AV553177 ( RZ55h06R )

[UP]


[1][TOP]
>UniRef100_C0Z304 AT2G21660 protein n=2 Tax=Arabidopsis thaliana RepID=C0Z304_ARATH
          Length = 115

 Score =  233 bits (594), Expect = 5e-60
 Identities = 104/104 (100%), Positives = 104/104 (100%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS
Sbjct: 12  DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 71

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW
Sbjct: 72  GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 115

[2][TOP]
>UniRef100_Q03250 Glycine-rich RNA-binding protein 7 n=1 Tax=Arabidopsis thaliana
           RepID=GRP7_ARATH
          Length = 176

 Score =  233 bits (594), Expect = 5e-60
 Identities = 104/104 (100%), Positives = 104/104 (100%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS
Sbjct: 73  DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 132

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW
Sbjct: 133 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 176

[3][TOP]
>UniRef100_B6VA25 Putative glycine-rich RNA-binding protein n=1 Tax=Chorispora
           bungeana RepID=B6VA25_CHOBU
          Length = 175

 Score =  194 bits (494), Expect = 2e-48
 Identities = 91/103 (88%), Positives = 91/103 (88%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGRSITVNEAQSRGSGGGGG RGGGGGGYRSGGGGGY GGGGSYGGGGGRRE  GGYS
Sbjct: 73  DLDGRSITVNEAQSRGSGGGGGGRGGGGGGYRSGGGGGYGGGGGSYGGGGGRRE--GGYS 130

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGGGY SRGGGGG YGGG     GGYGGGE GGYGGSGGGGG
Sbjct: 131 GGGGGYPSRGGGGGGYGGGGGRREGGYGGGESGGYGGSGGGGG 173

[4][TOP]
>UniRef100_Q3EBX0 Putative uncharacterized protein At2g21660.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q3EBX0_ARATH
          Length = 159

 Score =  184 bits (467), Expect = 3e-45
 Identities = 87/104 (83%), Positives = 87/104 (83%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGRSITVNEAQSRGSGGGGGHRGG                 GSYGGGGGRREGGGGYS
Sbjct: 73  DLDGRSITVNEAQSRGSGGGGGHRGG-----------------GSYGGGGGRREGGGGYS 115

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW
Sbjct: 116 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 159

[5][TOP]
>UniRef100_P49311 Glycine-rich RNA-binding protein GRP2A n=1 Tax=Sinapis alba
           RepID=GRP2_SINAL
          Length = 169

 Score =  176 bits (447), Expect = 6e-43
 Identities = 89/104 (85%), Positives = 89/104 (85%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGRSITVNEAQSRGSG GGG RGGGGG YR  GGGGY GGGG YGGG  RREGGG YS
Sbjct: 73  DLDGRSITVNEAQSRGSGAGGGGRGGGGG-YR--GGGGYGGGGGGYGGG--RREGGG-YS 126

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGGGYSSRGGGGG YGGG R  GGGYGGGEGGGYGG GGGGGW
Sbjct: 127 GGGGGYSSRGGGGGGYGGGGRRDGGGYGGGEGGGYGG-GGGGGW 169

[6][TOP]
>UniRef100_P49310 Glycine-rich RNA-binding protein GRP1A n=1 Tax=Sinapis alba
           RepID=GRP1_SINAL
          Length = 166

 Score =  173 bits (439), Expect = 5e-42
 Identities = 87/104 (83%), Positives = 87/104 (83%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGRSITVNEAQSRGSGGGGG R GGGGGYRSGGGGGY GGGG YGGGG  RE  GGYS
Sbjct: 73  DLDGRSITVNEAQSRGSGGGGGGR-GGGGGYRSGGGGGYGGGGGGYGGGG--RE--GGYS 127

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGGGYSSRGGGGG YGGG R       GGEGGGYGGSGGGGGW
Sbjct: 128 GGGGGYSSRGGGGGGYGGGGRR-----DGGEGGGYGGSGGGGGW 166

[7][TOP]
>UniRef100_Q03251-2 Isoform 2 of Glycine-rich RNA-binding protein 8 n=1 Tax=Arabidopsis
           thaliana RepID=Q03251-2
          Length = 110

 Score =  157 bits (398), Expect = 3e-37
 Identities = 79/106 (74%), Positives = 81/106 (76%), Gaps = 2/106 (1%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYS-GGGGSYGGGGGRREGGGGY 178
           +LDGR ITVNEAQSRGSGGGGG RGG GGGYRSGGGGGYS GGGG Y GG     GGGGY
Sbjct: 12  ELDGRVITVNEAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGG-----GGGGY 66

Query: 179 SGGGGGYSSRGGGGG-SYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
               GGY S GGGGG  YGGG R  GGGYGGG+GG YG  GGGGGW
Sbjct: 67  ERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYG--GGGGGW 110

[8][TOP]
>UniRef100_Q03251 Glycine-rich RNA-binding protein 8 n=2 Tax=Arabidopsis thaliana
           RepID=GRP8_ARATH
          Length = 169

 Score =  157 bits (398), Expect = 3e-37
 Identities = 79/106 (74%), Positives = 81/106 (76%), Gaps = 2/106 (1%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYS-GGGGSYGGGGGRREGGGGY 178
           +LDGR ITVNEAQSRGSGGGGG RGG GGGYRSGGGGGYS GGGG Y GG     GGGGY
Sbjct: 71  ELDGRVITVNEAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGG-----GGGGY 125

Query: 179 SGGGGGYSSRGGGGG-SYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
               GGY S GGGGG  YGGG R  GGGYGGG+GG YG  GGGGGW
Sbjct: 126 ERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYG--GGGGGW 169

[9][TOP]
>UniRef100_C0Z2N6 AT2G21660 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2N6_ARATH
          Length = 153

 Score =  156 bits (394), Expect = 8e-37
 Identities = 78/104 (75%), Positives = 78/104 (75%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGRSITVNEAQSRGSGGGGGHRGG        GGGGY  GGG            GGYS
Sbjct: 73  DLDGRSITVNEAQSRGSGGGGGHRGG--------GGGGYRSGGG------------GGYS 112

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGG Y   GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW
Sbjct: 113 GGGGSY---GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 153

[10][TOP]
>UniRef100_Q6YNS1 Putative glycine-rich RNA-binding protein n=1 Tax=Prunus avium
           RepID=Q6YNS1_PRUAV
          Length = 178

 Score =  144 bits (364), Expect = 2e-33
 Identities = 77/109 (70%), Positives = 79/109 (72%), Gaps = 5/109 (4%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQSRGSGGGGG   G GGGY  GGGGG  GGGG YGGGG R  GGGGYS
Sbjct: 73  NLDGRNITVNEAQSRGSGGGGG---GNGGGYSRGGGGGGYGGGGGYGGGGRREGGGGGYS 129

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG---YGGSGG--GGGW 313
            GGGG     GGGG  GGGRRE  GGYGGGEGGG     GSGG  GG W
Sbjct: 130 RGGGGGGYGSGGGGYGGGGRRE--GGYGGGEGGGARYSRGSGGSEGGSW 176

[11][TOP]
>UniRef100_Q99070 Glycine-rich RNA-binding protein 2 n=1 Tax=Sorghum bicolor
           RepID=GRP2_SORBI
          Length = 168

 Score =  144 bits (364), Expect = 2e-33
 Identities = 76/106 (71%), Positives = 80/106 (75%), Gaps = 2/106 (1%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVN+AQSRG GGGGG  GGGGGGY    GGGY GGGG Y   GGRREGGGGY 
Sbjct: 73  ELDGRNITVNQAQSRGGGGGGGGYGGGGGGYGGREGGGYGGGGGGY---GGRREGGGGY- 128

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG--GGGW 313
            GGGGY   GGGGG YGG  REGGGGYGG  GGGYGG+ G  GG W
Sbjct: 129 -GGGGY---GGGGGGYGG--REGGGGYGG--GGGYGGNRGDSGGNW 166

[12][TOP]
>UniRef100_A6G232 RNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1
           RepID=A6G232_9DELT
          Length = 136

 Score =  144 bits (363), Expect = 3e-33
 Identities = 74/102 (72%), Positives = 76/102 (74%), Gaps = 2/102 (1%)
 Frame = +2

Query: 5   LDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGY-- 178
           +DGR+I VNEA  RG GGGGG RGGGGGG R GGGGGY GGGG YGGGGG R GGGG   
Sbjct: 36  VDGRAIRVNEANERGGGGGGG-RGGGGGG-RGGGGGGYGGGGGGYGGGGGGRGGGGGGYG 93

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
            GGGGG   RGGGGG   GGR  GGGGYGGG GGG GG GGG
Sbjct: 94  GGGGGGRGGRGGGGGGGRGGRGGGGGGYGGGGGGG-GGYGGG 134

[13][TOP]
>UniRef100_Q05966 Glycine-rich RNA-binding protein 10 n=1 Tax=Brassica napus
           RepID=GRP10_BRANA
          Length = 169

 Score =  142 bits (358), Expect = 1e-32
 Identities = 74/107 (69%), Positives = 77/107 (71%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG---GGGGRREGGG 172
           +LDGR+ITVNEAQSRG GGGGG    GGGGY   GGGGY GGGG YG   GGGG   GGG
Sbjct: 71  ELDGRTITVNEAQSRGGGGGGGR---GGGGYGGRGGGGYGGGGGGYGDRRGGGGYGSGGG 127

Query: 173 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           G   GGGGY S  GGGG  GGG R  GGGYGGG+ GGYGG  GGGGW
Sbjct: 128 G--RGGGGYGS--GGGGYGGGGGRRDGGGYGGGD-GGYGGGSGGGGW 169

[14][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score =  140 bits (353), Expect = 4e-32
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPPLP
Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLP 676

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/87 (68%), Positives = 60/87 (68%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           PPPPLPP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  PP
Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295

Query: 126 PPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP  PPPPP   PPPPPP  PPPPP P
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPP 322

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 656

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 659

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 665

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 666

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 667

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 669

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 671

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 672

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 673

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 674

 Score =  137 bits (345), Expect = 4e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPPL   PPPPP  PPPPP P
Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPP 692

 Score =  137 bits (345), Expect = 4e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP LP
Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P P  PPPPP   PPPPPP  PPPPP P
Sbjct: 677 PSPPPPPPPPPPPPPPPPPPPPPPPPHP 704

 Score =  136 bits (343), Expect = 6e-31
 Identities = 65/103 (63%), Positives = 65/103 (63%), Gaps = 1/103 (0%)
 Frame = -3

Query: 351 TFIG-NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLY 175
           T IG NP P      P PPP PP PP  PPP PPPP   PPP LPPPPP    PPPPP  
Sbjct: 203 TVIGYNPPP------PSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPP 256

Query: 174 PPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPP   PPPPP  PPPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299

 Score =  135 bits (340), Expect = 1e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PP PPP  PPPPP P
Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPP 690

 Score =  135 bits (339), Expect = 2e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP  LPP PP  P
Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPP P P
Sbjct: 684 PPPPPPPPPPPPPPPPPPPHPPPPSPPP 711

 Score =  134 bits (338), Expect = 2e-30
 Identities = 61/98 (62%), Positives = 63/98 (64%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
           +P P   +  PP PP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP 
Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287

Query: 159 RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPPP  PPPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

 Score =  134 bits (338), Expect = 2e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   P PPPP  PPPPP P
Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPP 691

 Score =  134 bits (338), Expect = 2e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PP PP   PPPPPP  PPPPP P
Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPP 698

 Score =  134 bits (337), Expect = 3e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPP P  PPPPP P
Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPP 685

 Score =  134 bits (337), Expect = 3e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPP PP  PPPPP P
Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPP 686

 Score =  134 bits (337), Expect = 3e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP  PPPPP   PPPPPP  PPPPP P
Sbjct: 675 LPPSPPPPPPPPPPPPPPPPPPPPPPPP 702

 Score =  134 bits (336), Expect = 4e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           P PPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

 Score =  134 bits (336), Expect = 4e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  P PPP   PPPPPP  PPPPP P
Sbjct: 672 PPPLPPSPPPPPPPPPPPPPPPPPPPPP 699

 Score =  134 bits (336), Expect = 4e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P P  PPPPP   PPPPPP  PPPPP P
Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPP 701

 Score =  133 bits (335), Expect = 5e-30
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           PPPP PP PPPSPPP  PPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  PP
Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283

Query: 126 PPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP  PPPPP   PPPPPP  PPPPP P
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPP 310

 Score =  132 bits (332), Expect = 1e-29
 Identities = 60/92 (65%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

Query: 129 PPPE*PPPPP----LRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP       PPPPPP  PPPPP P
Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 50/83 (60%), Positives = 50/83 (60%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP P PPS       PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 658 PPPPPPPP-PPPPPPPPPLPPS-------PPPPP----PPPPP--PPPP---PPPPP--P 698

Query: 129 PPPE*PPPPPLRYPPPPPPRWPP 61
           PPP  PPPP    PPP  P  PP
Sbjct: 699 PPPPHPPPPS---PPPLVPALPP 718

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 40/64 (62%), Positives = 41/64 (64%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPPLPP PPP PPP PPPP        PPPPP    PPPPP +PPPPS  PP  P LP
Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPP-------PPPPP----PPPPPPHPPPPSP-PPLVPALP 717

Query: 129 PPPE 118
           P  E
Sbjct: 718 PSCE 721

[15][TOP]
>UniRef100_Q2VCI6 Putative glycine-rich RNA binding protein-like n=1 Tax=Solanum
           tuberosum RepID=Q2VCI6_SOLTU
          Length = 178

 Score =  140 bits (353), Expect = 4e-32
 Identities = 80/114 (70%), Positives = 81/114 (71%), Gaps = 11/114 (9%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGG--GGGYRSGGGGGYSGGGGSYGGGGGRREGGGG 175
           DLDGR+ITVNEAQSRG GGGGG RGGG  GGG R GGGGGY GGGG    GGGRREG   
Sbjct: 71  DLDGRNITVNEAQSRGGGGGGGGRGGGGYGGGRREGGGGGYGGGGGY---GGGRREG--- 124

Query: 176 YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGS---------GGGGG 310
             GGGGGYS   GGGG YGGGRRE  GGYGGG GGGYGG          GGGGG
Sbjct: 125 --GGGGGYS---GGGGGYGGGRRE--GGYGGG-GGGYGGGDRYSDRSSRGGGGG 170

[16][TOP]
>UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q0P2_IXOSC
          Length = 170

 Score =  139 bits (351), Expect = 7e-32
 Identities = 61/89 (68%), Positives = 61/89 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 11  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
           PPP  PPPPP   PPPPPP  PPPPP PR
Sbjct: 71  PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 99

 Score =  138 bits (347), Expect = 2e-31
 Identities = 63/100 (63%), Positives = 63/100 (63%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLPRD*ASLTVMLRP 10
           PPP  PPPPP   PPPPPP  PPPPP P       V  RP
Sbjct: 66  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRP 105

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 61  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 62  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 63  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 64  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 65  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92

 Score =  113 bits (282), Expect = 7e-24
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 36  PPPPPPPPPPPPPPPPPPPPP---PPP--PPPPP----PPPPP--PPPPPPPPPPPP--P 82

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPL 49
           PPP  PPPPP   PPPPPPR     PL
Sbjct: 83  PPPPPPPPPP---PPPPPPRLVTSRPL 106

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 50/99 (50%), Positives = 51/99 (51%), Gaps = 12/99 (12%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP RL    P L 
Sbjct: 58  PPPPPPPPPPPPPPPPPPPPP---PPP--PPPPP----PPPPPPPPPPPPRLVTSRP-LS 107

Query: 129 PPPE*PPPPPLR--------YPPPPPPRWPP----PPPL 49
                P P  LR         P P PP + P    P PL
Sbjct: 108 ALFARPVPRDLREMVWSGGDSPAPEPPFYAPRGNDPAPL 146

[17][TOP]
>UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PKI2_IXOSC
          Length = 154

 Score =  138 bits (347), Expect = 2e-31
 Identities = 60/89 (67%), Positives = 61/89 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 19  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
           PPP  PPPPP   PPPPPP  PPPPP P+
Sbjct: 79  PPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 107

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 61  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 62  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 63  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 64  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 65  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 66  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 7   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 67  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 8   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 68  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 9   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 69  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 10  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 70  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 11  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 71  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 12  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 72  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 99

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 13  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 73  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 14  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 74  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 15  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 75  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 102

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 16  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 76  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 103

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 17  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 77  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 104

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 18  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 78  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 105

 Score =  137 bits (345), Expect = 4e-31
 Identities = 60/90 (66%), Positives = 61/90 (67%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 20  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLPRD 40
           PPP  PPPPP   PPPPPP  PPPPP  R+
Sbjct: 80  PPPPPPPPPPPPPPPPPPPPPPPPPPPQRE 109

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 37/57 (64%), Positives = 37/57 (64%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP 139
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP R   P P
Sbjct: 66  PPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPP----PPPPP--PPPPQREHLPVP 114

[18][TOP]
>UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae
            RepID=UPI000186983E
          Length = 1411

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 854  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 914  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 941

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 855  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 915  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 942

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 856  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 916  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 943

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 857  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 917  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 944

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 858  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 918  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 945

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 859  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 919  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 946

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 860  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 920  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 947

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 861  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 921  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 948

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 862  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 922  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 949

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 863  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 923  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 950

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 864  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 924  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 951

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 865  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 925  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 952

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 866  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 926  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 953

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 867  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 927  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 954

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 868  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 928  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 955

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 869  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 929  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 956

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 870  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 930  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 957

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 871  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 931  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 958

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 872  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 932  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 959

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 873  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 933  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 960

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 874  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 934  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 961

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 875  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 935  PPPPPPPPPPPPPPPPPPPPPPPPPPPP 962

 Score =  136 bits (343), Expect = 6e-31
 Identities = 59/86 (68%), Positives = 59/86 (68%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 884  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPP 52
            PPP  PPPPP   PPPPPP  PPPPP
Sbjct: 944  PPPPPPPPPPPPPPPPPPPGAPPPPP 969

 Score =  135 bits (340), Expect = 1e-30
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 883  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPPP   PPPPPP   PPPP P
Sbjct: 943  PPPPPPPPPPPPPPPPPPPPGAPPPPPP 970

 Score =  134 bits (337), Expect = 3e-30
 Identities = 60/90 (66%), Positives = 60/90 (66%), Gaps = 2/90 (2%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 892  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951

Query: 129  PPPE*PPPPPLRYPPPPPPRWPP--PPPLP 46
            PPP  PPPPP   PPPPPP  PP  PPP P
Sbjct: 952  PPPPPPPPPPPGAPPPPPPALPPGAPPPPP 981

