
 Frame = +3

Query: 123 HNIRNMSVIAHVDHGKSTLTDSLVAAAGIMA 215
           HNIRNMSVIAHVDHGKSTLTDSLVAAAGI+A
Sbjct: 20  HNIRNMSVIAHVDHGKSTLTDSLVAAAGIIA 50

>ref|NP_849818.1| elongation factor -related [Arabidopsis thaliana]
            gi|13605865|gb|AAK32918.1|AF367331_1 At1g56070/T6H22_13
            [Arabidopsis thaliana] gi|15450763|gb|AAK96653.1|
            elongation factor EF-2 [Arabidopsis thaliana]
            gi|23397045|gb|AAN31808.1| putative elongation factor
            [Arabidopsis thaliana] gi|23397162|gb|AAN31864.1|
            putative elongation factor [Arabidopsis thaliana]
            gi|27363422|gb|AAO11630.1| At1g56070/T6H22_13
            [Arabidopsis thaliana]
          Length = 843

 Score = 1060 bits (2740), Expect(4) = 0.0
 Identities = 512/669 (76%), Positives = 587/669 (87%)
 Frame = +3

Query: 606  TYLRVIENANVIMATYQDEAMGDIQVYPDKSTVSFSAGLHGWAFTLTTFARMYASKFGTD 785
            T+ RVIENANVIMATY+D  +GD+QVYP+K TV+FSAGLHGWAFTLT FA+MYASKFG  
Sbjct: 177  TFSRVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVV 236

Query: 786  EARMITKLWGDNFFDPATKKWTTKQTDSPSCKRGFVQFIYEPIKQIIELAMKDAKDKLWP 965
            E++M+ +LWG+NFFDPAT+KW+ K T SP+CKRGFVQF YEPIKQII   M D KDKLWP
Sbjct: 237  ESKMMERLWGENFFDPATRKWSGKNTGSPTCKRGFVQFCYEPIKQIIATCMNDQKDKLWP 296

Query: 966  MLEKLNVIGRLKSDDKELSGKPLMKRIMQSWLPANEALLEMIVYHLPSPAKAQRYRVDVL 1145
            ML KL V   +K+D+KEL GKPLMKR+MQ+WLPA+ ALLEM+++HLPSP  AQRYRV+ L
Sbjct: 297  MLAKLGV--SMKNDEKELMGKPLMKRVMQTWLPASTALLEMMIFHLPSPHTAQRYRVENL 354

Query: 1146 YEGPLDDTYATAIRNCDPNGPLMVYISKMIPTADKGRFFAFGRVYSGKVATGAKVRIMGA 1325
            YEGPLDD YA AIRNCDPNGPLM+Y+SKMIP +DKGRFFAFGRV++GKV+TG KVRIMG 
Sbjct: 355  YEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFAGKVSTGMKVRIMGP 414

Query: 1326 NYIPGEKKDLYNKSVQRTVLCMGRKQEAVEDVPCGNTVALVGLDQYITKTATITKEGCDD 1505
            NYIPGEKKDLY KSVQRTV+ MG++QE VEDVPCGNTVA+VGLDQ+ITK AT+T E   D
Sbjct: 415  NYIPGEKKDLYTKSVQRTVIWMGKRQETVEDVPCGNTVAMVGLDQFITKNATLTNEKEVD 474

Query: 1506 AFPMKAMKFSVSPVVRVAVEPKNASDLPKLVEGLKRLARSDPMVQCIIEETGEHIIAGAG 1685
            A P++AMKFSVSPVVRVAV+ K ASDLPKLVEGLKRLA+SDPMV C +EE+GEHI+AGAG
Sbjct: 475  AHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTMEESGEHIVAGAG 534

Query: 1686 ELHLEICLKDLQDDFMGGAEIKISEPVVSFRETVTAQSDHTVMSKSPNKHNRLYIQARPM 1865
            ELHLEICLKDLQDDFMGGAEI  S+PVVSFRETV  +S  TVMSKSPNKHNRLY++ARPM
Sbjct: 535  ELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVCDRSTRTVMSKSPNKHNRLYMEARPM 594