 Score =  132 bits (332), Expect = 1e-29
 Identities = 61/99 (61%), Positives = 61/99 (61%), Gaps = 8/99 (8%)
 Frame = -3

Query: 318  NYHPPP--------PPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
            NY P P        PP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP
Sbjct: 840  NYEPAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899

Query: 162  SRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
               PPPPP  PPPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 900  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 50/83 (60%), Positives = 50/83 (60%), Gaps = 8/83 (9%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP LP
Sbjct: 925  PPPPPPPPPPPPPPPPPPPPP---PPP--PPPPP----PPPPP--PPPPGAPPPPPPALP 973

Query: 129  PPPE*PPPPPL--------RYPP 85
            P    PPPPP          YPP
Sbjct: 974  PGA--PPPPPALPCFHEGQEYPP 994

[19][TOP]
>UniRef100_Q38M49 Putative glycine-rich RNA binding protein-like n=1 Tax=Solanum
           tuberosum RepID=Q38M49_SOLTU
          Length = 176

 Score =  137 bits (344), Expect = 5e-31
 Identities = 79/116 (68%), Positives = 79/116 (68%), Gaps = 13/116 (11%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGY----RSGGGGGYSGGGGSYGGGGGRREGG 169
           DLDGR ITVNEAQSRG GGGGG  G GGGGY    R GGGGGY GGGG    GGGRREG 
Sbjct: 67  DLDGRKITVNEAQSRGGGGGGGGGGRGGGGYVRWRREGGGGGYGGGGGY---GGGRREG- 122

Query: 170 GGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGS---------GGGGG 310
               GGGGGYS   GGGG YGGGRRE  GGYGGG GGGYGG          GGGGG
Sbjct: 123 ----GGGGGYS---GGGGGYGGGRRE--GGYGGG-GGGYGGGDRYSDRSSRGGGGG 168

[20][TOP]
>UniRef100_Q9FUD5 Glycine-rich RNA-binding protein n=1 Tax=Sorghum bicolor
           RepID=Q9FUD5_SORBI
          Length = 170

 Score =  136 bits (342), Expect = 8e-31
 Identities = 76/109 (69%), Positives = 80/109 (73%), Gaps = 5/109 (4%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGG---GGRREGGG 172
           +LDGR+ITVN+AQSRG GGGGG  GGGGGGY     GG   GGG  GGG   GGRREGGG
Sbjct: 73  ELDGRNITVNQAQSRGGGGGGGGYGGGGGGY-----GGRREGGGYGGGGGGYGGRREGGG 127

Query: 173 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG--GGGW 313
           GY  GGGGY   GGGGG Y GGRREGGGGYGG  GGGYGG+ G  GG W
Sbjct: 128 GY--GGGGY---GGGGGGY-GGRREGGGGYGG--GGGYGGNRGDSGGNW 168

[21][TOP]
>UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7QFW8_IXOSC
          Length = 185

 Score =  134 bits (336), Expect = 4e-30
 Identities = 59/86 (68%), Positives = 59/86 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPP 56

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPP 52
           PPP  PPPPP   PPPPPP  PPPPP
Sbjct: 57  PPPPPPPPPPPPPPPPPPPPPPPPPP 82

 Score =  127 bits (320), Expect = 3e-28
 Identities = 57/86 (66%), Positives = 58/86 (67%)
 Frame = -3

Query: 300 PPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPP 121
           PP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  PPPP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 120 E*PPPPPLRYPPPPPPRWPPPPPLPR 43
             PPPPP   PPPPPP  PPPPP P+
Sbjct: 61  PPPPPPP---PPPPPPPPPPPPPPPQ 83

 Score =  120 bits (300), Expect = 6e-26
 Identities = 56/92 (60%), Positives = 56/92 (60%)
 Frame = -3

Query: 279 PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPP 100
           PP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  PPPP  PPPPP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 99  LRYPPPPPPRWPPPPPLPRD*ASLTVMLRPSR 4
              PPPPPP  PPPPP P     L    R SR
Sbjct: 61  PPPPPPPPPPPPPPPPPPPPPPQLCCFGRKSR 92

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 45/71 (63%), Positives = 45/71 (63%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP        PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 33  PPPPPPPPPPPPPPPPPPPPP--------PPPPP----PPPPP--PPPP---PPPPP--P 73

Query: 129 PPPE*PPPPPL 97
           PPP  PPPP L
Sbjct: 74  PPPPPPPPPQL 84

[22][TOP]
>UniRef100_Q8RW11 Putative glycine rich protein n=1 Tax=Rumex obtusifolius
           RepID=Q8RW11_RUMOB
          Length = 168

 Score =  133 bits (334), Expect = 7e-30
 Identities = 70/107 (65%), Positives = 72/107 (67%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSG---GGGSYGGGGGRREGGG 172
           DLDGR+ITVNEAQSRGSGGGGG       GYR GGGGGY G   GG + GGGGG   GGG
Sbjct: 72  DLDGRNITVNEAQSRGSGGGGG-------GYRGGGGGGYGGRREGGYNRGGGGGYGGGGG 124

Query: 173 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GY GGGGGY   GGGGG YGGGRRE  GGYGGG G  Y        W
Sbjct: 125 GYGGGGGGY---GGGGGGYGGGRRE--GGYGGGGGDRYARGNSDSDW 166

[23][TOP]
>UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium
           modesticaldum Ice1 RepID=B0TGJ1_HELMI
          Length = 256

 Score =  132 bits (333), Expect = 9e-30
 Identities = 59/89 (66%), Positives = 59/89 (66%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPP P  PPPP   PPPPP  P
Sbjct: 24  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPP 83

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
           PPP  PPPPP   PPPPPPR  PPPP  R
Sbjct: 84  PPPPPPPPPPPPPPPPPPPRPCPPPPPAR 112

 Score =  130 bits (327), Expect = 5e-29
 Identities = 59/89 (66%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 31  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90

Query: 129 PPPE*PPPPPLRYP-PPPPPRWPPPPPLP 46
           PPP  PPPPP   P PPPPP  P PPP P
Sbjct: 91  PPPPPPPPPPPPRPCPPPPPARPCPPPCP 119

 Score =  124 bits (311), Expect = 3e-27
 Identities = 57/88 (64%), Positives = 58/88 (65%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           P   +PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP R  PPPP  PP
Sbjct: 19  PERIIPPPPPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPP 75

Query: 126 PPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
           PP  PPPPP   PPPPPP  PPPPP PR
Sbjct: 76  PPPPPPPPPPPPPPPPPPPPPPPPPPPR 103

 Score =  105 bits (261), Expect = 2e-21
 Identities = 53/89 (59%), Positives = 53/89 (59%), Gaps = 2/89 (2%)
 Frame = -3

Query: 306 PPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           P  P  P  P    PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  
Sbjct: 10  PKVPYTPIAPERIIPPPPPPPP---PPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPP 62

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP P  PPPPP   PPPPPP  PPPPP P
Sbjct: 63  PPRPCPPPPPPPPPPPPPPPPPPPPPPPP 91

 Score =  104 bits (259), Expect = 3e-21
 Identities = 49/82 (59%), Positives = 50/82 (60%)
 Frame = -3

Query: 291 PP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*P 112
           PP   P  P  P  P R+ PP  PPPPP    PPPPP  PPPP   PPPPP  PPPP  P
Sbjct: 5   PPTGYPKVPYTPIAPERIIPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 111 PPPPLRYPPPPPPRWPPPPPLP 46
           PPPP   PPPPPP  PPPPP P
Sbjct: 61  PPPPRPCPPPPPPPPPPPPPPP 82

 Score =  102 bits (254), Expect = 1e-20
 Identities = 53/104 (50%), Positives = 55/104 (52%), Gaps = 14/104 (13%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR-LPPPPP*L 133
           PPPPP PP PPP P P PPPP   PPP  PPPPP    PPPPP  PPPP R  PPPPP  
Sbjct: 53  PPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPAR 112

Query: 132 PPPPE*PP-------------PPPLRYPPPPPPRWPPPPPLPRD 40
           P PP  PP              P    P P PP  P P P+P +
Sbjct: 113 PCPPPCPPKHECGLPEPCPQVEPIAGEPMPIPPCAPMPMPMPME 156

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 50/101 (49%), Positives = 53/101 (52%), Gaps = 13/101 (12%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP-------SRLP 151
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  P PP         LP
Sbjct: 73  PPPPPPPPPPPPPPPPPPPPP---PPP--PPPPPPRPCPPPPPARPCPPPCPPKHECGLP 127

Query: 150 PPPP*LPP----PPE*PPPPPLRYPPPPPP--RWPPPPPLP 46
            P P + P    P   PP  P+  P P  P  R P P P+P
Sbjct: 128 EPCPQVEPIAGEPMPIPPCAPMPMPMPMEPIGRQPLPIPMP 168

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 43/91 (47%), Positives = 44/91 (48%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPP-PYPPPPSRLPPP*LPPPPPLEE--*PPPPPLYPPPPSRLPPPPP 139
           PPPPP PP PPP PP P PPPP   P P  PP PP  E   P P P   P      P PP
Sbjct: 88  PPPPPPPPPPPPPPPRPCPPPPPARPCP--PPCPPKHECGLPEPCPQVEPIAGEPMPIPP 145

Query: 138 *LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             P P   P  P  R P P P   PP  P+P
Sbjct: 146 CAPMPMPMPMEPIGRQPLPIPMPMPPCAPMP 176

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 42/125 (33%), Positives = 45/125 (36%), Gaps = 48/125 (38%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS---------- 160
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  P PP           
Sbjct: 68  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLP 127

Query: 159 --------------------------------------RLPPPPP*LPPPPE*PPPPPLR 94
                                                  +P PP   P P E     P+ 
Sbjct: 128 EPCPQVEPIAGEPMPIPPCAPMPMPMPMEPIGRQPLPIPMPMPPC-APMPVEPVAREPME 186

Query: 93  YPPPP 79
           + P P
Sbjct: 187 HRPAP 191

[24][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score =  132 bits (333), Expect = 9e-30
 Identities = 61/96 (63%), Positives = 62/96 (64%), Gaps = 1/96 (1%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPP  PP PPPSPPP PPP    PPP  PPPPP    PPPPP  PPPPS 
Sbjct: 414 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 473

Query: 156 LPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
            PP PPP  PPPP  PPPPP   PPPPPP  PPPPP
Sbjct: 474 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509

 Score =  129 bits (323), Expect = 1e-28
 Identities = 62/97 (63%), Positives = 63/97 (64%), Gaps = 2/97 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*-LPPPPPLEE*PPPPPLYPPPPS 160
           P P   +  PPPPP PP PP  PPP PPPPS  PPP   PPPPP    PPPPP  PPPPS
Sbjct: 300 PSPPPPSPPPPPPPSPP-PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 358

Query: 159 RLPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
             PP PPP  PPPP  PPPPP   PPPPPP  PPPPP
Sbjct: 359 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395

 Score =  125 bits (315), Expect = 1e-27
 Identities = 62/102 (60%), Positives = 63/102 (61%), Gaps = 5/102 (4%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS- 160
           P P+     PPPPP P  PPPSPPP  PPP   PPP  PPPPP    PPPPP  PPPPS 
Sbjct: 246 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPP---PPPPSPPPPPPPSPPPPPPPSPPPPSP 302

Query: 159 ---RLPPPPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
                PPPPP  PPPP  PPP PP   PPPPPP  PPPPP P
Sbjct: 303 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 344

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PP-PPPLYPPPPSRLPP-PPP* 136
           PPP P PP PPP PPP PPPP   PPP  PPPPP    PP PPP  PPPPS  PP PPP 
Sbjct: 365 PPPSPPPPSPPPPPPPSPPPP---PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421

Query: 135 LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
            PPPP  PPPPP   PPPPPP  PPPPP
Sbjct: 422 SPPPPSPPPPPPPSPPPPPPPSPPPPPP 449

 Score =  125 bits (314), Expect = 1e-27
 Identities = 61/100 (61%), Positives = 62/100 (62%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPP--PPLYPPPP 163
           P P   +  PPPPP PP PPP  PP PPPPS  PP   PP PP    PPP  PP  PPPP
Sbjct: 367 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 426

Query: 162 SRLPPPPP*LPPPPE*-PPPPPLRYPPPPPPRWPPPPPLP 46
           S  PPPPP  PPPP   PPPPP   PPPPPP  PPPPP P
Sbjct: 427 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 466

 Score =  125 bits (313), Expect = 2e-27
 Identities = 61/96 (63%), Positives = 62/96 (64%), Gaps = 1/96 (1%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPP  PP PPPSPPP PPPPS  PPP  PP PP    PPP P  PPPPS 
Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPP-PPPPSPPPPP--PPSPPPPSPPPPSPPPPPPPSP 315

Query: 156 LPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
            PP PPP  PPPP  PPPPP   PPPPPP  PPPPP
Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351

 Score =  125 bits (313), Expect = 2e-27
 Identities = 61/100 (61%), Positives = 62/100 (62%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPP  PP PPPSPPP PPPPS  PPP   PPPP    P PPP  PPPPS 
Sbjct: 360 PPPSPPPPSPPPPSPPPPPPPSPPP-PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 418

Query: 156 ---LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
               PPPP   PPPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 419 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 458

 Score =  124 bits (312), Expect = 2e-27
 Identities = 57/91 (62%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSR---LPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP 139
           PPP P PP PPP PPP PPPPS     PPP  PPPPP    PPPPP  PPPP    PPPP
Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357

Query: 138 *LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPP   PP PP   PPPPPP  PPPPP P
Sbjct: 358 SPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 388

 Score =  124 bits (312), Expect = 2e-27
 Identities = 59/97 (60%), Positives = 59/97 (60%), Gaps = 9/97 (9%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP---PPP 139
           PPPPP P  PPPSPPP  PPP   PPP  PPPPP    PPPPP  PPPP   PP   PPP
Sbjct: 346 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 405

Query: 138 *LPPPPE*PPP------PPLRYPPPPPPRWPPPPPLP 46
             PPPP  PPP      PP   PPPPPP  PPPPP P
Sbjct: 406 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 442

 Score =  124 bits (310), Expect = 4e-27
 Identities = 60/100 (60%), Positives = 61/100 (61%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP  PPPPP    P PPP  PPPPS 
Sbjct: 200 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP----PSPPPPSPPPPSP 255

Query: 156 LPPPPP*LPPP---PE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPPP  PPP   P  PPPPP   PPPPPP  PPPPP P
Sbjct: 256 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 295

 Score =  124 bits (310), Expect = 4e-27
 Identities = 57/89 (64%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPP--P*L 133
           PPPP PP PPP PPP PPPPS  PP   PPPPP    P PPP  PPPPS  PPPP  P  
Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 340

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPP  PPPPP   PPP PP   PPPP P
Sbjct: 341 PPPPSPPPPPPPSPPPPSPPPPSPPPPSP 369

 Score =  124 bits (310), Expect = 4e-27
 Identities = 57/97 (58%), Positives = 58/97 (59%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP PPP    PPP  PPPPP    PPPPP  PPPP  
Sbjct: 406 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPP  PPP   PP PP   PPPPPP  PPPPP P
Sbjct: 466 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 502

 Score =  124 bits (310), Expect = 4e-27
 Identities = 59/99 (59%), Positives = 60/99 (60%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPPPP PP PPP  PP PPPPS  PPP   PPPP    P PPP  PPPPS 
Sbjct: 429 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 488

Query: 156 LPPPP--P*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPP  P  PPPP  PPPPP   PPP PP   PPPP P
Sbjct: 489 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 527

 Score =  123 bits (309), Expect = 6e-27
 Identities = 58/92 (63%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP---PPP 139
           PPPPP P  PPPSPPP  PPP   PPP  PPPPP    PPPPP  PPPP   PP   PPP
Sbjct: 460 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 519

Query: 138 *LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
             PPPP  PPP PP   PPPPPP  PPPP  P
Sbjct: 520 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 551

 Score =  123 bits (308), Expect = 7e-27
 Identities = 61/107 (57%), Positives = 62/107 (57%), Gaps = 10/107 (9%)
 Frame = -3

Query: 342 GNPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPP-PPLEE*PPPPPLYPPP 166
           G P P   +  PP PP P  PPPSPPP  PPP   PPP  PPP PP    PPPPP  PPP
Sbjct: 188 GIPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 247

Query: 165 PSRLPP---------PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
           PS  PP         PPP  PPPP  PPPPP   PPPPPP  PPPPP
Sbjct: 248 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294

 Score =  123 bits (308), Expect = 7e-27
 Identities = 58/97 (59%), Positives = 59/97 (60%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPPPP PP PPP  PP PPPPS  PP   PP PP    P PPP  PPPPS 
Sbjct: 266 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 325

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP PP  PPPP  PPPPP   PPPPPP  PPPP  P
Sbjct: 326 PPPSPP--PPPPPSPPPPPPPSPPPPPPPSPPPPSPP 360

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/91 (64%), Positives = 59/91 (64%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPP P PP PPP PPP PPPPS  PPP  PPPPP    P PPP  PPPPS  PPPPP  P
Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSP-PPPSPPPPPP----PSPPPPSPPPPSPPPPPPPSPP 282

Query: 129 PPP---E*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP     PPPPP   PP PPP  PPPPP P
Sbjct: 283 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 313

 Score =  122 bits (306), Expect = 1e-26
 Identities = 60/99 (60%), Positives = 61/99 (61%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPP  PP PPPSPPP PPPPS  PPP   PPPP    P PPP  PPPPS 
Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPP-PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 374

Query: 156 LPPPP--P*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPP  P  PPPP  PPPPP   PPP PP   PPPP P
Sbjct: 375 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 413

 Score =  122 bits (306), Expect = 1e-26
 Identities = 57/97 (58%), Positives = 58/97 (59%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPPPP PP PPP  PP PPPPS  PP   PP PP    PPP P  PPPPS 
Sbjct: 323 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 382

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPPP  PPPP   PPPP   PP PPP  PPPP  P
Sbjct: 383 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 419

 Score =  122 bits (305), Expect = 2e-26
 Identities = 60/100 (60%), Positives = 61/100 (61%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
           P P   +  PPPPP PP PPP   PPP PPPPS  PP   PP PP    PPP P  PPPP
Sbjct: 375 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 434

Query: 162 SRLPPPPP*-LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           S  PPPPP   PPPP  PPPPP   PPPPPP  PPPP  P
Sbjct: 435 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 474

 Score =  122 bits (305), Expect = 2e-26
 Identities = 57/89 (64%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPP-PPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPPPP P  PPPSPPP  PPP   PPP  PPP PP    PPPPP  PPPP   PPP P  
Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP---PPPSPPP 446