Query: 1866 EDGLAEAIESGRVGPRDDPKIRSKILSEEFGWDKEIAKKIWCFAPDTNGANMMIDVTKGV 2045
            E+GLAEAI+ GR+GPRDDPKIRSKIL+EEFGWDK++AKKIW F P+T G NM++D+ KGV
Sbjct: 595  EEGLAEAIDDGRIGPRDDPKIRSKILAEEFGWDKDLAKKIWAFGPETTGPNMVVDMCKGV 654

Query: 2046 QYLNEIKDSCVAAMQWACKEGVLAEENMRGIVFEFMDVVLHTDAIHRGGGQIIPTARRVI 2225
            QYLNEIKDS VA  QWA KEG LAEENMRGI FE  DVVLH+DAIHRGGGQ+IPTARRVI
Sbjct: 655  QYLNEIKDSVVAGFQWASKEGPLAEENMRGICFEVCDVVLHSDAIHRGGGQVIPTARRVI 714

Query: 2226 YAAELTAQPRLCEPVYLVEIQAPEQALGGIYSTLNTKRGMVFEEMQRPGTPMYNIKAYLP 2405
            YA+++TA+PRL EPVY+VEIQAPE ALGGIYS LN KRG VFEEMQRPGTP+YNIKAYLP
Sbjct: 715  YASQITAKPRLLEPVYMVEIQAPEGALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLP 774

Query: 2406 VVESFGFTSVLRANTAGQAFPQCVFDHWDVMPMNPLDKGTQANTLVTNIRTRKGLKPEPA 2585
            VVESFGF+S LRA T+GQAFPQCVFDHW++M  +PL+ GTQA+ LV +IR RKGLK    
Sbjct: 775  VVESFGFSSQLRAATSGQAFPQCVFDHWEMMSSDPLEPGTQASVLVADIRKRKGLKEAMT 834

Query: 2586 PLSEYEDKL 2612
            PLSE+EDKL
Sbjct: 835  PLSEFEDKL 843

 Score =  128 bits (321), Expect(4) = 0.0
 Identities = 61/72 (84%), Positives = 67/72 (92%)
 Frame = +1

Query: 220 EQAGDARLTDTRADEQERGITIKSTGISLYYQMTDDDLKNFTGQRDGNDYLVNLIDSPGH 399
           E AGD R+TDTRADE ERGITIKSTGISLYY+MTD+ LK+FTG RDGN+YL+NLIDSPGH
Sbjct: 49  EVAGDVRMTDTRADEAERGITIKSTGISLYYEMTDESLKSFTGARDGNEYLINLIDSPGH 108

Query: 400 VDFSSEVTAALR 435
           VDFSSEVTAALR
Sbjct: 109 VDFSSEVTAALR 120

 Score =  105 bits (261), Expect(4) = 0.0
 Identities = 50/55 (90%), Positives = 53/55 (95%)
 Frame = +2

Query: 437 ITDGALVVVDCVEGVCVQTETVLRQALAERIRPVLTVNKMDRCFLELMLEGEEAY 601
           ITDGALVVVDC+EGVCVQTETVLRQAL ERIRPVLTVNKMDRCFLEL ++GEEAY
Sbjct: 121 ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAY 175

 Score = 62.4 bits (150), Expect(4) = 0.0
 Identities = 30/31 (96%), Positives = 31/31 (99%)
 Frame = +3

Query: 123 HNIRNMSVIAHVDHGKSTLTDSLVAAAGIMA 215
           HNIRNMSVIAHVDHGKSTLTDSLVAAAGI+A
Sbjct: 17  HNIRNMSVIAHVDHGKSTLTDSLVAAAGIIA 47

>sp|O23755|EF2_BETVU Elongation factor 2 (EF-2) gi|7443464|pir||T14579 translation
            elongation factor eEF-2 - beet gi|2369714|emb|CAB09900.1|
            elongation factor 2 [Beta vulgaris subsp. vulgaris]
          Length = 843

 Score = 1058 bits (2736), Expect(4) = 0.0
 Identities = 510/669 (76%), Positives = 590/669 (87%)
 Frame = +3

Query: 606  TYLRVIENANVIMATYQDEAMGDIQVYPDKSTVSFSAGLHGWAFTLTTFARMYASKFGTD 785
            T+ +VIENANVIMATY+D  +GD+QVYP+K TV+FSAGLHGWAFTL+ FA+MYASKFG D
Sbjct: 177  TFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLSNFAKMYASKFGVD 236

Query: 786  EARMITKLWGDNFFDPATKKWTTKQTDSPSCKRGFVQFIYEPIKQIIELAMKDAKDKLWP 965
            E++M+ +LWG+NFFDPATKKWTTK + + SCKRGFVQF YEPIKQII   M D KDKL  
Sbjct: 237  ESKMMERLWGENFFDPATKKWTTKNSGNASCKRGFVQFCYEPIKQIIAACMNDQKDKLLA 296

Query: 966  MLEKLNVIGRLKSDDKELSGKPLMKRIMQSWLPANEALLEMIVYHLPSPAKAQRYRVDVL 1145
             + KL +  ++K+++K+L G+PLMKR+MQ+WLPA+ ALLEM+++HLPSPA AQRYRV+ L
Sbjct: 297  HVTKLGI--QMKTEEKDLMGRPLMKRVMQTWLPASSALLEMMIHHLPSPATAQRYRVENL 354

Query: 1146 YEGPLDDTYATAIRNCDPNGPLMVYISKMIPTADKGRFFAFGRVYSGKVATGAKVRIMGA 1325
            YEGP+DD YATAIRNCDP GPLM+Y+SKMIP +DKGRFFAFGRV++GKV+TG KVRIMG 
Sbjct: 355  YEGPMDDVYATAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFAGKVSTGMKVRIMGP 414

Query: 1326 NYIPGEKKDLYNKSVQRTVLCMGRKQEAVEDVPCGNTVALVGLDQYITKTATITKEGCDD 1505
            NY+PGEKKDLY K+VQRTV+ MG+KQE VEDVPCGNTVALVGLDQYITK AT+T E   D
Sbjct: 415  NYVPGEKKDLYVKNVQRTVIWMGKKQETVEDVPCGNTVALVGLDQYITKNATLTNEKESD 474

Query: 1506 AFPMKAMKFSVSPVVRVAVEPKNASDLPKLVEGLKRLARSDPMVQCIIEETGEHIIAGAG 1685
            A P++AMKFSVSPVVRVAV+ K ASDLPKLVEGLKRLA+SDPMV C IEE+GEHIIAGAG
Sbjct: 475  AHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSIEESGEHIIAGAG 534

Query: 1686 ELHLEICLKDLQDDFMGGAEIKISEPVVSFRETVTAQSDHTVMSKSPNKHNRLYIQARPM 1865
            ELHLEICLKDLQDDFMGGAEI  S+PVVSFRETV  +S  TVMSKSPNKHNRLY++ARPM
Sbjct: 535  ELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLDRSVRTVMSKSPNKHNRLYMEARPM 594

Query: 1866 EDGLAEAIESGRVGPRDDPKIRSKILSEEFGWDKEIAKKIWCFAPDTNGANMMIDVTKGV 2045
            E+GLAEAI+ GR+GPRDDPK RSKIL+EE+GWDK++AKKIWCF P+T G NM++D+ KGV
Sbjct: 595  EEGLAEAIDEGRIGPRDDPKNRSKILAEEYGWDKDLAKKIWCFGPETTGPNMVVDMCKGV 654

Query: 2046 QYLNEIKDSCVAAMQWACKEGVLAEENMRGIVFEFMDVVLHTDAIHRGGGQIIPTARRVI 2225
            QYLNEIKDS VA  QWA KEG LAEENMRGI FE  DVVLHTDAIHRGGGQIIPTARRV 
Sbjct: 655  QYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQIIPTARRVF 714

Query: 2226 YAAELTAQPRLCEPVYLVEIQAPEQALGGIYSTLNTKRGMVFEEMQRPGTPMYNIKAYLP 2405
            YA++LTA+PRL EPVYLVEIQAPE ALGGIYS LN KRG VFEEMQRPGTP+YNIKAYLP
Sbjct: 715  YASQLTAKPRLLEPVYLVEIQAPENALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLP 774

Query: 2406 VVESFGFTSVLRANTAGQAFPQCVFDHWDVMPMNPLDKGTQANTLVTNIRTRKGLKPEPA 2585
            VVESFGF+S LRA+T+GQAFPQCVFDHW++MP +PL+ G+QA+TLV+ IR RKGLK +  
Sbjct: 775  VVESFGFSSTLRASTSGQAFPQCVFDHWEMMPSDPLEAGSQASTLVSVIRKRKGLKEQMT 834