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPP  PPPPP   PPPPPP  PPP P P
Sbjct: 447 PPPPSPPPPPPPSPPPPPPPSPPPPSPPP 475

 Score =  122 bits (305), Expect = 2e-26
 Identities = 57/97 (58%), Positives = 58/97 (59%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPPPP PP PPP  PP PPPPS  PP   PP PP    PPP P  PPPPS 
Sbjct: 437 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 496

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPPP  PPPP   PPPP   PP PPP  PPPP  P
Sbjct: 497 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 533

 Score =  121 bits (303), Expect = 3e-26
 Identities = 59/99 (59%), Positives = 60/99 (60%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PP--PPPLYPPPP 163
           P P   +  PP PP P  PPPSPPP PPP    PPP  PPPPP    PP  PPP  PPPP
Sbjct: 308 PPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367

Query: 162 SRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           S  PP PP  PPPP  PPPPP   PPPPPP  PPPP  P
Sbjct: 368 SPPPPSPP--PPPPPSPPPPPPPSPPPPPPPSPPPPSPP 404

 Score =  120 bits (301), Expect = 5e-26
 Identities = 58/99 (58%), Positives = 59/99 (59%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPL--YPPPP 163
           P P   +  PP PP P  PPPSPPP  PPP   PPP  PPPPP    PPPPP    PPPP
Sbjct: 391 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 450

Query: 162 SRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           S  PPPPP  PPPP   PPPP   PP PPP  PPPP  P
Sbjct: 451 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 489

 Score =  120 bits (301), Expect = 5e-26
 Identities = 57/92 (61%), Positives = 57/92 (61%), Gaps = 5/92 (5%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLY--PPPPSRLPPPPP*L 133
           PPPP PP PPP PPP PPPPS  PP   PP PP    PPPPP    PPPP   PPPPP  
Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 511

Query: 132 PPPPE*P---PPPPLRYPPPPPPRWPPPPPLP 46
           PPPP  P   PPPP   PP PPP  PPPPP P
Sbjct: 512 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543

 Score =  120 bits (300), Expect = 6e-26
 Identities = 59/98 (60%), Positives = 60/98 (61%), Gaps = 1/98 (1%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPP-PYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
           P P+     PPPP  PP PPPSPP P PPPPS  PPP  PP PP    PPP P  PPPPS
Sbjct: 223 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP--PPSPPPPSPPPPSPPPPPPPS 280

Query: 159 RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPPP  PPPP   PPPP   PP PPP  PP PP P
Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318

 Score =  119 bits (298), Expect = 1e-25
 Identities = 63/103 (61%), Positives = 64/103 (62%), Gaps = 6/103 (5%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*P---PPSPPP-YPPPPSRLPPP*-LPPPPPLEE*PPPPPLYP 172
           P P   +  PPPPP PP P   PPSPPP  PPPPS  PPP   PPPPP    PPPPP  P
Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512

Query: 171 PPPSRLPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPS  PP PPP  PPPP  PPP P   PPPPPP  PPP P P
Sbjct: 513 PPPSPPPPSPPPPSPPPPSPPPPSP---PPPPPPSPPPPSPPP 552

 Score =  118 bits (296), Expect = 2e-25
 Identities = 56/97 (57%), Positives = 57/97 (58%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPPP P  PPPSPPP  PPP   P P  P PPP    PPPPP  PPPP  
Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 287

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPPP  PP P  P PPP   PPPPPP  PPP P P
Sbjct: 288 SPPPPP--PPSPPPPSPPPPSPPPPPPPSPPPPSPPP 322

 Score =  117 bits (294), Expect = 3e-25
 Identities = 56/87 (64%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
           PPP P PP PPP PPP PPPP   PPP  PPPPP    P PPP  PPPPS  PP PPP  
Sbjct: 479 PPPSPPPPSPPPPPPPSPPPP---PPPSPPPPPP----PSPPPPSPPPPSPPPPSPPPPS 531

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPP 52
           PPPP  PPPPP   PPP PP   PPPP
Sbjct: 532 PPPPSPPPPPPPSPPPPSPPPPSPPPP 558

 Score =  109 bits (273), Expect = 8e-23
 Identities = 55/93 (59%), Positives = 56/93 (60%), Gaps = 8/93 (8%)
 Frame = -3

Query: 300 PPLPP*PPPSPPPYPPPPSRLPPP*LP---PPPPLEE*PPPPPLYPPPPSRLPP----PP 142
           P +P  PPPSPPP  PPP   PPP  P   PPPP    P PPP  PPPPS  PP    PP
Sbjct: 187 PGIPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 246

Query: 141 P*LPPPPE*PPPPPLRYPPP-PPPRWPPPPPLP 46
           P  PPPP  PPPPP   PPP PPP  PPPPP P
Sbjct: 247 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 279

 Score =  102 bits (255), Expect = 1e-20
 Identities = 54/94 (57%), Positives = 55/94 (58%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPPP P  PPP PP  PPPP   PPP  P PPP    P PPP  PPPPS 
Sbjct: 479 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP--PSPPP----PSPPPPSPPPPS- 531

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPP 55
             PPPP  PPPP  PP PP   PP PPP  PPPP
Sbjct: 532 --PPPPSPPPPP--PPSPP---PPSPPPPSPPPP 558

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 53/87 (60%), Positives = 53/87 (60%), Gaps = 2/87 (2%)
 Frame = -3

Query: 300 PPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*LPPP 124
           P   P  P  PPP PPPPS  PPP  P PPP    P PPP  PPPPS  PP PPP  PPP
Sbjct: 183 PISTPGIPSPPPPSPPPPS--PPP--PSPPP----PSPPPPSPPPPSPPPPSPPPPSPPP 234

Query: 123 PE*PPPPPLRYPPP-PPPRWPPPPPLP 46
           P  PPPPP   PPP PPP  PPPPP P
Sbjct: 235 PSPPPPPPPSPPPPSPPPPSPPPPPPP 261

[25][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score =  132 bits (333), Expect = 9e-30
 Identities = 63/95 (66%), Positives = 63/95 (66%), Gaps = 7/95 (7%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPP--SRLPPP*LP---PPPPLEE*PPPPPLYPPPPSRLPPP 145
           PPPPP PP PPP PPP PPPP  S  PPP LP   PPPPL   PPPPP  PPPP   PPP
Sbjct: 71  PPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPP 130

Query: 144 PP*LPPPPE--*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP  PPPP    PPPPP   PPPPPP  PPPPP P
Sbjct: 131 PPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSP 165

 Score =  130 bits (327), Expect = 5e-29
 Identities = 67/104 (64%), Positives = 68/104 (65%), Gaps = 7/104 (6%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPP--PPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
           P P   +  PPPPP PP PPPSPPP PP  PPS LPP   PPPPP    PPPPP  PPPP
Sbjct: 10  PPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPS--PPPPPPPSPPPPPPSQPPPP 67

Query: 162 --SRLPPPPP*LPPPPE*P-PPPPLRYPPPPP--PRWPPPPPLP 46
             S  PPPPP  PPPP  P PPPPL  PPPPP  P  PPPPPLP
Sbjct: 68  PSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLP 111

 Score =  129 bits (324), Expect = 1e-28
 Identities = 65/107 (60%), Positives = 66/107 (61%), Gaps = 12/107 (11%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPL-YPPPPS 160
           P P   +  PPPP  PP PP SPPP PPPPS  PPP   PPPPL   PPPPPL  PPPP 
Sbjct: 49  PPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPP 108

Query: 159 RLP---------PPPP*L--PPPPE*PPPPPLRYPPPPPPRWPPPPP 52
            LP         PPPP L  PPPP  PPPPPL  PPPPPP  PPPPP
Sbjct: 109 PLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPP 155

 Score =  128 bits (321), Expect = 2e-28
 Identities = 64/100 (64%), Positives = 65/100 (65%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPP-PPPLEE*PPPPPLYPPPPS 160
           P P   +  PPPPP PP P PSPPP PP PS  PPP LP  PPP    PPPPPL PPPP 
Sbjct: 73  PPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPP 132

Query: 159 RLPPPPP*L--PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPPP L  PPPP  PPPPP   PPPPPP   PPPPLP
Sbjct: 133 PSPPPPPLLSPPPPPPSPPPPPPPSPPPPPP--SPPPPLP 170

 Score =  127 bits (319), Expect = 4e-28
 Identities = 62/108 (57%), Positives = 62/108 (57%), Gaps = 20/108 (18%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPP-SRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPPPPLP  PPP PP  PPPP S  PPP  PPPPPL   PPPPP  PPPP   PPPPP  
Sbjct: 105 PPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPS 164

Query: 132 PPP-------------------PE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP                   P  PPPPP   PPPPPP  PPPPPLP
Sbjct: 165 PPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLP 212

 Score =  126 bits (316), Expect = 9e-28
 Identities = 60/98 (61%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPL--EE*PPPPPLYPPP 166
           +P P   +  PPPPP PP PPPSPPP  PPPS LPPP   PP PL     PPPPP  PPP
Sbjct: 142 SPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPP 201

Query: 165 PSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
           P   PPPPP   PP   PP PPL  PPPPPP  PPPPP
Sbjct: 202 PPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPP 239

 Score =  124 bits (310), Expect = 4e-27
 Identities = 61/102 (59%), Positives = 61/102 (59%), Gaps = 14/102 (13%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSP--PPYPPPPSRLPPP*LPPPP---------PLEE*PPPPPLYPPPP 163
           PPPPP PP PPP P  PP PPPPS  PPP  PPPP         P    PPPPP  PPPP
Sbjct: 1   PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPP 60

Query: 162 SRLPPPPP*L---PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              PPPPP     PPPP  PPPPP   PPPP P  PPPPPLP
Sbjct: 61  PSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLP 102

 Score =  123 bits (309), Expect = 6e-27
 Identities = 63/106 (59%), Positives = 66/106 (62%), Gaps = 9/106 (8%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPP-----LPP*PPPSPPPYPPPP--SRLPPP*L--PPPPPLEE*PPP 187
           +P P   +  PPPPP     LPP PPP PPP PPPP  S+ PPP    PPPPP    PPP
Sbjct: 24  SPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPP 83

Query: 186 PPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPL 49
           PP  PPPP   PPPPP LP P   PPPPPL   PPPPP  PPPPPL
Sbjct: 84  PPPSPPPPLPSPPPPPPLPSP---PPPPPLPSSPPPPPPSPPPPPL 126

 Score =  121 bits (304), Expect = 2e-26
 Identities = 61/98 (62%), Positives = 62/98 (63%), Gaps = 10/98 (10%)
 Frame = -3

Query: 309 PPPPPL------PP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP 148
           PPPPPL      PP PPP PPP PPPP   PPP LPPP PL   PPP P +P PPS  PP
Sbjct: 135 PPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPP-PPPSPPHPLPPSPPPP 193

Query: 147 PPP-*LPPPPE*PPPPPLRYPP---PPPPRWPPPPPLP 46
           PPP   PPPP  PPPPPL  PP   PP P  PPPPP P
Sbjct: 194 PPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPP 231

 Score =  118 bits (295), Expect = 2e-25
 Identities = 62/103 (60%), Positives = 62/103 (60%), Gaps = 15/103 (14%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSP---PPYPPPPSRLPPP*LPPPPPLEE*PPPPPLY---PPPPSRLPP 148
           PPPPPLP  PPP P    P PPPPS  PPP  PPPPP    PPPPPL    PPPPS  PP
Sbjct: 96  PPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPS--PPPPPLLSPPPPPPSPPPP 153

Query: 147 PPP*LPPPPE*PP---PPPLRYPPPPP------PRWPPPPPLP 46
           PPP  PPPP  PP   PPP   PPPPP      P  PPPPP P
Sbjct: 154 PPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPP 196

 Score =  114 bits (284), Expect = 4e-24
 Identities = 54/87 (62%), Positives = 54/87 (62%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           PPPPLPP P P PPP P PP  LPP   PPPPP    PPPPP  PPPP    PP P  P 
Sbjct: 165 PPPPLPP-PSPLPPPPPSPPHPLPPS--PPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPS 221

Query: 126 PPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP  PPPPP   PPPPPP  PPPP  P
Sbjct: 222 PPLPPPPPPPPSPPPPPPPSPPPPSPP 248

 Score =  112 bits (279), Expect = 2e-23
 Identities = 55/87 (63%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query: 309 PPPPPLPP*P-PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPPPP PP P PPSPPP PPP    PPP  PPPPPL    P PP   PP   LPPPP   
Sbjct: 176 PPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPL----PSPPAPSPPSPPLPPPP--- 228

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPP 52
           PPPP  PPPPP   P PPPP  PPPPP
Sbjct: 229 PPPPSPPPPPP---PSPPPPSPPPPPP 252

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 32/50 (64%), Positives = 32/50 (64%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
           PPPPPLP  P PSPP  P PP   PPP  PPPPP    PPPP   PPPPS
Sbjct: 206 PPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPS--PPPPSPPPPPPS 253

[26][TOP]
>UniRef100_Q8LPB1 Glycine-rich RNA-binding protein n=1 Tax=Physcomitrella patens
           RepID=Q8LPB1_PHYPA
          Length = 178

 Score =  132 bits (331), Expect = 2e-29
 Identities = 65/101 (64%), Positives = 68/101 (67%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVN+AQSRG G GGG  GGGG   R GGGGGY GGG   GGGGG   GGGG  
Sbjct: 70  ELDGRNITVNQAQSRGGGSGGG--GGGGYNNRQGGGGGYGGGGYGGGGGGGYGAGGGGAY 127

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
           G    Y   GGGGG YGG R  GG G GGG GGG GGSG G
Sbjct: 128 GSRSSYDREGGGGGGYGGSRGGGGYGSGGGGGGGRGGSGSG 168

[27][TOP]
>UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q3U3_IXOSC
          Length = 137

 Score =  131 bits (330), Expect = 2e-29
 Identities = 59/86 (68%), Positives = 59/86 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPP 56

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPP 52
           PPP  PPPPP   PPPPPP  PPPPP
Sbjct: 57  PPPPPPPPPP---PPPPPPPPPPPPP 79

 Score =  121 bits (304), Expect = 2e-26
 Identities = 53/79 (67%), Positives = 53/79 (67%)
 Frame = -3

Query: 282 PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPP 103
           PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  PPPP  PPPP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 102 PLRYPPPPPPRWPPPPPLP 46
           P   PPPPPP  PPPPP P
Sbjct: 61  PPPPPPPPPPPPPPPPPPP 79

[28][TOP]
>UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1
           Tax=Vitis vinifera RepID=UPI0001982DE4
          Length = 569

 Score =  130 bits (328), Expect = 3e-29
 Identities = 68/115 (59%), Positives = 73/115 (63%), Gaps = 3/115 (2%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPP---LPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPP 169
           +P P      PPPPP    PP PPPSPPP PPPPS  PPP  PPPPP    PPPPP  PP
Sbjct: 112 SPPPEYEEGCPPPPPEPECPPPPPPSPPP-PPPPSPPPPPSPPPPPPPS--PPPPPSPPP 168

Query: 168 PPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLPRD*ASLTVMLRPSR 4
           PP   PPPPP  PPPP  PPPPP   PPPPPP  PPPPP+ R+ A L + L+  R
Sbjct: 169 PPPPSPPPPP--PPPPPPPPPPP---PPPPPPPPPPPPPVDRN-ARLKIALKAIR 217

[29][TOP]
>UniRef100_Q41518 Single-stranded nucleic acid binding protein n=1 Tax=Triticum
           aestivum RepID=Q41518_WHEAT
          Length = 167

 Score =  130 bits (328), Expect = 3e-29
 Identities = 70/104 (67%), Positives = 73/104 (70%), Gaps = 1/104 (0%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQSR SGGG    GGGGGGY     GG  GGGG YGGGGG   GGGGY 
Sbjct: 71  ELDGRNITVNEAQSRRSGGG----GGGGGGY-----GGQRGGGGGYGGGGGYGGGGGGYG 121

Query: 182 G-GGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G GGGGY  + GGGG YG     GGGGYGG  GGGYGG  GGGG
Sbjct: 122 GQGGGGYGGQRGGGGGYG-----GGGGYGG--GGGYGGQRGGGG 158

[30][TOP]
>UniRef100_C5CSB2 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110
           RepID=C5CSB2_VARPS
          Length = 181

 Score =  130 bits (327), Expect = 5e-29
 Identities = 69/112 (61%), Positives = 72/112 (64%), Gaps = 11/112 (9%)
 Frame = +2

Query: 5   LDGRSITVNEA---QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGS-YGGGGGRRE-GG 169
           L GRS+ VNEA   ++R    GGG  GGGGGGY  GGGGGY GGGG  YGGGGG R  GG
Sbjct: 69  LGGRSVVVNEARPMEARPPRSGGGGYGGGGGGYGGGGGGGYGGGGGGGYGGGGGGRSGGG 128

Query: 170 GGYSGGGGGYSSRGGGGGS------YGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GGY GGGGG S  GGGGG       YG G R GGGG   G GGGYGG G  G
Sbjct: 129 GGYGGGGGGRSGGGGGGGDGGFRSPYGAGPRGGGGGGRSGGGGGYGGGGNSG 180

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 37/51 (72%), Positives = 37/51 (72%)
 Frame = +2

Query: 158 REGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           R GGGGY GGGGGY   GGGGG YGGG   GGGGYGGG GG  GG GG GG
Sbjct: 88  RSGGGGYGGGGGGYG--GGGGGGYGGG---GGGGYGGGGGGRSGGGGGYGG 133

[31][TOP]
>UniRef100_Q6ASX7 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica
           Group RepID=Q6ASX7_ORYSJ
          Length = 162

 Score =  130 bits (327), Expect = 5e-29
 Identities = 68/102 (66%), Positives = 70/102 (68%), Gaps = 1/102 (0%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGY 178
           +LDGR+ITVNEAQSR SGGGGG  GGGGGGY  G GGGGY GGG   GGG GRREGG   
Sbjct: 73  ELDGRNITVNEAQSRRSGGGGGGYGGGGGGYGGGRGGGGYGGGG---GGGYGRREGG--- 126

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
                      GGGG YGGGR  GGGGYGG  GGGYGG  GG
Sbjct: 127 ----------YGGGGGYGGGRGGGGGGYGGSRGGGYGGDSGG 158

[32][TOP]
>UniRef100_O22384 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22384_ORYSA
          Length = 162

 Score =  130 bits (327), Expect = 5e-29
 Identities = 68/102 (66%), Positives = 70/102 (68%), Gaps = 1/102 (0%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGY 178
           +LDGR+ITVNEAQSR SGGGGG  GGGGGGY  G GGGGY GGG   GGG GRREGG   
Sbjct: 73  ELDGRNITVNEAQSRRSGGGGGGYGGGGGGYGGGRGGGGYGGGG---GGGYGRREGG--- 126