Query: 2586 PLSEYEDKL 2612
            PLSE+EDKL
Sbjct: 835  PLSEFEDKL 843

 Score =  123 bits (309), Expect(4) = 0.0
 Identities = 59/72 (81%), Positives = 66/72 (90%)
 Frame = +1

Query: 220 EQAGDARLTDTRADEQERGITIKSTGISLYYQMTDDDLKNFTGQRDGNDYLVNLIDSPGH 399
           E AGD R+TDTRADE ERGITIKSTGISLYYQMTD+ L+++ G+R GNDYL+NLIDSPGH
Sbjct: 49  EVAGDVRMTDTRADEAERGITIKSTGISLYYQMTDEALQSYKGERKGNDYLINLIDSPGH 108

Query: 400 VDFSSEVTAALR 435
           VDFSSEVTAALR
Sbjct: 109 VDFSSEVTAALR 120

 Score =  105 bits (262), Expect(4) = 0.0
 Identities = 50/56 (89%), Positives = 54/56 (96%)
 Frame = +2

Query: 437 ITDGALVVVDCVEGVCVQTETVLRQALAERIRPVLTVNKMDRCFLELMLEGEEAYS 604
           ITDGALVVVDC+EGVCVQTETVLRQAL ERIRPVLTVNKMDRCFLEL ++GEEAY+
Sbjct: 121 ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYT 176

 Score = 62.4 bits (150), Expect(4) = 0.0
 Identities = 30/31 (96%), Positives = 31/31 (99%)
 Frame = +3

Query: 123 HNIRNMSVIAHVDHGKSTLTDSLVAAAGIMA 215
           HNIRNMSVIAHVDHGKSTLTDSLVAAAGI+A
Sbjct: 17  HNIRNMSVIAHVDHGKSTLTDSLVAAAGIIA 47