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
                      GGGG YGGGR  GGGGYGG  GGGYGG  GG
Sbjct: 127 ----------YGGGGGYGGGRGGGGGGYGGSRGGGYGGDSGG 158

[33][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score =  130 bits (326), Expect = 6e-29
 Identities = 61/89 (68%), Positives = 62/89 (69%)
 Frame = -3

Query: 312 HPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           HPPPPP PP PPP  PP PP PS  PPP  PPPPP+   PPPPP  PPPPS  PPPPP  
Sbjct: 65  HPPPPP-PPPPPPPQPPLPPSPS--PPP--PPPPPVPPPPPPPPPPPPPPSPPPPPPPPP 119

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 120 PPPPSPPPPPP---PPPPPPPNPPPPPPP 145

 Score =  128 bits (321), Expect = 2e-28
 Identities = 61/104 (58%), Positives = 63/104 (60%), Gaps = 7/104 (6%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PP-------PSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPL 178
           P P+   + PPPPP PP PP       PSPPP PPPP   PPP  PPPPP    PPPPP 
Sbjct: 58  PTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPP 117

Query: 177 YPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPP   PPPPP  PPPP  PPPPP   PPPPP   PPP P P
Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPP---PPPPPSPSPPPSPPP 158

 Score =  126 bits (317), Expect = 7e-28
 Identities = 56/88 (63%), Positives = 56/88 (63%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 87  PPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPP 146

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP   PPP P   PPP PP  PPP P P
Sbjct: 147 PPSPSPPPSPPPSPPPSPPPSPPPSPPP 174

 Score =  122 bits (307), Expect = 9e-27
 Identities = 57/89 (64%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPPS  PPP P   
Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPP--PPPPSPSPPPSPPPS 159

Query: 129 PPPE*PPPPPLRYPPPPPPRWPP-PPPLP 46
           PPP  PP PP   PP PPP  PP PPP P
Sbjct: 160 PPPSPPPSPPPSPPPSPPPSPPPSPPPRP 188

 Score =  121 bits (303), Expect = 3e-26
 Identities = 58/91 (63%), Positives = 58/91 (63%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309 PPPPPLPP*P---PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP 139
           PP PPLPP P   PP PPP PPPP   PPP  PPPPP    PPPPP  PPPPS  PPPPP
Sbjct: 76  PPQPPLPPSPSPPPPPPPPVPPPPP--PPP--PPPPPPSPPPPPPPPPPPPPSPPPPPPP 131

Query: 138 *LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPP  PPPPP   P P PP  PPP P P
Sbjct: 132 PPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP 162

 Score =  120 bits (301), Expect = 5e-26
 Identities = 56/88 (63%), Positives = 56/88 (63%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           P P P PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 83  PSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPP--PPPPPSPPPPPPPPPPPPPNPP 140

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPP PP  PPP P P
Sbjct: 141 PPP--PPPPPSPSPPPSPPPSPPPSPPP 166

 Score =  120 bits (301), Expect = 5e-26
 Identities = 56/88 (63%), Positives = 56/88 (63%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPPSPPP PPPP   PP   PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 98  PPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPP----PPPPPPNPPPP---PPPPPPSP 150

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP  PPP P   PPP PP  PPP P P
Sbjct: 151 SPPPSPPPSPPPSPPPSPPPSPPPSPPP 178

 Score =  118 bits (296), Expect = 2e-25
 Identities = 59/94 (62%), Positives = 59/94 (62%), Gaps = 6/94 (6%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYP---PPPSRLPPPPP 139
           PPPPP P  PPP PPP PPPPS  PPP  PPPPP    PPPPP  P   PPPS  P PPP
Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP 162

Query: 138 *LP--PPPE*PPPPPLRYPPPPPPRWPP-PPPLP 46
             P  PPP  PP PP   PP PPPR PP PPP P
Sbjct: 163 SPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSP 196

 Score =  117 bits (294), Expect = 3e-25
 Identities = 56/98 (57%), Positives = 57/98 (58%), Gaps = 1/98 (1%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPPP PP PPP PPP PPPP   PPP  PPPP     P PPP  PP P  
Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPP 166

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPP-PPPLP 46
            PPP P   PPP  PP PP R PP PPP  PP PPP P
Sbjct: 167 SPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSP 204

 Score =  114 bits (286), Expect = 3e-24
 Identities = 55/89 (61%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PP PP PP PPP PPP  PPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 93  PPVPPPPPPPPPPPPPPSPPP---PPP--PPPPPPPSPPPPPPPPPPPPPNPPPPPPPPP 147

Query: 129 PPPE*PPPPPLRYPPPPPPRWPP-PPPLP 46
           P P  PP PP   PP PPP  PP PPP P
Sbjct: 148 PSPSPPPSPPPSPPPSPPPSPPPSPPPSP 176

 Score =  113 bits (283), Expect = 6e-24
 Identities = 54/91 (59%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP P P PPP PPPPS  PPP  PP PP    P PPP  PP P   PPP P   
Sbjct: 128 PPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPR 187

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPP--PPLPR 43
           PPP  PP PP   PP PPPR PP   PP PR
Sbjct: 188 PPPSPPPSPPPSPPPSPPPRPPPSPNPPSPR 218

 Score =  113 bits (282), Expect = 7e-24
 Identities = 58/99 (58%), Positives = 61/99 (61%)
 Frame = -3

Query: 342 GNPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
           G+P P       PPP +PP P PS P +PPPP   PPP  PP PPL   P PPP  PPPP
Sbjct: 44  GSPPPG-----TPPPGVPP-PTPSGPEHPPPPPPPPPP--PPQPPLPPSPSPPPP-PPPP 94

Query: 162 SRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              PPPPP  PPPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 95  VPPPPPPPPPPPPPPSPPPPP--PPPPPPPPSPPPPPPP 131

 Score =  112 bits (280), Expect = 1e-23
 Identities = 63/114 (55%), Positives = 63/114 (55%), Gaps = 17/114 (14%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPP--------------PSRLPPP*LPP-PPPLE 202
           P P  R    PPP  PP PPPSPPP PPP              PS  PPP  PP PPP  
Sbjct: 182 PSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSP 241

Query: 201 E*PPPPPLYPPPPSRLPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPP-PLP 46
             P PPP  PPPP   PP PPP LPPPP   PPPPL  PP PPP  PPPP PLP
Sbjct: 242 PPPRPPPPAPPPPRPPPPSPPPPLPPPPS--PPPPLPPPPSPPPPSPPPPSPLP 293

 Score =  110 bits (275), Expect = 5e-23
 Identities = 63/114 (55%), Positives = 63/114 (55%), Gaps = 26/114 (22%)
 Frame = -3

Query: 309 PPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPP----PLEE*PPPPPLYPPPPSRLPP 148
           PPP P PP PPP   PPP PPPPS  PPP LPPPP    PL   P PPP  PPPPS LPP
Sbjct: 237 PPPSPPPPRPPPPAPPPPRPPPPS--PPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPP 294

Query: 147 ----------------PPP*LPPPPE*PPP---PPLRYPP-PPPPRWPPPPPLP 46
                           PPP  PPPP  PPP   PP   PP PPPPR PPP P P
Sbjct: 295 SPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNP 348

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/98 (59%), Positives = 58/98 (59%), Gaps = 11/98 (11%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPP-----PLEE*PP--PPPLYPPPPSRLPP 148
           PPPPLPP PP  PPP PPPPS LPP   PP P     P    PP  PPP  PPPPS  PP
Sbjct: 271 PPPPLPP-PPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPP 329

Query: 147 -PPP*LPPPPE*PPP---PPLRYPPPPPPRWPPPPPLP 46
            PPP  PPPP  PPP   PP   PP P P  PPPPP P
Sbjct: 330 RPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSP 367

 Score =  108 bits (270), Expect = 2e-22
 Identities = 51/86 (59%), Positives = 53/86 (61%)
 Frame = -3

Query: 303 PPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPP 124
           PPP  P PP +PPP  PPP+   P   PPPPP    PP PPL P P    PPPPP  PPP
Sbjct: 41  PPPGSP-PPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPP 99

Query: 123 PE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P  PPPPP   PPPPPP  PPPPP P
Sbjct: 100 PPPPPPPPPPSPPPPPPPPPPPPPSP 125

 Score =  108 bits (269), Expect = 2e-22
 Identities = 52/89 (58%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PP PP PP PPP PPP PPPP   PPP   PPP     PPP P   PPPS  P PPP  P
Sbjct: 122 PPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 181

Query: 129 P-PPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P PP  PPP P   PPP PP  PPP P P
Sbjct: 182 PSPPPRPPPSPPPSPPPSPPPSPPPRPPP 210

 Score =  107 bits (266), Expect = 5e-22
 Identities = 53/90 (58%), Positives = 53/90 (58%), Gaps = 1/90 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPP P PP PPP PPP  PPP   PPP  P PPP    PPP P   PPPS  P PPP  P
Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPS---PPPSPPPSPPPSPPPSPPPSPP 177

Query: 129 P-PPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
           P PP  PPP P   PPP PP  PPP P PR
Sbjct: 178 PSPPPSPPPRPPPSPPPSPPPSPPPSPPPR 207

 Score =  106 bits (265), Expect = 7e-22
 Identities = 57/102 (55%), Positives = 57/102 (55%), Gaps = 4/102 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P PN     PPPPP PP P PSPPP PPP    PPP  PP PP    P PPP  PP P  
Sbjct: 135 PPPN-----PPPPPPPPPPSPSPPPSPPPS---PPPSPPPSPPPSPPPSPPPSPPPSPPP 186

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPP---PPPPRWP-PPPPLPR 43
            PPP P   PPP  PP PP R PP   PP PR P P PP PR
Sbjct: 187 RPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPR 228

 Score =  105 bits (263), Expect = 1e-21
 Identities = 57/106 (53%), Positives = 60/106 (56%), Gaps = 9/106 (8%)
 Frame = -3

Query: 336 PKPN*RNYHPPP--PPLPP*--PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPP 169
           P P+  +  PPP  PP PP   PPP PPP  PPP R PPP   PPPPL   P PPP  PP
Sbjct: 220 PSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPP--SPPPPLPPPPSPPPPLPP 277

Query: 168 PPSR---LPPPPP*LPPPPE*PPPPPLR--YPPPPPPRWPPPPPLP 46
           PPS     PPPP  LPP P  P P P    +P PPPP  PPP P P
Sbjct: 278 PPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPP 323

 Score =  105 bits (262), Expect = 2e-21
 Identities = 55/99 (55%), Positives = 56/99 (56%), Gaps = 1/99 (1%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP P  PP  PP PPP PPPP R PPP   PPPP    P PPP  PPPPS 
Sbjct: 215 PSPRPPSPSPPSPRPPPRRPPFPPPSPPPP-RPPPP--APPPPRPPPPSPPPPLPPPPSP 271

Query: 156 LPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
            PP PPP  PPPP  PPP PL   P PP   PP  P PR
Sbjct: 272 PPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPR 310

 Score =  103 bits (258), Expect = 5e-21
 Identities = 56/95 (58%), Positives = 56/95 (58%), Gaps = 8/95 (8%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPP-PSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP---PPP 139
           PPP  PP PPPSPPP PPP P   PPP  PP PP    P P P  P PPS  PP   PPP
Sbjct: 172 PPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPP 231

Query: 138 *LPP-PPE*PPPPPLRYPPPPPPRWP---PPPPLP 46
             PP PP  PPPP    P PPPPR P   PPPPLP
Sbjct: 232 RRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLP 266

 Score =  103 bits (257), Expect = 6e-21
 Identities = 62/124 (50%), Positives = 63/124 (50%), Gaps = 26/124 (20%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*P--PPSPPPYPPP-PSRLPPP*LPPPPPLEE*PPPPPLYPPP 166
           P P   N  PPPPP PP P  PPSPPP PPP P   PPP  PP PP    P PPP  PP 
Sbjct: 132 PPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPS 191

Query: 165 PSRLPPPPP*LPPPPE*PP------------------PPPLR--YPP--PPPPRWPPP-P 55
           P   PPP P   PPP  PP                  PPP R  +PP  PPPPR PPP P
Sbjct: 192 PPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAP 251

Query: 54  PLPR 43
           P PR
Sbjct: 252 PPPR 255

 Score =  103 bits (256), Expect = 8e-21
 Identities = 54/96 (56%), Positives = 54/96 (56%), Gaps = 9/96 (9%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPP-PSRLPPP*LPPPPPLEE*PP------PPPLYPPPPSRLPP 148
           PPP  PP PPP PPP PPP P   PPP  PP PP    PP      P P  P PP R PP
Sbjct: 176 PPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPP 235

Query: 147 PPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PP  PPPP  PP  PPP R PPP PP   PPPP P
Sbjct: 236 FPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSP 271

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/95 (56%), Positives = 55/95 (57%), Gaps = 9/95 (9%)
 Frame = -3

Query: 309 PPPPPLPP*P---PPSPP--PYPPPPSRLPPP*LPPPP----PLEE*PPPPPLYPPPPSR 157
           PPP PLPP P    PSPP  P+P PP   PPP  PPPP    P    P PPP  PPPPS 
Sbjct: 287 PPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSP 346

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
            PP PP  PP P  P PPP   PPP PPR PP PP
Sbjct: 347 NPPRPP--PPSPSPPKPPPPPSPPPRPPRRPPRPP 379

 Score =  100 bits (249), Expect = 5e-20
 Identities = 51/89 (57%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPP-PSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPP  PP PPPSPPP PPP P   PPP  PP PP    P PPP   PP  R P P P  P
Sbjct: 168 PPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSP 227

Query: 129 -PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PP PP   PPP PP   PPPP P
Sbjct: 228 RPPPRRPPFPPPSPPPPRPPPPAPPPPRP 256

 Score =  100 bits (248), Expect = 7e-20
 Identities = 53/94 (56%), Positives = 53/94 (56%), Gaps = 7/94 (7%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPP-PSRLPPP*LPPPPPLEE*PPPPPLYPP---PPSRLPP--- 148
           PPP  PP PPPSPPP PPP P   PPP  PP PP    P PPP  PP   PPS  PP   
Sbjct: 164 PPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPS 223

Query: 147 PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP   PPP   P PPP   PP PPP  PPPP  P
Sbjct: 224 PPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPP 257

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 47/92 (51%), Positives = 47/92 (51%), Gaps = 4/92 (4%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPP   P       P  PPP S  PPP  PPP      PPP P  P  P   PPPPP  P
Sbjct: 24  PPPRRSPVVALVETPAAPPPGS--PPPGTPPPGV----PPPTPSGPEHP---PPPPP--P 72

Query: 129 PPPE*PPPPPL----RYPPPPPPRWPPPPPLP 46
           PPP  PP PPL      PPPPPP  PPPPP P
Sbjct: 73  PPP--PPQPPLPPSPSPPPPPPPPVPPPPPPP 102

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 39/74 (52%), Positives = 41/74 (55%), Gaps = 6/74 (8%)
 Frame = -3

Query: 249 PSRLPPP*LPPPPPLEE*PP-PPPLYPPP---PSRLPPPPP*LP--PPPE*PPPPPLRYP 88
           P+R PPP   P   L E P  PPP  PPP   P  +PPP P  P  PPP  PPPPP   P
Sbjct: 20  PARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQP 79

Query: 87  PPPPPRWPPPPPLP 46
           P PP   PPPPP P
Sbjct: 80  PLPPSPSPPPPPPP 93

[34][TOP]
>UniRef100_O04070 SGRP-1 protein n=1 Tax=Solanum commersonii RepID=O04070_SOLCO
          Length = 162

 Score =  130 bits (326), Expect = 6e-29
 Identities = 69/103 (66%), Positives = 73/103 (70%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQ+RGSGGGG    GGGGG+  GGG    GGGG YGGGGG R GGGG  
Sbjct: 72  ELDGRNITVNEAQARGSGGGG----GGGGGF--GGGRRREGGGGGYGGGGGYRGGGGGGY 125

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG      GGGGG YGGGRREGGG      GGGYGG G GGG
Sbjct: 126 GGG---RREGGGGGGYGGGRREGGG------GGGYGGGGYGGG 159

[35][TOP]
>UniRef100_B7QN34 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7QN34_IXOSC
          Length = 364

 Score =  129 bits (325), Expect = 8e-29
 Identities = 62/97 (63%), Positives = 64/97 (65%)
 Frame = +2

Query: 20  ITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 199
           I +  A  R +GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG 
Sbjct: 245 IAIKRANDRSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 304

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
              GGGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 341

 Score =  127 bits (320), Expect = 3e-28
 Identities = 61/94 (64%), Positives = 63/94 (67%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           N+  + G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    
Sbjct: 251 NDRSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 310

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 344

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 259 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 318

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 346

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 260 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 319

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 320 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 347

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 320

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 348

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 321

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 349

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 350

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 351

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 265 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 324

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 352

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 266 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 325

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 326 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 353

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 267 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 326

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 327 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 354

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 327

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 328 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 355

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 329 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 356

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 270 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 329

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 330 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 357

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 271 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 331 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 358

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 332 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 359

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 333 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 360

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 334 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 361

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 275 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 335 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 362

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 276 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 335

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 336 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 363

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 277 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 336

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 337 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 364

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/86 (68%), Positives = 59/86 (68%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 232
           GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG  G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 233 GGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG   GGGG GGG GGG GG GGGGG
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGGGG 86

 Score =  122 bits (306), Expect = 1e-26
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGGG 57

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 58  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 85

 Score =  113 bits (282), Expect = 7e-24
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 10  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGG----GGGGGG 62

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGG 307
            GGG   GGGG GGG GGG GG GGGG
Sbjct: 63  GGGG---GGGGGGGGGGGGGGGGGGGG 86

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 36/52 (69%), Positives = 36/52 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYS 202
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG S
Sbjct: 37  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVS 88

[36][TOP]
>UniRef100_Q43472 Low temperature-responsive RNA-binding protein n=1 Tax=Hordeum
           vulgare RepID=Q43472_HORVU
          Length = 161

 Score =  129 bits (324), Expect = 1e-28
 Identities = 70/108 (64%), Positives = 71/108 (65%), Gaps = 4/108 (3%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGY----RSGGGGGYSGGGGSYGGGGGRREGG 169
           DLDGR+ITVNEAQSR S GGGG  GGGGGGY    R GGGGGY GGGG Y         G
Sbjct: 71  DLDGRNITVNEAQSRRSDGGGGF-GGGGGGYGGQRREGGGGGYGGGGGGY---------G 120

Query: 170 GGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GG SGGGGGY SR GGGG YGG    GGGGYGG  GG      GGG W
Sbjct: 121 GGRSGGGGGYGSRDGGGGGYGG----GGGGYGGSRGG-----SGGGNW 159

[37][TOP]
>UniRef100_Q08I87 Putative glycine-rich RNA-binding protein n=1 Tax=Dianthus
           caryophyllus RepID=Q08I87_DIACA
          Length = 163

 Score =  129 bits (324), Expect = 1e-28
 Identities = 74/105 (70%), Positives = 76/105 (72%), Gaps = 4/105 (3%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRS--GGGGGYSGGGGSYGGGGGRREGGGG 175
           +LDGRSITVNEAQSRGSGGGGG     GGGYRS  GGGGGY GGGG Y   GGRREG   
Sbjct: 71  ELDGRSITVNEAQSRGSGGGGG-----GGGYRSGGGGGGGYGGGGGGY---GGRREG--- 119

Query: 176 YSGGGGGYSSRGGGGGSYGGGRRE--GGGGYGGGEGGGYGGSGGG 304
             GGGGGY   GG GG Y GGRRE  GGGGYGGG GGGY G+  G
Sbjct: 120 --GGGGGYG--GGSGGGY-GGRREGGGGGGYGGGGGGGYRGNSDG 159

[38][TOP]
>UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata
           RepID=UPI000192638B
          Length = 557

 Score =  129 bits (323), Expect = 1e-28
 Identities = 59/89 (66%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPP--CPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCP 319

Query: 129 PPPE*PPPPPLRYPPP-PPPRWPPPPPLP 46
           PPP  PPP P   PPP PPP  PPPPP P
Sbjct: 320 PPPPPPPPCPPPCPPPCPPPCPPPPPPCP 348

 Score =  125 bits (313), Expect = 2e-27
 Identities = 60/94 (63%), Positives = 60/94 (63%), Gaps = 5/94 (5%)
 Frame = -3

Query: 312 HPP-----PPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP 148
           HPP     PPP PP PPP PPP PPPP   PPP  PPPPP    PP PP  PPPP   PP
Sbjct: 239 HPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPP--PPPPPPPPPPPCPPPCPPPPPPCPP 296

Query: 147 PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 297 PPP--PPPPCPPPPPP---PPPPPPPCPPPPPPP 325

 Score =  122 bits (307), Expect = 9e-27
 Identities = 57/89 (64%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPP    PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 267 PPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPP 326

Query: 129 P-PPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P PP  PPP P   PPPPPP  PPP P P
Sbjct: 327 PCPPPCPPPCPPPCPPPPPPCPPPPCPPP 355

 Score =  122 bits (306), Expect = 1e-26
 Identities = 57/89 (64%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*-PPPPPLYPPPPSRLPPPPP*L 133
           PPPP  PP PPP PPP PPPP   PPP  PPPPP     PPPPP  PPP    PPPPP  
Sbjct: 249 PPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPP----PPPPPPC 304

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPP  PPPPP   PPPPPP  P PPP P
Sbjct: 305 PPPPPPPPPPPPPCPPPPPPPPPCPPPCP 333

 Score =  118 bits (295), Expect = 2e-25
 Identities = 59/93 (63%), Positives = 59/93 (63%), Gaps = 5/93 (5%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPP-PPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPPPP PP PPP PPP PP PP   PPP  PPPPP    PPPPP  PPPP   PP PP  
Sbjct: 275 PPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPP--PPPPPPCPPPPPPPPPCPPPC 332

Query: 132 PP--PPE*PPPPPLRYPP--PPPPRWPPPPPLP 46
           PP  PP  PPPPP   PP  PPPP  PPPPP P
Sbjct: 333 PPPCPPPCPPPPPPCPPPPCPPPPCPPPPPPCP 365

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/87 (59%), Positives = 53/87 (60%), Gaps = 2/87 (2%)
 Frame = -3

Query: 300 PPLPP*PPPSPPPYPPPPSRLPPP*LP--PPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           P   P  PP+PPP PPPP   PPP  P  PPPP    PPPPP  PPPP   PPP P  PP
Sbjct: 233 PSAAPCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPP 292

Query: 126 PPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P   PPPPP   PPPPPP  PPPPP P
Sbjct: 293 PCPPPPPPPPPCPPPPPPPPPPPPPCP 319

 Score =  112 bits (279), Expect = 2e-23
 Identities = 57/92 (61%), Positives = 57/92 (61%), Gaps = 6/92 (6%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPP-----PSRLPPP 145
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPP     P   PPP
Sbjct: 289 PPPPPCPP-PPPPPPPCPPPPP--PPP--PPPPPCPPPPPPPPPCPPPCPPPCPPPCPPP 343

Query: 144 PP*LPPPPE*PPPPPLRYPPPP-PPRWPPPPP 52
           PP  PPPP   PPPP   PPPP PP  P PPP
Sbjct: 344 PPPCPPPP--CPPPPCPPPPPPCPPACPIPPP 373

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 49/78 (62%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPP-PPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPPPP PP PPP PPP PPPP   PPP  PP PPP    PPPPP  PPPP    PPPP  
Sbjct: 306 PPPPPPPPPPPPCPPP-PPPPPPCPPPCPPPCPPPC---PPPPPPCPPPPC---PPPPCP 358

Query: 132 PPPPE*PPPPPLRYPPPP 79
           PPPP  PP  P+  PPPP
Sbjct: 359 PPPPPCPPACPI--PPPP 374

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 23/36 (63%), Positives = 24/36 (66%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLE 202
           PPPPP PP PP  PPP PPPP   PP    PPPP+E
Sbjct: 342 PPPPPCPP-PPCPPPPCPPPPPPCPPACPIPPPPME 376

[39][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score =  129 bits (323), Expect = 1e-28
 Identities = 62/99 (62%), Positives = 63/99 (63%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP PPP    PPP  PPPPP    PPPPP  PPPPS 
Sbjct: 238 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSP 297

Query: 156 LPP-PPP*LPPPPE*PPPPPLRYPPP-PPPRWPPPPPLP 46
            PP PPP  PPPP  PPPPP R PPP PPP  PPPPP P
Sbjct: 298 PPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPP 336

 Score =  128 bits (322), Expect = 2e-28
 Identities = 60/98 (61%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPP  PP PPP PPP  PPP   PPP  P PPP    PPPPP  PPPPS 
Sbjct: 298 PPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSP 357

Query: 156 LPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP  PPPPP   PPPPPPR PPP P P
Sbjct: 358 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPP 395

 Score =  127 bits (320), Expect = 3e-28
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP P  PPPSPPP  PPP   PPP  PPPPP    P PPP  PPPPS  PPPPP  P
Sbjct: 284 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP----PRPPPPSPPPPSPPPPPPPSPP 339

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP R PPP PP   PPPP P
Sbjct: 340 PPPSPPPPPPPRPPPPSPPPPSPPPPSP 367

 Score =  127 bits (320), Expect = 3e-28
 Identities = 58/89 (65%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           PPPP PP PPP P P PPPP R PPP  PPP P    PPPP   PPPP   PPPPP  PP
Sbjct: 330 PPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPP 389

Query: 126 PPE*PPP-PPLRYPPPPPPRWPPPPPLPR 43
           PP  PPP PP   PPPPPP  PPPPP PR
Sbjct: 390 PPSPPPPSPPPPSPPPPPPPSPPPPPPPR 418

 Score =  126 bits (316), Expect = 9e-28
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PP  PPP PPPPS  PPP  PPPPP    PPPPP  PPPPS  PPPP   P
Sbjct: 346 PPPPPRPP-PPSPPPPSPPPPS--PPPPSPPPPPPPSPPPPPPPRPPPPS--PPPPS--P 398

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPPR PPP P P
Sbjct: 399 PPPSPPPPPPPSPPPPPPPRPPPPSPPP 426

 Score =  125 bits (313), Expect = 2e-27
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           PPPP PP PPP PPP PPPPS  PP   PP PP    PPPPP  PPPPS  PP PP  PP
Sbjct: 276 PPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPP--PP 333

Query: 126 PPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP  PPPPP   PPPPPPR PPP P P
Sbjct: 334 PPPSPPPPP-SPPPPPPPRPPPPSPPP 359

 Score =  124 bits (312), Expect = 2e-27
 Identities = 60/99 (60%), Positives = 61/99 (61%), Gaps = 1/99 (1%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPL-YPPPPS 160
           P P   +  PP PP P  PPPSPPP  PPP   PPP  PPPPP    PPPPP   PPPP 
Sbjct: 223 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 282

Query: 159 RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
           R PPPPP  PPPP   PPPP   PP PPP  PPPPP PR
Sbjct: 283 RPPPPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPPPPR 319

 Score =  124 bits (312), Expect = 2e-27
 Identities = 59/100 (59%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPPPP PP PPP  PP PPPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 253 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 312

Query: 156 LPPPPP*LP---PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPPP  P   PPP  PPPPP   PPPPP   PPPPP P
Sbjct: 313 PPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRP 352

 Score =  124 bits (312), Expect = 2e-27
 Identities = 57/89 (64%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LP-PPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPP P PP PPP PPP PPPP   PPP  P PPPP    P PPP  PPPPS  PPPPP  
Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 380

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPP   PPPP   PP PPP  PPPPP P
Sbjct: 381 PPPPPPRPPPPSPPPPSPPPPSPPPPPPP 409

 Score =  124 bits (311), Expect = 3e-27
 Identities = 60/104 (57%), Positives = 61/104 (58%), Gaps = 6/104 (5%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPP  PP  PP P P PPPP R PPP  PPP P    PPPPP  PPPP  
Sbjct: 288 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSP----PPPPPPSPPPPPS 343

Query: 156 LPPPPP*LPPPPE*PPP------PPLRYPPPPPPRWPPPPPLPR 43
            PPPPP  PPPP  PPP      PP   PPPPPP  PPPPP PR
Sbjct: 344 PPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPR 387

 Score =  124 bits (310), Expect = 4e-27
 Identities = 59/99 (59%), Positives = 60/99 (60%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PP--PPPLYPPPP 163
           P P+     PPPP  PP PPPSPPP PPP    PPP  PPPPP    PP  PPP  PPPP
Sbjct: 246 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP 305

Query: 162 SRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           S  PP PP  PPP   PP PP   PPPPPP  PPPPP P
Sbjct: 306 SPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSP 344

 Score =  122 bits (306), Expect = 1e-26
 Identities = 58/98 (59%), Positives = 59/98 (60%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 188 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 245

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
            PP PP   PPP  PPPPP   PPPPPP  PPPPP PR
Sbjct: 246 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPR 283

 Score =  121 bits (304), Expect = 2e-26
 Identities = 58/95 (61%), Positives = 59/95 (62%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 198 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 255

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
            PP PP  PPPP  PPPPP   PPPPPPR PPPPP
Sbjct: 256 PPPSPP-PPPPPSPPPPPPPSPPPPPPPRPPPPPP 289

 Score =  121 bits (303), Expect = 3e-26
 Identities = 59/99 (59%), Positives = 60/99 (60%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 203 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 260

Query: 156 LPPPPP*LPPPP--E*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPPP  PPPP    PPPPP R PPPPPP  PPP P P
Sbjct: 261 PPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPP 299

 Score =  117 bits (292), Expect = 5e-25
 Identities = 58/98 (59%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PP-PPPLYPPPPS 160
           P P  R   P PPP  P PP  PPP PPPP   PPP  PPPPP    PP PPP  PPPPS
Sbjct: 346 PPPPPRPPPPSPPPPSPPPPSPPPPSPPPP---PPPSPPPPPPPRPPPPSPPPPSPPPPS 402

Query: 159 RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPPP  PPPP   PPPP   PP PPP  PPPP  P
Sbjct: 403 PPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPP 440

[40][TOP]
>UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI000155382B
          Length = 492

 Score =  128 bits (322), Expect = 2e-28
 Identities = 60/88 (68%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 150 GGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 209

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG+GGG GG GGGGG
Sbjct: 210 RGGGGGGGGGGGGGGDGGGRGGGGGGGG 237

 Score =  127 bits (318), Expect = 5e-28
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 194

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 195 GGGGGGGGGGGGGGGRGGGGGGGGGGGG 222

 Score =  127 bits (318), Expect = 5e-28
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 265 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 324

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GGSGGGGG
Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGSGGGGG 352

 Score =  127 bits (318), Expect = 5e-28
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGGS
Sbjct: 288 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGS 347

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 348 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 375

 Score =  127 bits (318), Expect = 5e-28
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG  S GGGGG 
Sbjct: 295 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGG 354

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 355 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 382

 Score =  127 bits (318), Expect = 5e-28
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG S  GGGGG 
Sbjct: 296 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGG 355

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 356 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 383

 Score =  127 bits (318), Expect = 5e-28
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG SGGGGG    GGGGG 
Sbjct: 303 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGG 362

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 363 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 390

 Score =  127 bits (318), Expect = 5e-28
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGGS GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 318 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 377

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 378 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 405

 Score =  127 bits (318), Expect = 5e-28
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG SGGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 382

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 383 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 410

 Score =  127 bits (318), Expect = 5e-28
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG  SGGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 330 GGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 389

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 390 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 417

 Score =  127 bits (318), Expect = 5e-28
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GSGGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 346 GSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 405

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 406 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 433

 Score =  126 bits (316), Expect = 9e-28
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 332 GGGGGGGGGGGGGGGSGGGGGGGGGGGG 359

 Score =  126 bits (316), Expect = 9e-28
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 281 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 340

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 341 GGGGGGSGGGGGGGGGGGGGGGGGGGGG 368

 Score =  126 bits (316), Expect = 9e-28
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 309 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGG 368

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 369 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 396

 Score =  126 bits (316), Expect = 9e-28
 Identities = 61/90 (67%), Positives = 61/90 (67%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           S G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGG
Sbjct: 347 SGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 406

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 407 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 436

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 237 GGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 296

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 297 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 324

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 327

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 328 GGGGGGGGGGGGGGGGGGGSGGGGGGGG 355

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 276 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 335

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 336 GGGGGGGGGGGSGGGGGGGGGGGGGGGG 363

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 282 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 341

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 342 GGGGGSGGGGGGGGGGGGGGGGGGGGGG 369

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 283 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 342

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 343 GGGGSGGGGGGGGGGGGGGGGGGGGGGG 370

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 287 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 346

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 347 SGGGGGGGGGGGGGGGGGGGGGGGGGGG 374

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 294 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGG 353

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 354 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 381

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 297 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGG 356

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 357 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 384

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 304 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGG 363

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 364 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 391

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 310 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGG 369

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 370 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 397

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGG 370

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 371 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 398

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 317 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 376

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 377 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 404

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 383

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 384 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 411

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 331 GGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 390

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 391 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 418

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 332 GGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 391

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 392 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 419

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 339 GGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 398

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 399 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 426

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 340 GGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 399

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 400 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 427

 Score =  125 bits (314), Expect = 1e-27
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG   RGGGGG 
Sbjct: 157 GGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 216

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 217 GGGG---GGGGDGGGRGGGGGGGGGGGG 241

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GG GG RGGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 221 GGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 280

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 281 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 308

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 236 GGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 295

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 296 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 323

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 243 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 302

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 303 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 330

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 245 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 304

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 332

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 246 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 305

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 306 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 333

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 247 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 306

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 334

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 248 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 307

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 335

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 249 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 308

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 309 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 336

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 250 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 309

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 310 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 337

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 251 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 310

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 338

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 252 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 311

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 312 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 339

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 253 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 312

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 313 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 340

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 254 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 313

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 314 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 341

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 255 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 314

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 315 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 342

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 256 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 315

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 316 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 343

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 257 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 316

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 317 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 344

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 258 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 317

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 318 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 345

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 259 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 318

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 346

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 350 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 409

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 410 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 437

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 351 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 410

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 411 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 438

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 411

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 412 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 439

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 412

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 413 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 440

 Score =  125 bits (313), Expect = 2e-27
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GSGGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 89  GSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGG 148

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 149 GGGG---GGGGGGGGGGGGVGGGGGGGG 173

 Score =  125 bits (313), Expect = 2e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG R GGGG  GGGGG    GG GG 
Sbjct: 173 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGG 232

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 233 GGGGGGGGGGGDGGGGGGGGGGGGGGGG 260

 Score =  125 bits (313), Expect = 2e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  G GGGR  GGGG  GGGGG    GGGGG 
Sbjct: 193 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGG 252

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 253 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 280

 Score =  125 bits (313), Expect = 2e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 228 GRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 287

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 288 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 315

 Score =  124 bits (312), Expect = 2e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGG 187

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGRGGGGG 215

 Score =  124 bits (312), Expect = 2e-27
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG--GGGGGGGG 224

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGGR  GGGG GGG GGG GG GGGGG
Sbjct: 225 DGGGRGGGGGGGGGGGGGGDGGGGGGGG 252

 Score =  124 bits (312), Expect = 2e-27
 Identities = 60/89 (67%), Positives = 60/89 (67%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           RG GGGGG  GGGGG    GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG
Sbjct: 229 RGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 288

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG   GGGG GGG GGG GG GGGGG
Sbjct: 289 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 317

 Score =  124 bits (311), Expect = 3e-27
 Identities = 61/92 (66%), Positives = 62/92 (67%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG----GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           G GGGGG RGGGGGG   GG    GGG  GGGG  GGGGG  +GGGG  GGGGG    GG
Sbjct: 202 GGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGG 261

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 293

 Score =  124 bits (310), Expect = 4e-27
 Identities = 61/88 (69%), Positives = 61/88 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG SGGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGSGGGG--GGGGGSGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 114 GGGGGVGGGGGVGGGGGGGGGGGGGGGG 141

 Score =  124 bits (310), Expect = 4e-27
 Identities = 61/92 (66%), Positives = 62/92 (67%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYS----SRGG 214
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGGR  GGGG  GGGGG        GG
Sbjct: 174 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGG 233

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG  GGG  +GGGG GGG GGG GG GGGGG
Sbjct: 234 GGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGG 265

 Score =  123 bits (309), Expect = 6e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGG    GGGGG SGGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 66  GGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGV 125

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 153

 Score =  123 bits (309), Expect = 6e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG G  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 75  GGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGG 134

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 162

 Score =  123 bits (309), Expect = 6e-27
 Identities = 60/90 (66%), Positives = 60/90 (66%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           S G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGG
Sbjct: 80  SGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGG 139

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G  GGG   GGGG GGG GGG GG  GGGG
Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGVGGGG 169