EST assemble image


clone accession position
1 MXL078f06_r BP097622 1 491
2 MXL068c11_r BP096989 1 520
3 HCL072f10_r AV643608 5 659
4 HCL080h11_r AV644056 6 640
5 MXL041h04_r BP095442 13 504
6 MXL063g05_r BP096723 24 542
7 MXL012a03_r BP093682 49 586
8 CL42d09_r AV395487 53 617
9 MXL094d03_r BP098506 67 596
10 MXL066g10_r BP096905 77 628
11 MXL010d09_r BP093578 77 406
12 LCL047c05_r AV628798 77 575
13 LCL080h10_r AV630573 79 563
14 LCL009d01_r AV626454 80 517
15 LCL022c09_r AV627180 80 587
16 LCL009c02_r AV626446 80 633
17 LCL061h02_r AV629604 80 569
18 LCL048d05_r AV628880 80 453
19 LCL022h02_r AV627216 80 511
20 LCL046a12_r AV628715 81 526
21 LCL088b06_r AV631051 81 620
22 LCL095b08_r AV631502 81 614
23 LCL012g12_r AV626642 81 613
24 LCL026h09_r AV627448 82 513
25 LCL030c09_r AV627667 82 478
26 MXL037g11_r BP095197 82 370
27 LCL029g01_r AV627628 82 637
28 LCL028g06_r AV627572 82 448
29 LCL003b04_r AV626146 83 442
30 LCL099a06_r AV631739 84 599
31 MXL082g05_r BP097875 86 548
32 CL05f01_r AV393562 94 666
33 MXL059f11_r BP096497 94 515
34 MXL002c10_r BP093025 94 578
35 MXL043h10_r BP095564 94 599
36 CL39c04_r AV395182 94 622
37 MXL029f01_r BP094783 94 514
38 MXL094d05_r BP098507 94 485
39 MXL067d11_r BP096945 94 518
40 MXL006d01_r BP093295 94 590
41 HCL066e11_r AV643267 95 659
42 CL24g06_r AV394451 95 537
43 CL17c11_r AV394096 95 599
44 LCL097g04_r AV631658 96 356
45 CL17b01_r AV394100 96 583
46 LCL049c08_r AV628942 96 401
47 HCL070h04_r AV643508 96 597
48 CL55g08_r AV396029 96 646
49 MXL100h10_r BP098892 96 610
50 LCL002g03_r AV626123 96 613
51 HCL038h10_r AV641701 96 608
52 HCL077e07_r AV643874 96 612
53 MXL057d03_r BP096356 96 607
54 MXL047h05_r BP095817 96 606
55 HCL066e07_r AV643264 96 605
56 CL49h04_r AV397737 96 630
57 LCL010a09_r AV626489 96 400
58 MXL075g09_r BP097443 96 500
59 MXL041e11_r BP095425 96 499
60 HCL058g08_r AV642826 96 602
61 LCL037h11_r AV628185 96 370
62 HCL050h10_r AV642387 96 611
63 LCL020f11_r AV627075 96 598
64 HCL036e01_r AV641568 96 596
65 HCL055d08_r AV642652 96 612
66 MXL092g04_r BP098398 96 494
67 MXL016c08_r BP093962 96 613
68 MXL085c07_r BP098010 96 614
69 HCL030h05_r AV641274 96 394
70 CL17f07_r AV394136 96 642
71 MXL081f05_r BP097807 96 589
72 CL55d01_r AV396065 96 614
73 MXL009c06_r BP093500 96 587
74 LCL098e08_r AV631710 96 586
75 MXL006c06_r BP093291 96 491
76 MXL078h03_r BP097638 96 490
77 LCL018e02_r AV626939 96 643
78 MXL090c09_r BP098257 96 488
79 LCL081h11_r AV630640 96 390
80 HCL004b08_r AV639741 96 384
81 HCL051e05_r AV642421 96 588
82 MXL060g06_r BP096560 96 481
83 MXL016a01_r BP093938 96 480
84 MXL076h03_r BP097499 96 582
85 MXL016d03_r BP093967 96 581
86 LCL072f04_r AV630079 96 479
87 HCL004g02_r AV639769 96 378
88 MXL009c11_r BP093505 96 467
89 MXL008f06_r BP093456 96 654
90 LCL008d04_r AV626394 96 578
91 LCL058a12_r AV629402 96 576
92 LCL095f08_r AV631526 96 654
93 MXL099h03_r BP098830 96 454
94 HCL054e11_r AV642603 96 662
95 HCL025b08_r AV640947 96 570
96 HCL003c03_r AV639695 96 661
97 CL31h03_r AV395011 96 666
98 MXL002c08_r BP093024 96 565
99 HCL088f03_r AV644441 96 669
100 CL15a09_r AV393984 96 622
101 HCL066a12_r AV643234 96 673
102 HCL062h07_r AV643050 96 625
103 MXL003c03_r BP093090 96 447
104 MXL059f03_r BP096491 96 542
105 HCL039c07_r AV641719 96 642
106 MXL049a10_r BP095904 96 535
107 HCL079c09_r AV643967 96 218
108 MXL030a06_r BP094805 96 273
109 HCL011a07_r AV640136 96 533
110 MXL031h04_r BP094895 96 443
111 MXL004f07_r BP093180 96 239