 Score =  123 bits (308), Expect = 7e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG  SGGGGG  GGGG  GGGGG   GGGG  G GGG    GGGGG 
Sbjct: 73  GGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGG 132

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 160

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GG GGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 214 GGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 273

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 301

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 320

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGG G
Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGGGGGGSG 348

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 321

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GG GG
Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGGGGGSGG 349

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG G GGG
Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGGGGSGGG 350

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG  GGGG
Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGSGGGG 351

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 270 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 329

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG G G GG GGGGG
Sbjct: 330 GGGGGGGGGGGGGGGGGSGGGGGGGGGG 357

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 271 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG  GG GG GGGGG
Sbjct: 331 GGGGGGGGGGGGGGGGSGGGGGGGGGGG 358

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GG  GGG GG GGGGG
Sbjct: 333 GGGGGGGGGGGGGGSGGGGGGGGGGGGG 360

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG G G GGG GG GGGGG
Sbjct: 334 GGGGGGGGGGGGGSGGGGGGGGGGGGGG 361

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 277 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 336

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGG  GGG GGG GG GGGGG
Sbjct: 337 GGGGGGGGGGSGGGGGGGGGGGGGGGGG 364

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 278 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 337

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GG G GGG GGG GG GGGGG
Sbjct: 338 GGGGGGGGGSGGGGGGGGGGGGGGGGGG 365

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 279 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 338

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   G GG GGG GGG GG GGGGG
Sbjct: 339 GGGGGGGGSGGGGGGGGGGGGGGGGGGG 366

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 280 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 339

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG    GGG GGG GGG GG GGGGG
Sbjct: 340 GGGGGGGSGGGGGGGGGGGGGGGGGGGG 367

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 285 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 344

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            G G   GGGG GGG GGG GG GGGGG
Sbjct: 345 GGSGGGGGGGGGGGGGGGGGGGGGGGGG 372

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 286 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 345

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GG   GGGG GGG GGG GG GGGGG
Sbjct: 346 GSGGGGGGGGGGGGGGGGGGGGGGGGGG 373

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG     GGGG 
Sbjct: 293 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGG 352

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 380

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GG GG    GGGGG 
Sbjct: 300 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGG 359

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 387

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  G GGG    GGGGG 
Sbjct: 301 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGG 360

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 361 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 388

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG   GGGG    GGGGG 
Sbjct: 302 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGG 361

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 362 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 389

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   G GG  GGGGG    GGGGG 
Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGG 366

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 367 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 394

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG    GGG  GGGGG    GGGGG 
Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGG 367

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 368 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 395

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGG    GGGG  GGGGG    GGGGG 
Sbjct: 312 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGG 371

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 372 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 399

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGG G   GGGG  GGGGG    GGGGG 
Sbjct: 313 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGG 372

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 373 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 400

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GG GG   GGGG  GGGGG    GGGGG 
Sbjct: 314 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 373

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 374 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 401

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  G GGG   GGGG  GGGGG    GGGGG 
Sbjct: 315 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 374

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 375 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 402

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG   GGGG   GGGG  GGGGG    GGGGG 
Sbjct: 316 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 375

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 376 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 403

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGG   GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 378

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 379 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 406

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGG   GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 384

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 385 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 412

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGG G  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 326 GGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 385

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 386 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 413

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GG GG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 327 GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 386

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 387 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 414

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGG    GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 333 GGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 392

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 393 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 420

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGG G   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 334 GGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 393

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 394 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 421

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGG GG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 335 GGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 394

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 395 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 422

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GG GGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 336 GGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 395

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 396 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 423

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  G GGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 337 GGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 396

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 397 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 424

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG   GGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 338 GGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 397

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 398 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 425

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGG   GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 341 GGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 400

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 401 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 428

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG G  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 342 GGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 401

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 402 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 429

 Score =  122 bits (307), Expect = 9e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGG--GGGGGGGGGGGGGGGGGGGGGG 153

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 154 GGGGGGGGGGGVGGGGGGGGGGGGGGGG 181

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 122 GGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGG 181

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 209

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGG GG R GGGGG  GGGG   GGGG   GGGG  GGGGG    GGGGG 
Sbjct: 213 GGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 272

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 300

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGG G   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 231 GGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 290

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 291 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 318

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGG GG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 232 GGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 291

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 292 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 319

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GG GGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 233 GGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 292

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 293 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 320

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  G GGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 234 GGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 293

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 294 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 321

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGG   GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 238 GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 297

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 298 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 325

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG G  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 239 GGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 298

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 299 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 326

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GG GG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 240 GGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 299

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 300 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 327

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 241 GGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 300

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 301 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 328

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G  GGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 242 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 301

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 302 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 329

 Score =  122 bits (306), Expect = 1e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GG GG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGV 119

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 120 GGGGGVGGGGGGGGGGGGGGGGGGGGGG 147

 Score =  122 bits (306), Expect = 1e-26
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 102 GGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGGG 158

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 159 GGGGGGVGGGGGGGGGGGGGGGGGGGGG 186

 Score =  122 bits (306), Expect = 1e-26
 Identities = 60/89 (67%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG-GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G GGGGG  GGGGGG   GGG GG  GGGG  GGGGG   GGGG  GGGGG    GGGGG
Sbjct: 104 GGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG   GGGG GGG GGG GG GGGGG
Sbjct: 164 GVGGGGGGGGGGGGGGGGGGGGGGGGGGG 192

 Score =  122 bits (306), Expect = 1e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGG 186

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG  GGGG
Sbjct: 187 GGGGGGGGGGGGGGGGGGGGGGGRGGGG 214

 Score =  122 bits (306), Expect = 1e-26
 Identities = 61/93 (65%), Positives = 61/93 (65%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGG-----GGRREGGGGYSGGGGGYSSRG 211
           G GGGGG  GGGGGG   GGGGG  GGGG  GGG     GG R GGGG  GGGGG    G
Sbjct: 187 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGG 246

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 247 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 279

 Score =  122 bits (306), Expect = 1e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G  GGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 227 GGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 286

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 287 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 314

 Score =  122 bits (305), Expect = 2e-26
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 118 GVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGVGGGGGGGGG 174

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 202

 Score =  122 bits (305), Expect = 2e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGG 188

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG G  GGGGG
Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGRGGGGGG 216

 Score =  121 bits (304), Expect = 2e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   G GGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 146 GGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGGR  GGGG GGG GGG GG  GGGG
Sbjct: 206 GGGGRGGGGGGGGGGGGGGDGGGRGGGG 233

 Score =  121 bits (304), Expect = 2e-26
 Identities = 59/88 (67%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGG G 
Sbjct: 172 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGG 231

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG+GGG GG GGGGG
Sbjct: 232 GGGG---GGGGGGGGDGGGGGGGGGGGG 256

 Score =  121 bits (303), Expect = 3e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGG   GGGGG    GGGGG 
Sbjct: 83  GGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGG 142

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGVGGGGG 170

 Score =  121 bits (303), Expect = 3e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGG G   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 112 GGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGG 171

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 172 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 199

 Score =  121 bits (303), Expect = 3e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GG GG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 121 GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGG 180

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 208

 Score =  121 bits (303), Expect = 3e-26
 Identities = 60/89 (67%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG-GRREGGGGYSGGGGGYSSRGGGGG 223
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGG G   GGGG  GGGGG    GGGGG
Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGG 189

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG   GGGG GGG GGG GG GGGGG
Sbjct: 190 GGGGGGGGGGGGGGGGGGGGRGGGGGGGG 218

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG   GGG  GGGGG   GGGG  GGGGG     GGGG 
Sbjct: 65  GGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGG 124

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 125 VGGGGGGGGGGGGGGGGGGGGGGGGGGG 152

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGG  GGGGGG   GGGG   GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 222 GGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 281

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 282 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 309

 Score =  120 bits (301), Expect = 5e-26
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GSGGGGG  GGGGGG   GGGGG  GGGG   GGGG   GGGG SGGGGG    GGGGG 
Sbjct: 49  GSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGG---GGGGGSGGGGGGGGGGGGGGG 105

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG G G GGG GG GGGGG
Sbjct: 106 GGGGGGGGGGGGGVGGGGGVGGGGGGGG 133

 Score =  120 bits (300), Expect = 6e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGG RGGG GG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 38  GGGSGGGGRGGGSGG-GGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGG 96

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 97  GGGGGGGGGGGGGGGGGGGGGGVGGGGG 124

 Score =  120 bits (300), Expect = 6e-26
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GG G  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGG 112

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG  GG GGG GG GGGGG
Sbjct: 113 GGGGGGVGGGGGVGGGGGGGGGGGGGGG 140

 Score =  120 bits (300), Expect = 6e-26
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG   GGGG   GGGG  G GGG    GGGGG 
Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGG 238

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 239 GGGGGDGGGGGGGGGGGGGGGGGGGGGG 266

 Score =  119 bits (299), Expect = 8e-26
 Identities = 61/99 (61%), Positives = 63/99 (63%), Gaps = 2/99 (2%)
 Frame = +2

Query: 20  ITVNEAQSRGSGGGG--GHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGG 193
           +T +   S GS GGG  G  GG GGG R GG GG  GGGG  GGGGG   GGGG  GGGG
Sbjct: 19  VTTDCGYSGGSRGGGCSGCGGGSGGGGRGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78

Query: 194 GYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G    GGGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 79  GSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

 Score =  119 bits (299), Expect = 8e-26
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGG G   GGGGG  GGGG  G GGG   GGGG  GGGGG    GGGGG 
Sbjct: 212 GGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 271

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 299

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGG G   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGG  
Sbjct: 67  GGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVG 126

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 154

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG   GGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    G GGG 
Sbjct: 110 GGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGG 169

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 197

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GG GG  GGGG  GGGG    GGGG  GGGGG    GGGGG 
Sbjct: 209 GRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGG 268

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 296

 Score =  119 bits (297), Expect = 1e-25
 Identities = 58/86 (67%), Positives = 58/86 (67%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 232
           GGGGG  GGGGGG   GGGGG  GGGG  GGGG    GGGG  GGGGG    GGGGG  G
Sbjct: 92  GGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGG 151

Query: 233 GGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG   GGGG GGG GGG GG GGGGG
Sbjct: 152 GGGGGGGGGGGGGVGGGGGGGGGGGG 177

 Score =  118 bits (296), Expect = 2e-25
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG G  GGGGGG   GGGGG  GGGG  GGGGG   GGGG   GGGG    GGGGG 
Sbjct: 120 GGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGG 179

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 207

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GG GGG   GGG G  GGGG  GGGGG   GGGG  GGGGG    GG GG 
Sbjct: 69  GGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGG 128

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 156

 Score =  118 bits (295), Expect = 2e-25
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGG   GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 103 GGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGGG 159

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 160 GGGGGVGGGGGGGGGGGGGGGGGGGGGG 187

 Score =  118 bits (295), Expect = 2e-25
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGG    GGGGG  GGGG  GGGGG   GGGG  GGGGG     GGGG 
Sbjct: 111 GGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGG 170

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 171 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 198

 Score =  117 bits (294), Expect = 3e-25
 Identities = 59/92 (64%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           RG G GGG  GGGGGG   GGGGG  GGGG  GG GG   GGGG  GGGGG    GGGGG
Sbjct: 46  RGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGG 105

Query: 224 SYGGGRREGGG---GYGGGEGGGYGGSGGGGG 310
             GGG   GGG   G GGG GGG GG GGGGG
Sbjct: 106 GGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGG 137

 Score =  117 bits (293), Expect = 4e-25
 Identities = 58/90 (64%), Positives = 58/90 (64%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           S G G GGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GG GG    GGGG
Sbjct: 41  SGGGGRGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGG 100

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G  GGG   GGGG GGG  GG GG GGGGG
Sbjct: 101 GGGGGGGGGGGGGGGGGGVGGGGGVGGGGG 130

 Score =  116 bits (291), Expect = 7e-25
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGG GG   GGGG   GGGG  GGGGG   GGGG  GGGGG    GGG G 
Sbjct: 68  GGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGG 127

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 155

 Score =  112 bits (279), Expect = 2e-23
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 365 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGG----GGGGGG 417

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGG G
Sbjct: 418 GGGG---GGGGGGGGGGGGGGGGGGGVG 442

 Score =  107 bits (267), Expect = 4e-22
 Identities = 58/95 (61%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +2

Query: 29  NEAQ-SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSS 205
           NE Q +   G  GG RGGG  G   G GGG   GGGS GGGGG   GGGG  GGGGG   
Sbjct: 15  NEEQVTTDCGYSGGSRGGGCSGCGGGSGGG-GRGGGSGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 206 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGGGGS GGG   GG G GGG GGG GG GGGGG
Sbjct: 74  GGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGG 108

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 26/39 (66%), Positives = 27/39 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRRE 163
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGG  +E
Sbjct: 406 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGQE 444

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 25/39 (64%), Positives = 25/39 (64%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRRE 163
           G GGGGG  GGGGGG   GGGGG  GGGG  GG G   E
Sbjct: 408 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGQEPE 446

[41][TOP]
>UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B501E
          Length = 406

 Score =  128 bits (321), Expect = 2e-28
 Identities = 59/101 (58%), Positives = 60/101 (59%), Gaps = 4/101 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P    Y PPPPP    PPP PPP PPP    PPP  PPPPP    PPPPP Y PPP  
Sbjct: 214 PPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPP 273

Query: 156 LPPPPP*L----PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPPP      PPPP  PPPPP  Y PPPPP + PPPP P
Sbjct: 274 PPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPP 314

 Score =  127 bits (318), Expect = 5e-28
 Identities = 57/92 (61%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = -3

Query: 315 YHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP* 136
           Y PPPPP PP PPP+  P PPP    PPP  PPPPP    PPPPP Y PPP   PPPPP 
Sbjct: 183 YGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 242

Query: 135 L--PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              PPPP  PPPPP  Y PPPPP + PPPP P
Sbjct: 243 AYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPP 274

 Score =  124 bits (311), Expect = 3e-27
 Identities = 58/100 (58%), Positives = 59/100 (59%), Gaps = 10/100 (10%)
 Frame = -3

Query: 315 YHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP* 136
           Y PPPPP PP PPPS  P PPP    PPP  PPPPP    PPPPP Y PPP   PPPPP 
Sbjct: 114 YAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 173

Query: 135 L----------PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
                      PPPP  PPPPP  Y PPPPP + PPPP P
Sbjct: 174 AYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPP 213

 Score =  123 bits (308), Expect = 7e-27
 Identities = 57/100 (57%), Positives = 59/100 (59%), Gaps = 10/100 (10%)
 Frame = -3

Query: 315 YHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP* 136
           Y PPPPP PP PPP+  P PPP    PPP  PPPPP    PPPPP Y PPP   PPPPP 
Sbjct: 137 YGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 196

Query: 135 L----------PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
                      PPPP  PPPPP  Y PPPPP + PPPP P
Sbjct: 197 AYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPP 236

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/101 (58%), Positives = 61/101 (60%), Gaps = 4/101 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPP---LPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPP 166
           P P    Y PPPPP    PP PP   PP PPPP   PP   PPPPP    PPPPP  PPP
Sbjct: 90  PPPPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPP 149

Query: 165 PSRLPPPPP*L-PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P+  PPPPP   PPPP  PPPPP  Y PPPPP + PPPP P
Sbjct: 150 PAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPP 190

 Score =  121 bits (303), Expect = 3e-26
 Identities = 62/121 (51%), Positives = 65/121 (53%), Gaps = 24/121 (19%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*P-------------PPSPPPYPPPPSRL----PPP*LPPPPP 208
           P P    Y PPPPP PP P             PP PPP PPPP+      PPP  PPPPP
Sbjct: 237 PPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPP 296

Query: 207 LEE*PPPPPLY-----PPPPSRLPPPPP*L--PPPPE*PPPPPLRYPPPPPPRWPPPPPL 49
               PPPPP Y     PPPP+  PPPPP    P PP  PPPPP   PPPPPP + PPPP 
Sbjct: 297 PAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPP 356

Query: 48  P 46
           P
Sbjct: 357 P 357

 Score =  119 bits (297), Expect = 1e-25
 Identities = 58/97 (59%), Positives = 59/97 (60%), Gaps = 1/97 (1%)
 Frame = -3

Query: 333 KPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRL 154
           KP    Y PPPP   P  PP PP Y PPP   PP   PPPPP    PPPPP  PPPPS  
Sbjct: 75  KPAPPAYAPPPPVYAP--PPPPPAYAPPPP--PPAYAPPPPPAYAPPPPPPPPPPPPSYG 130

Query: 153 PPPPP*L-PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPPP   PPPP  PPPPP  Y PPPPP + PPPP P
Sbjct: 131 PPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPP 167

 Score =  119 bits (297), Expect = 1e-25
 Identities = 56/92 (60%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = -3

Query: 315 YHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP* 136
           Y PPPPP PP PPP+  P PPP    PPP  PPPPP    PPPPP  PPPP+   PPPP 
Sbjct: 206 YGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPP 265

Query: 135 L--PPPPE*PPPPPLRY---PPPPPPRWPPPP 55
              PPPP  PPPPP  Y   PPPPPP  PPPP
Sbjct: 266 AYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPP 297

 Score =  117 bits (293), Expect = 4e-25
 Identities = 55/95 (57%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = -3

Query: 315 YHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRL----PP 148
           Y PPPPP PP PPP+  P PPPP   PP    PPPP    PPPPP  PPPP+      PP
Sbjct: 229 YGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPP 288

Query: 147 PPP*LPPPPE*PPPPPLRY---PPPPPPRWPPPPP 52
           PPP  PPPP   PPPP  Y   PPPPPP + PPPP
Sbjct: 289 PPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPP 323

 Score =  117 bits (292), Expect = 5e-25
 Identities = 60/104 (57%), Positives = 60/104 (57%), Gaps = 9/104 (8%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPL-----PP*PPPSPPPY-PPPPSRLPPP*LPPPPPLEE*PPPPPLY 175
           P P    Y PPPPP      PP PPP PP Y PPPP    PP  PPPPP    PPPPP Y
Sbjct: 145 PPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPP--PPPPP----PPPPPAY 198

Query: 174 PPPPSRL---PPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
            PPP      PPPPP  PPPP   PPPP  Y PPPPP  PPPPP
Sbjct: 199 GPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 242

 Score =  115 bits (287), Expect = 2e-24
 Identities = 56/92 (60%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = -3

Query: 315 YHPPPPPLPP*PPPSPPPY--PPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRL--PP 148
           Y PPPPP    PPP PP Y  PPPP+  PPP  PPPPP    PPPP   PPPP     PP
Sbjct: 88  YAPPPPPPAYAPPPPPPAYAPPPPPAYAPPP--PPPPP----PPPPSYGPPPPPAYGPPP 141

Query: 147 PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
           PPP  PPPP   PPPP  Y PPPPP  PPPPP
Sbjct: 142 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 173

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/113 (51%), Positives = 62/113 (54%), Gaps = 15/113 (13%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPS-----PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYP 172
           P P    Y PPPPP PP PPP+     PP Y PPP   PP   PPPPP    P PPP  P
Sbjct: 277 PPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPP 336

Query: 171 PPPSRLPPPPP*L-----PPPPE*PPPPPLRYPPPP-----PPRWPPPPPLPR 43
           PPP+  PPPPP       PPP   PPPPP +Y P P     PP  PPPPP P+
Sbjct: 337 PPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVVYGPPAPPPPPPAPK 389

 Score =  114 bits (285), Expect = 3e-24
 Identities = 57/103 (55%), Positives = 60/103 (58%), Gaps = 12/103 (11%)
 Frame = -3

Query: 315 YHPPPPPLPP*PP-------PSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLY--PPPP 163
           Y PPPPP PP PP       P PPP PPPP    PP  PPP      PPPPP Y  PPPP
Sbjct: 267 YGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPP--PPPAYGPPPPPPPPAYAPPPPP 324

Query: 162 SRLPPPPP*LPPPP---E*PPPPPLRYPPPPPPRWPPPPPLPR 43
           +  PP PP  PPPP     PPPPP   PPPPPP + PPPP P+
Sbjct: 325 AYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPK 367

 Score =  104 bits (259), Expect = 3e-21
 Identities = 54/103 (52%), Positives = 58/103 (56%), Gaps = 16/103 (15%)
 Frame = -3

Query: 315 YHPPPPPLPP*PPPS---------PPPYPPPPSRLPPP*L---PPPPPLEE*PPPPPLY- 175
           Y   P P PP PPP+          P  P PP+  PPP +   PPPPP    PPPPP Y 
Sbjct: 48  YAVVPAPQPPPPPPAYDDCDEIVLVPGKPAPPAYAPPPPVYAPPPPPPAYAPPPPPPAYA 107

Query: 174 -PPPPSRLPPPPP*LPPPPE*--PPPPPLRYPPPPPPRWPPPP 55
            PPPP+  PPPPP  PPPP    PPPPP   PPPPPP  PPPP
Sbjct: 108 PPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPP 150

 Score =  100 bits (248), Expect = 7e-20
 Identities = 49/94 (52%), Positives = 52/94 (55%), Gaps = 15/94 (15%)
 Frame = -3

Query: 282 PPPSPPPYPPP----------PSRLPPP*LPPPPPLEE*PPPPPLY---PPPPSRLPPPP 142
           P P PPP PP           P +  PP   PPPP+   PPPPP Y   PPPP+  PPPP
Sbjct: 52  PAPQPPPPPPAYDDCDEIVLVPGKPAPPAYAPPPPVYAPPPPPPAYAPPPPPPAYAPPPP 111

Query: 141 P*L--PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P    PPPP  PPPPP   PPPPP   PPPPP P
Sbjct: 112 PAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPP 145

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 48/104 (46%), Positives = 53/104 (50%), Gaps = 14/104 (13%)
 Frame = -3

Query: 315 YHPPPPPLP-P*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLY---PPPPSRLPP 148
           Y P    +P P PPP PP Y      +  P  P PP      PPPP+Y   PPPP+  PP
Sbjct: 44  YSPVYAVVPAPQPPPPPPAYDDCDEIVLVPGKPAPPAYA---PPPPVYAPPPPPPAYAPP 100

Query: 147 PPP----------*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP            PPPP  PPPPP  Y PPPPP + PPPP P
Sbjct: 101 PPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPP 144

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/80 (45%), Positives = 38/80 (47%), Gaps = 20/80 (25%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPL-----PP*PPPSPPPY---PPPPSRLPPP*----LPPPPP----- 208
           P P    Y PPPPP      PP PPP PP Y   PPPP+  PPP      PPPPP     
Sbjct: 311 PPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSP 370

Query: 207 ---LEE*PPPPPLYPPPPSR 157
              +   PP PP  PP P R
Sbjct: 371 APIVVYGPPAPPPPPPAPKR 390

[42][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score =  127 bits (320), Expect = 3e-28
 Identities = 63/105 (60%), Positives = 66/105 (62%), Gaps = 8/105 (7%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*P----PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPP 169
           P P    Y PPPPP PP P    PP PPP PPPP   PPP  PPPPP    PPPPP+Y P
Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPP--PPPPP----PPPPPVYSP 482

Query: 168 PPSRLPPPPP*L--PPPPE*PPPPPLRYPPPPPPRW--PPPPPLP 46
           PP   PPPPP +  PPPP  PPPPP  Y PPPPP +  PPPPP P
Sbjct: 483 PPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527

 Score =  117 bits (294), Expect = 3e-25
 Identities = 56/89 (62%), Positives = 58/89 (65%), Gaps = 3/89 (3%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP---* 136
           PPPP PP P  SPPP PPPP   PP   PPPPP    PPPPP+Y PPP   PPPPP    
Sbjct: 426 PPPPSPPPPVYSPPPPPPPP---PPVYSPPPPPPP--PPPPPVYSPPPPPPPPPPPPPVY 480

Query: 135 LPPPPE*PPPPPLRYPPPPPPRWPPPPPL 49
            PPPP  PPPPP  Y PPPPP  PPPPP+
Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPPPPPPPPV 509

 Score =  115 bits (287), Expect = 2e-24
 Identities = 60/107 (56%), Positives = 62/107 (57%), Gaps = 13/107 (12%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPP--SPPPYPPPP-------SRLPPP*LPPPPPLEE*PPPP 184
           P P    Y PPPPP PP PPP  SPPP PPPP       S  PP   PPPPP+   PPPP
Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501

Query: 183 PLYPPPPSRLPPPPP*L--PPPPE*PPPPPL--RYPPPPPPRWPPPP 55
           P  PPPP   PPPPP    PPPP  P P P+    PPPPPP  PPPP
Sbjct: 502 PPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548

 Score =  110 bits (276), Expect = 4e-23
 Identities = 60/110 (54%), Positives = 63/110 (57%), Gaps = 13/110 (11%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPP--SPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
           P P    Y PPPP  PP PPP  SPPP PPPP   PP   PPPPP+   PPPPP   P P
Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPP-PPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531

Query: 162 ---SRLPPPPP*LPPPPE*PPPPPLRY----PPP----PPPRWPPPPPLP 46
              +R PPPPP  PPPP+  PPPP  Y    PPP    PPP  PPPP  P
Sbjct: 532 VYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSP 581

 Score =  105 bits (263), Expect = 1e-21
 Identities = 53/93 (56%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -3

Query: 321 RNYHPPPPPLPP*PPPS-PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPP 145
           R+  P PP + P PPPS P P PP P    PP L  PPP     PPPP+Y PPP   PPP
Sbjct: 390 RSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPS---PPPPVYSPPPPPPPPP 446

Query: 144 PP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P   PPPP  PPPPP  Y PPPPP  PPPPP P
Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPP-PPPPPPP 478

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 58/121 (47%), Positives = 61/121 (50%), Gaps = 24/121 (19%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPL--PP*PPPSPPPY--------PPPPSRLPPP*LPPPPP----LEE 199
           P P    Y PPPPP+   P PPPSP P         PPPP   PPP   PPPP       
Sbjct: 503 PPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSS 562

Query: 198 *PPP---PPLYPPPPSRLPPPP--P*LPPPP-----E*PPPPPLRYPPPPPPRWPPPPPL 49
            PPP   PP + PPP   PPPP  P L PPP       PPP P+  PPPPPP   PPPP 
Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPP 622

Query: 48  P 46
           P
Sbjct: 623 P 623

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 57/109 (52%), Positives = 57/109 (52%), Gaps = 21/109 (19%)
 Frame = -3

Query: 309 PPPPPLPP*PP---PSPPPY----PPPPSRLPPP*L---PPPPPLEE*PPPPPLYPPPP- 163
           PPPPP PP PP   P PPP     PPPPS  P P     PPPPP    PPPP   PPPP 
Sbjct: 498 PPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHS-PPPPQFSPPPPE 556

Query: 162 ----SRLPP----PPP*LPPPPE*PPPP--PLRYPPPPPPRWPPPPPLP 46
               S  PP    PPP  PPPP  PPPP  P   PPPPP     PPP P
Sbjct: 557 PYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTP 605

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 56/112 (50%), Positives = 61/112 (54%), Gaps = 25/112 (22%)
 Frame = -3

Query: 309 PPPPPLPP*P---PPSPPPY----PPPPSRLPPP*LPPPPPLEE*PPPPPLYP-----PP 166
           PPPP  PP P   PP P PY    PPPP   PPP  PPPP      PPPP+YP     PP
Sbjct: 539 PPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPH----SPPPPIYPYLSPPPP 594

Query: 165 PSRL--PPPPP*LPPPP-----E*PPPPP-LRYPPPPPP-----RWPPPPPL 49
           P+ +  PPP P   PPP     E PPPPP + Y PPPPP       PPPPP+
Sbjct: 595 PTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPV 646

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/113 (47%), Positives = 59/113 (52%), Gaps = 25/113 (22%)
 Frame = -3

Query: 309 PPPPPL----PP*PPPSPPPYPPPPSRLPPP*L------PPPPPLEE*PPPPPLY---PP 169
           PPP P     PP P  SPPP+ PPP   PPP +      PPPP     PPP P+Y   PP
Sbjct: 553 PPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPP 612

Query: 168 PPSRLPPPPP*L------PPPP----E*PPPPPLRY--PPPPPPRWPPPPPLP 46
           PP   PPPPP        PPPP      PPPPP+ Y  PPPPP  +  PPP P
Sbjct: 613 PPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPP 665

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 57/121 (47%), Positives = 60/121 (49%), Gaps = 33/121 (27%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*L--PPPPPLEE-------------*PPPPPLY 175
           PPPPP P   PP  P Y PPP   PPP +  PPPPP  E              PPPPP+Y
Sbjct: 591 PPPPPTPVSSPPPTPVYSPPP---PPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVY 647

Query: 174 ---PPPP----SRLPPPPP---*LPPPPE----*PPPPPLRYPPPPPPRWPP----PPPL 49
              PPPP    S  PPPPP     PPPPE     PPP P+ Y  PPPP   P    PPP 
Sbjct: 648 YSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPA 707

Query: 48  P 46
           P
Sbjct: 708 P 708

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 60/142 (42%), Positives = 68/142 (47%), Gaps = 40/142 (28%)
 Frame = -3

Query: 351  TFIGNPKPN*RNYHPPPPPL--PP*PPP----SPPP--------YPPPP----SRLPPP* 226
            T + +P P      PPPPP   PP PPP    SPPP         PPPP    S  PPP 
Sbjct: 596  TPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655

Query: 225  L-----PPPPPLEE*PPPPP---LYPPPPSRL----PPPPP*LP----PPP----E*PPP 106
            +     PPPPP+    PPPP    + PPPS +    PPPPP  P    PPP       PP
Sbjct: 656  VYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPP 715

Query: 105  PPLRYPPPPPP--RWPPPPPLP 46
            PP+ +  PPPP     PPPP P
Sbjct: 716  PPMVHHSPPPPVIHQSPPPPSP 737

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 50/117 (42%), Positives = 56/117 (47%), Gaps = 18/117 (15%)
 Frame = -3

Query: 348 FIGNPKPN*RNYHPPPPPLPP*PPPSPPP-----YPPPPSRL----PPP*LPPPPPLEE* 196
           +  +P P    Y  PPPP PP    SPPP     + PPPS +    PPP  PP  P EE 
Sbjct: 647 YYSSPPPPPVYYSSPPPP-PPVHYSSPPPPEVHYHSPPPSPVHYSSPPP--PPSAPCEES 703

Query: 195 PPPPPLY---PPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPP------RWPPPPP 52
           PPP P+    PPPP     PPP  P   + PPPP   Y  P PP        PPPPP
Sbjct: 704 PPPAPVVHHSPPPPMVHHSPPP--PVIHQSPPPPSPEYEGPLPPVIGVSYASPPPPP 758

[43][TOP]
>UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA
          Length = 599

 Score =  127 bits (320), Expect = 3e-28
 Identities = 60/108 (55%), Positives = 65/108 (60%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P PN      PP PLPP PPP PPP PPP    PPP  PP PP    PPPPP  PPPP  
Sbjct: 213 PLPN-----APPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLPRD*ASLTVMLR 13
            PPPPP   PPP  PPPPP   PPPPPP  PPPPP+  D  S+ ++ +
Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQCSVCIVAK 315

 Score =  105 bits (262), Expect = 2e-21
 Identities = 53/92 (57%), Positives = 56/92 (60%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
           +P P+     PPPPP PP  PP PPP PPPP        PPPPP    PPPPP  PPPP 
Sbjct: 233 SPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPP-------PPPPP----PPPPPPSPPPP- 280

Query: 159 RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWP 64
             PPPPP  PPPP  PPPPP   PPPPPP +P
Sbjct: 281 --PPPPP--PPPPPPPPPPP---PPPPPPVYP 305

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/81 (58%), Positives = 48/81 (59%)
 Frame = -3

Query: 288 P*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PP 109
           P P P+ PP P PPS       PPPPP    PP PP  PPPP   PPPPP  PPP   PP
Sbjct: 211 PLPLPNAPPSPLPPS-------PPPPP----PPSPPPSPPPP---PPPPPPSPPPSPPPP 256

Query: 108 PPPLRYPPPPPPRWPPPPPLP 46
           PPP   PPPPPP  PPPPP P
Sbjct: 257 PPP---PPPPPPPPPPPPPPP 274

[44][TOP]
>UniRef100_B7PFE5 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PFE5_IXOSC
          Length = 202

 Score =  127 bits (319), Expect = 4e-28
 Identities = 62/93 (66%), Positives = 62/93 (66%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG 211
           EA   G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    G
Sbjct: 107 EALGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 172

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 173 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 200

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 173

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 174 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 201

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 174

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 202

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 44/76 (57%), Positives = 45/76 (59%)
 Frame = +2

Query: 83  GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGY 262
           G   RS    G S    + GGGGG   GGGG  GGGGG    GGGGG  GGG   GGGG 
Sbjct: 91  GRSRRSYSPEGISHRLEALGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 150

Query: 263 GGGEGGGYGGSGGGGG 310
           GGG GGG GG GGGGG
Sbjct: 151 GGGGGGGGGGGGGGGG 166

[45][TOP]
>UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=A7UVF7_ANOGA
          Length = 147

 Score =  127 bits (319), Expect = 4e-28
 Identities = 58/85 (68%), Positives = 58/85 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 27  PPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPP----PPPPPPPPPPPPPPPPPPPPPP 80

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPP 55
           PPP  PPPPP   PPPPPP  PPPP
Sbjct: 81  PPPPPPPPPP---PPPPPPPLPPPP 102

 Score =  127 bits (318), Expect = 5e-28
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PP PP PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 24  PPRPPPPPPPPPPPPPPPPPP---PPP--PPPPP----PPPPPPPPPPPPPPPPPPPPPP 74

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPPPPP  PPPPPLP
Sbjct: 75  PPPPPPPPPP---PPPPPPPPPPPPPLP 99

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/80 (63%), Positives = 51/80 (63%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PPP PPP PPPP        PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 48  PPPPPPPPPPPPPPPPPPPPP--------PPPPP----PPPPP--PPPP---PPPPP--P 88

Query: 129 PPPE*PPPPPLRYPPPPPPR 70
           PPP  PPPPP   P PPPPR
Sbjct: 89  PPP--PPPPP---PLPPPPR 103

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 27/40 (67%), Positives = 27/40 (67%)
 Frame = -3

Query: 165 PSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P  LPP PP  PPPP  PPPPP   PPPPPP  PPPPP P
Sbjct: 20  PHLLPPRPP--PPPP--PPPPPPPPPPPPPPPPPPPPPPP 55

[46][TOP]
>UniRef100_B7PE98 Glycine rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PE98_IXOSC
          Length = 156

 Score =  127 bits (318), Expect = 5e-28
 Identities = 62/100 (62%), Positives = 63/100 (63%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG 190
           G+       Q  G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGG
Sbjct: 25  GKKYRCYNIQGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84

Query: 191 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG    GGGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 85  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 38  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 98  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 125

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 39  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 126

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 40  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 127

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 41  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 128

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 42  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 129

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 43  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 130

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 131

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 45  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 132

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 46  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 133

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 47  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 134

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 48  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 135

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 49  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 136

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 50  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 137

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 51  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 138

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 52  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 139

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 140

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 54  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 141

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 55  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 143

 Score =  104 bits (260), Expect = 3e-21
 Identities = 53/93 (56%), Positives = 56/93 (60%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG 211
           +A+    G G  +R     G   GGGGG  GGGG  GGGGG   GGGG  GGGGG    G
Sbjct: 16  KAEQAVEGAGKKYRCYNIQGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 76  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 51/76 (67%), Positives = 51/76 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 78  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGG----GGGGGG 130

Query: 227 YGGGRREGGGGYGGGE 274
            GGG   GGGG GGGE
Sbjct: 131 GGGG--GGGGGGGGGE 144

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 44/66 (66%), Positives = 44/66 (66%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 80  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 139

Query: 227 YGGGRR 244
            GGG R
Sbjct: 140 GGGGER 145

[47][TOP]
>UniRef100_Q03878 Glycine-rich RNA-binding protein n=1 Tax=Daucus carota
           RepID=GRP1_DAUCA
          Length = 157

 Score =  127 bits (318), Expect = 5e-28
 Identities = 70/107 (65%), Positives = 72/107 (67%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSG--GGGSYGGGGGRRE-GGG 172
           +LDGR+ITVNEAQSRGSGGGGG R GGGGGY  GGGGGY G   GG  GG GGRRE GGG
Sbjct: 71  ELDGRNITVNEAQSRGSGGGGGRREGGGGGY--GGGGGYGGRREGGGGGGYGGRREGGGG 128

Query: 173 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GY GGGGGY           GGRREGG        GGYGG GGG  W
Sbjct: 129 GYGGGGGGY-----------GGRREGG-------DGGYGGGGGGSRW 157

[48][TOP]
>UniRef100_A9P8Z7 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8Z7_POPTR
          Length = 165

 Score =  126 bits (317), Expect = 7e-28
 Identities = 68/101 (67%), Positives = 70/101 (69%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGR+ITVNEAQSRGSGGGGG     GGGY  GGGGGY  GG   GGGGG   GGGGY 
Sbjct: 72  DLDGRNITVNEAQSRGSGGGGG-----GGGYSRGGGGGY--GGRREGGGGGYSRGGGGYG 124