112 HCL036g04_r AV641581 96 654
113 HCL016h06_r AV640470 96 526
114 MXL071h02_r BP097209 96 520
115 HCL064h06_r AV643164 96 250
116 MXL052h03_r BP096109 96 519
117 MXL072e11_r BP097253 96 518
118 HCL050g11_r AV642378 96 631
119 HCL098g10_r AV645147 96 517
120 CL61d10_r AV396340 96 630
121 HCL030a11_r AV641223 96 256
122 HCL024a10_r AV640883 96 305
123 LCL004d07_r AV626214 96 313
124 HCL004e02_r AV639756 96 329
125 MXL081e09_r BP097802 96 515
126 MXL012h02_r BP093738 96 513
127 MXL024e09_r BP094534 96 410
128 MXL021b07_r BP094317 96 510
129 MXL092g02_r BP098396 96 508
130 HCL050g04_r AV642375 97 612
131 MXL038e04_r BP095231 97 274
132 HCL062g09_r AV643045 97 632
133 LCL027a05_r AV627454 97 583
134 MXL014h07_r BP093865 98 647
135 MXL002g03_r BP093056 98 613
136 HCL068g01_r AV643386 98 622
137 HCL005f07_r AV639824 98 576
138 MXL005c02_r BP093222 98 652
139 CL33g06_r AV394994 98 659
140 CL06g04_r AV393603 100 661
141 MXL079h03_r BP097699 102 501
142 MXL054e08_r BP096202 102 538
143 CL20g01_r AV394315 103 593
144 HCL045g06_r AV642107 103 432
145 MXL065b02_r BP096800 103 589
146 MXL067a04_r BP096912 103 537
147 HCL073a09_r AV643629 103 403
148 HCL065g08_r AV643217 103 627
149 MXL070g10_r BP097143 103 472
150 MXL033b03_r BP094948 105 485
151 MXL038b11_r BP095216 106 456
152 CL31d01_r AV395037 106 653
153 MXL050h03_r BP096002 108 639
154 MXL031h09_r BP094898 110 503
155 CL11h08_r AV393781 110 642
156 MXL001f04_r BP092974 114 639
157 HCL029g03_r AV641206 114 648
158 MXL066d08_r BP096882 114 631
159 MXL026g06_r BP094664 114 329
160 LCL080h06_r AV630569 115 583
161 CL39b10_r AV395196 116 602
162 HCL002h01_r AV639672 118 473
163 HCL091e10_r AV644636 121 654
164 HCL096d09_r AV644980 122 526
165 CL77g12_r AV397261 128 657
166 HCL004e01_r AV639755 133 489
167 MXL082g09_r BP097878 133 640
168 LCL073a02_r AV630093 150 570
169 HCL052c04_r AV642461 151 684
170 LCL008h11_r AV626433 162 656
171 HCL064c03_r AV643128 163 658
172 CL24d03_r AV394434 163 682
173 MXL010a12_r BP093556 166 512
174 MXL012f08_r BP093722 178 513
175 HCL060b07_r AV642900 205 719
176 MXL042e07_r BP095481 216 612
177 CL59a12_r AV397915 217 669
178 CL53c04_r AV395975 218 768
179 LCL099d11_r AV631765 221 760
180 MXL056d03_r BP096307 226 728
181 HCL004g11_r AV639774 229 583
182 HCL059d11_r AV642862 229 538
183 HCL044a01_r AV642015 239 648
184 LCL092d11_r AV631350 255 710
185 CL13a04_r AV393931 257 654
186 MXL026f12_r BP094663 263 511
187 LCL016a10_r AV626824 271 578
188 HCL006a10_r AV639846 273 740
189 LCL015h02_r AV626811 273 764
190 HCL037d02_r AV641610 277 710
191 CL12h01_r AV393833 279 769
192 LCL021h12_r AV627155 285 480
193 MXL039c08_r BP095279 303 725
194 LCL079c05_r AV630465 340 480
195 CL57g05_r AV396254 345 904
196 HCL065c05_r AV643186 346 902
197 HCL096a03_r AV644960 346 786
198 CL25h12_r AV394565 346 901
199 CL01a02_r AV393304 346 889
200 HCL095d09_r AV644911 348 824
201 HCL057b02_r AV642744 364 865
202 CL40e06_r AV395386 364 900
203 MXL065g01_r BP096840 366 755
204 CL22e06_r AV394233 376 941
205 LCL008f04_r AV626407 407 941
206 LCL012d11_r AV626622 421 937
207 HCL086e12_r AV644335 421 923
208 CL32e03_r AV394863 421 944
209 HCL064g04_r AV394863 432 776
210 LCL074d09_r AV630154 439 776
211 LCL035b12_r AV628005 440 941
212 CL41d04_r AV395418 446 876
213 LCL057d03_r AV629360 453 1018
214 HCL011e09_r AV640169 459 993
215 HCL008f01_r AV640001 460 961
216 CL01c02_r AV393306 464 965
217 LCL045e04_r AV628676 474 762
218 LCL011h04_r AV626584 481 671
219 LCL071a08_r AV630013 484 786
220 HCL035h12_r AV641545 484 937
221 LCL011b04_r AV626551 491 777
222 HCL047a06_r AV642183 501 808
223 CL63g02_r AV396533 506 1047
224 LCL040a03_r AV628315 508 987
225 HCL085g09_r AV644298 518 1001
226 HCL079b12_r AV643963 523 988
227 HCL035f11_r AV641532 523 992
228 LCL008d05_r AV626395 531 980
229 LCL073f03_r AV630125 546 980
230 MXL098f03_r BP098757 577 1079
231 MXL055h01_r BP096275 582 968
232 CL39d05_r AV395187 595 1116
233 HCL059f02_r AV642868 602 1104
234 LCL052a06_r AV629099 668 1183
235 MXL079h12_r BP097703 685 1145
236 CL24f03_r AV394435 702 1177
237 CL24f04_r AV394425 702 1209
238 LCL042f03_r AV628485 757 1228
239 MXL038c10_r BP095225 758 1256
240 LCL054h07_r AV629232 764 1300
241 LCL054c08_r AV629203 764 1269
242 LCL043e03_r AV628540 772 1235
243 LCL066d01_r AV629797 928 1420
244 HCL100c11_r AV645259 954 1368
245 HCL089h10_r AV644518 978 1502
246 HCL047g09_r AV642226 1016 1276
247 MXL078e11_r BP097619 1016 1481
248 MXL068e03_r BP097000 1079 1410
249 MXL052d04_r BP096085 1155 1490
250 LCL076g10_r AV630293 1197 1696
251 LC077g03_r AV624437 1313 1696
252 MXL059g11_r BP096505 1387 1788
253 HCL042e12_r AV641928 1392 1878
254 MXL018g11_r BP094152 1431 1877
255 MXL003h07_r BP093134 1444 1735
256 LCL036h11_r AV628115 1453 1978
257 MXL068h11_r BP097031 1513 1904
258 MX235b11_r BP091194 1533 1819
259 MXL024b07_r BP094506 1665 1914
260 LC060f12_r AV623228 1673 2068
261 LCL074e01_r AV630158 1696 2062
262 HC086d12_r AV638443 1759 2243
263 LC010d08_r AV619587 1805 2261
264 CM009a06_r AV397687 1817 2434
265 MX236g06_r BP091309 1833 2256
266 LCL041c11_r AV628408 1916 2408
267 HCL096d08_r AV644979 1929 2146
268 CM089d01_r AV392225 1967 2570
269 MXL058c10_r BP096412 1988 2383
270 LCL031e01_r AV627750 1999 2328
271 CM075d04_r AV391610 2014 2635
272 HCL070a06_r AV643458 2035 2301
273 HC068d03_r AV637076 2154 2632
274 LCL019d03_r AV626986 2188 2693
275 LCL071h03_r AV630042 2194 2483
276 HC019b02_r AV633295 2214 2640
277 CM061a08_r AV390606 2223 2877
278 CL43c10_r AV395547 2232 2880
279 CM076d06_r AV391729 2240 2862
280 HCL023e10_r AV640854 2248 2638
281 CM056f10_r AV390330 2259 2900
282 CM024f05_r AV388267 2307 2870
283 LC068e03_r AV623776 2327 2816
284 LC083f06_r AV624855 2338 2898
285 CM025h01_r AV388116 2357 2894
286 MX259h07_r BP092843 2436 2885
287 MX058c08_r BP088345 2479 2889
288 MX238b01_r BP091396 2489 2781
289 CM020f01_r AV397496 2492 3118
290 MX104a02_r BP089028 2494 2939
291 MXL097f12_r BP098706 2556 3010
292 HC098e12_r AV639377 2650 3061
293 CL46g11_r AV395638 2817 3330
294 MX051h04_r BP088109 2918 3255
295 MX052a08_r BP088116 2918 3273
296 CL09c10_r AV393722 2930 3410
297 CL09g08_r AV393731 2936 3410
298 MXL026b11_r BP094639 2969 3283
299 MXL083c03_r BP097904 3014 3448
300 MX025a10_r BP087095 3037 3409
301 CM030b01_r AV397380 3068 3670
302 CL19f08_r AV394208 3077 3600
303 CM058a05_r AV390390 3100 3625
304 CL66d10_r AV396749 3114 3675
305 CM087h12_r AV392457 3130 3680
306 CM093h03_r AV392972 3158 3699
307 HCL074c12_r AV643694 3162 3658
308 MX250a11_r BP092126 3163 3662
309 CL63d04_r AV396512 3178 3686
310 HCL065a01_r AV643169 3180 3663
311 HCL061g12_r AV642992 3197 3662
312 HC058a06_r AV636326 3201 3658
313 HCL030e02_r AV641249 3253 3670
314 HC053c12_r AV635959 3255 3662
315 MXL004g11_r BP093192 3274 3670
316 LCL002d04_r AV626100 3303 3720
317 MXL049h02_r BP095945 3305 3679
318 CL41f05_r AV395404 3315 3659
319 HC097a12_r AV395404 3528 3804




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research