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
           GGGGGY   GGGGG YGGG R+ G G GG      GGS GG
Sbjct: 125 GGGGGY---GGGGGGYGGG-RDRGYGDGGSRYSSRGGSDGG 161

[49][TOP]
>UniRef100_A9P8S6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9P8S6_POPTR
          Length = 170

 Score =  126 bits (317), Expect = 7e-28
 Identities = 68/104 (65%), Positives = 70/104 (67%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGR+ITVNEAQSRGSGGGGG   GGGG  R+ GGGGY GGGG   GGGG   GGGGY 
Sbjct: 72  DLDGRNITVNEAQSRGSGGGGG---GGGGYNRNSGGGGY-GGGGRREGGGGYSRGGGGYG 127

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGG GY S GGGGG YGGGR  G G   GG      G   GG W
Sbjct: 128 GGGSGYGS-GGGGGGYGGGRDRGYG--DGGSRYSSRGESEGGSW 168

[50][TOP]
>UniRef100_UPI0000E491FD PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E491FD
          Length = 116

 Score =  126 bits (316), Expect = 9e-28
 Identities = 62/88 (70%), Positives = 62/88 (70%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GSGGGGG  GGGGGGY SGGGGG  GGG S GGGGG   GGGG  GGGGG  S GGGGG 
Sbjct: 30  GSGGGGGDSGGGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGG--GGGGGGDSGGGGGGY 87

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GG   GGGG GGG GGG  G GGGGG
Sbjct: 88  SSGGGGGGGGGGGGGGGGGDSGGGGGGG 115

 Score =  113 bits (282), Expect = 7e-24
 Identities = 59/94 (62%), Positives = 61/94 (64%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           + + S  SGGGG    GGGGG   GGGGGYS GGG   GGGG   GGG   GGGGGYSS 
Sbjct: 19  DHSHSYSSGGGGS---GGGGGDSGGGGGGYSSGGG---GGGG---GGGDSGGGGGGYSSG 69

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGGG  GG    GGGGY  G GGG GG GGGGG
Sbjct: 70  GGGGGGGGGDSGGGGGGYSSGGGGGGGGGGGGGG 103

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 35/67 (52%), Positives = 38/67 (56%), Gaps = 3/67 (4%)
 Frame = +2

Query: 119 SGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGY---GGGEGGGYG 289
           SG GG +      ++    YS GGGG    GGGGG  GG    GGGGY   GGG GGG G
Sbjct: 8   SGQGGDHSD---HQDHSHSYSSGGGG---SGGGGGDSGG----GGGGYSSGGGGGGGGGG 57

Query: 290 GSGGGGG 310
            SGGGGG
Sbjct: 58  DSGGGGG 64

[51][TOP]
>UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK2_CHLRE
          Length = 541

 Score =  126 bits (316), Expect = 9e-28
 Identities = 58/86 (67%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*LP 130
           PPPP PP PPP PPP PPPPS  PPP  PPPPP    PPPPP  PPPPS  PP PPP  P
Sbjct: 175 PPPPPPPSPPPPPPPSPPPPS--PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 232

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPP 52
           PPP  PPPPP   PPP PP   PPPP
Sbjct: 233 PPPSPPPPPPPSPPPPSPPPPSPPPP 258

 Score =  101 bits (252), Expect = 2e-20
 Identities = 48/76 (63%), Positives = 48/76 (63%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPP P PP PPP  PP PPPPS  PPP   PPPP    P PPP  PPPPS  PPPPP  P
Sbjct: 187 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP-SP 245

Query: 129 PPPE*PPPPPLRYPPP 82
           PPP  PPP P   PPP
Sbjct: 246 PPPSPPPPSP---PPP 258

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 45/78 (57%), Positives = 45/78 (57%), Gaps = 7/78 (8%)
 Frame = -3

Query: 258 PPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*P-------PPPP 100
           PPPP   PPP  PPPPP    P PPP  PPPPS  PPPPP   PPP  P       PPPP
Sbjct: 175 PPPP---PPPSPPPPPP----PSPPPPSPPPPS--PPPPPPPSPPPPPPPSPPPPSPPPP 225

Query: 99  LRYPPPPPPRWPPPPPLP 46
              PP PPP  PPPPP P
Sbjct: 226 SPPPPSPPPPSPPPPPPP 243

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 40/65 (61%), Positives = 41/65 (63%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPPPP PP PP  PPP PPPPS  PPP  PPPPP    P PPP  PPPPS 
Sbjct: 202 PPPPPPSPPPPPPPSPP-PPSPPPPSPPPPSP-PPPSPPPPPP----PSPPPPSPPPPS- 254

Query: 156 LPPPP 142
            PPPP
Sbjct: 255 -PPPP 258

[52][TOP]
>UniRef100_B7PCR0 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PCR0_IXOSC
          Length = 229

 Score =  126 bits (316), Expect = 9e-28
 Identities = 61/90 (67%), Positives = 61/90 (67%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           S G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGG
Sbjct: 126 SGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 185

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 215

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 188

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 216

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 189

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 190 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 217

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 190

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 218

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 191

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 192 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 219

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 192

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 193 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 220

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 194 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 221

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 194

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 195 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 222

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 195

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 196 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 223

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 197 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 224

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 198 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 225

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 199 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 226

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 200 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 227

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 201 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 228

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 202 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 229

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 25/37 (67%), Positives = 25/37 (67%)
 Frame = +2

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           S   GGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 123 SCMSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159

[53][TOP]
>UniRef100_B7P671 Cement protein, putative n=1 Tax=Ixodes scapularis
           RepID=B7P671_IXOSC
          Length = 324

 Score =  126 bits (316), Expect = 9e-28
 Identities = 60/89 (67%), Positives = 61/89 (68%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           +G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG
Sbjct: 33  KGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG   GGGG GGG GGG GG GGGGG
Sbjct: 93  GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 121

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 35  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 95  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 122

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 36  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 123

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 37  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 97  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 124

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 38  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 98  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 125

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 39  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 126

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 40  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 127

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 41  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 128

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 42  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 129

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 43  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 130

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 131

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 45  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 132

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 46  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 133

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 47  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 134

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 48  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 135

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 49  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 136

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 50  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 137

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 51  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 138

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 52  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 139

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 140

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 54  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 141

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 55  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 143

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 57  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 144

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 58  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 145

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 59  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 119 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 146

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 120 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 147

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 121 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 148

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 62  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 121

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 149

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 63  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 122

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 150

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 64  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 151

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 65  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 125 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 152

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 66  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 125

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 153

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 67  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 126

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 154

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 68  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 127

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 155

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 69  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 128

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 156

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 70  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 129

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 157

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 71  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 130

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 158

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 72  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 131

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 159

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 73  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 132

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 160

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 74  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 133

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 161

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 75  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 134

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 162

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 76  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 135

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 163

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 77  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 136

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 164

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 78  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 137

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 165

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 79  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 138

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 166

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 80  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 139

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 167

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 81  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 140

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 168

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 82  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 141

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 169

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 83  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 142

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 170

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 84  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 143

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 171

 Score =  124 bits (311), Expect = 3e-27
 Identities = 61/94 (64%), Positives = 62/94 (65%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           +E  S   GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    
Sbjct: 27  SELLSYKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 87  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 43/67 (64%), Positives = 44/67 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 168

Query: 227 YGGGRRE 247
            GG  +E
Sbjct: 169 GGGXXKE 175

[54][TOP]
>UniRef100_Q5TU53 AGAP002965-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=Q5TU53_ANOGA
          Length = 212

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/89 (67%), Positives = 61/89 (68%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           +G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG
Sbjct: 12  QGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG   GGGG GGG GGG GG GGGGG
Sbjct: 72  GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 14  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 74  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

 Score =  124 bits (311), Expect = 3e-27
 Identities = 60/90 (66%), Positives = 60/90 (66%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           Q  G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGG
Sbjct: 12  QGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GG  GGG   GGGG GGG GGG GG GGGG
Sbjct: 72  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

 Score =  123 bits (309), Expect = 6e-27
 Identities = 59/91 (64%), Positives = 61/91 (67%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           + +G  GGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGG
Sbjct: 7   RGKGKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 67  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

 Score =  123 bits (309), Expect = 6e-27
 Identities = 59/91 (64%), Positives = 61/91 (67%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           + +  GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGG
Sbjct: 9   KGKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 69  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

 Score =  118 bits (296), Expect = 2e-25
 Identities = 57/86 (66%), Positives = 58/86 (67%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 232
           G G G +GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG  G
Sbjct: 6   GRGKGKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65

Query: 233 GGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG   GGGG GGG GGG GG GGGGG
Sbjct: 66  GGGGGGGGGGGGGGGGGGGGGGGGGG 91

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/91 (62%), Positives = 59/91 (64%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           + +G  G G   GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGG
Sbjct: 2   KKKGGRGKGKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 62  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

 Score =  112 bits (280), Expect = 1e-23
 Identities = 58/97 (59%), Positives = 58/97 (59%), Gaps = 9/97 (9%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 26  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85

Query: 227 YGGGRREGGGGYGGGEGGGYG---------GSGGGGG 310
            GGG   GGGG GGG  G YG         G GGG G
Sbjct: 86  GGGGGGGGGGGGGGGGVGAYGSVRSTSSDRGRGGGTG 122

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/91 (59%), Positives = 54/91 (59%), Gaps = 8/91 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 38  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGG 93

Query: 227 YGGGRREGGGGYGG--------GEGGGYGGS 295
            GGG   G G YG         G GGG GGS
Sbjct: 94  GGGGGGGGVGAYGSVRSTSSDRGRGGGTGGS 124

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 40/77 (51%), Positives = 41/77 (53%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   G G Y       S RG GGG+
Sbjct: 62  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGAYGSVRSTSSDRGRGGGT 121

Query: 227 YGGGRREGGGGYGGGEG 277
            G        G  GG G
Sbjct: 122 GGSPSMVPTIGTLGGIG 138

[55][TOP]
>UniRef100_B7PFE7 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PFE7_IXOSC
          Length = 254

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 19  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 79  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 20  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 80  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 21  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 81  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 22  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 82  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 23  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 83  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 24  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 84  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 25  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 85  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 26  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 86  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 27  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 87  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 28  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 88  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 29  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 89  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 30  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 90  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 31  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 91  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 118

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 32  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 92  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 119

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 33  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 93  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 120

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 34  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 94  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 121

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 35  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 95  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 122

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 36  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 123

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 37  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 97  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 124

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 38  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 98  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 125

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 39  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 126

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 40  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 127

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 41  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 128

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 42  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 129

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 43  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 130

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 131

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 45  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 132

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 46  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 133

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 47  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 134

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 48  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 135

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 49  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 136

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 50  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 137

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 51  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 138

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 52  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 139

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 140

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 54  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 141

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 55  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 143

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 57  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 144

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 58  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 145

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 40/60 (66%), Positives = 41/60 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG+
Sbjct: 87  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGA 146

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 35/53 (66%), Positives = 35/53 (66%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSS 205
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGG   S
Sbjct: 97  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAIVS 149

[56][TOP]
>UniRef100_B7PDJ6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PDJ6_IXOSC
          Length = 275

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 88

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 2   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 62  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 89

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 3   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 63  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 90

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 4   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 64  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 91

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 5   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 65  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 6   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 66  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 93

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 7   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 67  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 8   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 68  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 9   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 69  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 96

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 10  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 70  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 11  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 71  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 12  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 72  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 13  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 73  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 14  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 74  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 15  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 75  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 16  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 76  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 41/61 (67%), Positives = 42/61 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGGS
Sbjct: 45  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGS 104

Query: 227 Y 229
           +
Sbjct: 105 H 105

[57][TOP]
>UniRef100_Q1XG61 Putative glycine-rich RNA binding protein n=1 Tax=Cryptomeria
           japonica RepID=Q1XG61_CRYJA
          Length = 181

 Score =  124 bits (312), Expect = 2e-27
 Identities = 74/115 (64%), Positives = 76/115 (66%), Gaps = 11/115 (9%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGG--GGYSGGG-GSY----GGGGGRR 160
           DLDGR+ITVN AQ+RG GGGGG   GGGGGYR GGG  GGY GGG G Y     GGGG  
Sbjct: 73  DLDGRNITVNRAQARGGGGGGG---GGGGGYRGGGGGSGGYGGGGSGGYESRRSGGGG-- 127

Query: 161 EGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG--YGGSG--GGGGW 313
            GGGGYSGGG   S RG GGGS  GG   G GGY GG GGG  YGG G    GGW
Sbjct: 128 SGGGGYSGGGRERSERGYGGGSRNGG---GYGGYSGGGGGGSRYGGGGVSDDGGW 179

[58][TOP]
>UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO
          Length = 2618

 Score =  124 bits (312), Expect = 2e-27
 Identities = 59/102 (57%), Positives = 61/102 (59%), Gaps = 5/102 (4%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*-----PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYP 172
            P P      PPPPPLPP      PPP PPP+PPPPS  PPP   PPP   + P PPP  P
Sbjct: 2055 PPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSP 2114

Query: 171  PPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PP   PPPPP  PPPP  PPP PL  PPP PP  PPPPP P
Sbjct: 2115 SPPPPSPPPPPSPPPPPPSPPPAPLPPPPPSPPPSPPPPPSP 2156

 Score =  119 bits (297), Expect = 1e-25
 Identities = 65/122 (53%), Positives = 67/122 (54%), Gaps = 25/122 (20%)
 Frame = -3

Query: 336  PKPN*RNYHPPP--------PPLPP*PPPSPPPY------PPPPSRLPPP*--LPPPPPL 205
            P PN    HPPP        PPLP  PPPSPPP       PPPP+ LPPP   LPPP P 
Sbjct: 2020 PPPN----HPPPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPS 2075

Query: 204  EE*PPPPPLYPPPPSRLPPPPP---------*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
               PPPPP +PPPPS  PPPPP           PPPP   PPPP    PPPPP  PPPPP
Sbjct: 2076 PSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPP---SPPPPPSPPPPPP 2132

Query: 51   LP 46
             P
Sbjct: 2133 SP 2134

 Score =  118 bits (296), Expect = 2e-25
 Identities = 62/115 (53%), Positives = 66/115 (57%), Gaps = 9/115 (7%)
 Frame = -3

Query: 363  ARERTFIGNPKPN*RNYHPPPPPLPP*PP-PSPPPYPPPPSRLPPP*LPPPPPLEE*PPP 187
            A  + +   P+P   +  P PPPLP  PP PSPPP  PPP   PPP  PPPPP    PPP
Sbjct: 2009 AAPKQYADAPRPPPNHPPPSPPPLPSPPPLPSPPPPSPPPLSPPPP--PPPPPAPLPPPP 2066

Query: 186  PPLYPPPPSRLPPPPP*-LPPPPE*PPPPPLRYPP-------PPPPRWPPPPPLP 46
            PPL PP PS  PPPPP   PPPP  PPPPP   PP       PPPP   PPPP P
Sbjct: 2067 PPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSP 2121

 Score =  115 bits (288), Expect = 2e-24
 Identities = 55/94 (58%), Positives = 58/94 (61%), Gaps = 6/94 (6%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPP------YPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP 148
            PPPP  PP PPP+PPP      +PPPPS  PPP  PPPPP     PPPP   PPP+ LPP
Sbjct: 2086 PPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPP----SPPPPPPSPPPAPLPP 2141

Query: 147  PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP  PPP   PPP P   PP PPP  PP PP P
Sbjct: 2142 PPP-SPPPSPPPPPSPPPSPPAPPPHPPPEPPAP 2174

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/95 (56%), Positives = 54/95 (56%), Gaps = 9/95 (9%)
 Frame = -3

Query: 309  PPPP---------PLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
            PPPP         P PP P PSPPP  PP    PPP  PPPPP    PPP PL PPPPS 
Sbjct: 2094 PPPPAPPPGAAQAPWPPPPSPSPPPPSPP----PPPSPPPPPPS---PPPAPLPPPPPS- 2145

Query: 156  LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
             PPP P  PPPP  PP PP   PPP PP  PP PP
Sbjct: 2146 -PPPSP--PPPPSPPPSPPA--PPPHPPPEPPAPP 2175

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 47/82 (57%), Positives = 48/82 (58%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PPPP P  PPPSPPP P PP   PPP  PPP PL   PP PP  PPPP   P PPP  P 
Sbjct: 2109 PPPPSPSPPPPSPPPPPSPP---PPPPSPPPAPLPPPPPSPPPSPPPP---PSPPPSPPA 2162

Query: 126  PPE*PPPPPLRYPPPPPPRWPP 61
            PP  PPP      PP PP +PP
Sbjct: 2163 PPPHPPP-----EPPAPPSFPP 2179

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPP P PP P P PPP PPPP   PP   PPP PL   PPPPP   PPPS  PPPPP   
Sbjct: 2110 PPPSPSPPPPSPPPPPSPPPP---PPS--PPPAPL---PPPPP--SPPPS--PPPPP--S 2155

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPP 52
            PPP  P PPP  +PPP PP  P  PP
Sbjct: 2156 PPPSPPAPPP--HPPPEPPAPPSFPP 2179

[59][TOP]
>UniRef100_UPI0000DA3D7B PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA3D7B
          Length = 211

 Score =  124 bits (311), Expect = 3e-27
 Identities = 60/90 (66%), Positives = 62/90 (68%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG--YSGGGGGYSSRGGGG 220
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG  +GGGG   +GGGGG    GGGG
Sbjct: 40  GGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGG 99

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 100 GGGGGGDGRGGGGGGGGGGGGGGGGGGGGG 129

 Score =  123 bits (309), Expect = 6e-27
 Identities = 61/89 (68%), Positives = 61/89 (68%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG-GRREGGGGYSGGGGGYSSRGGGGG 223
           G GGGGG  GGGGG    GGGGG SGGGG  GGGG GR  GGGG  GGGGG    GGGGG
Sbjct: 71  GGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGG 130

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG   GGGG GGG GGG GG GGGGG
Sbjct: 131 GDGGGGGGGGGGGGGGGGGGGGGGGGGGG 159

 Score =  122 bits (306), Expect = 1e-26
 Identities = 59/88 (67%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG   GGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 70  GGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGG----GGGGGG 125

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG  +GGGG GGG GGG GG GGGGG
Sbjct: 126 GGGGGGDGGGGGGGGGGGGGGGGGGGGG 153

 Score =  121 bits (303), Expect = 3e-26
 Identities = 62/105 (59%), Positives = 66/105 (62%), Gaps = 2/105 (1%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSY--GGGGGRREGGGG 175
           DL+   + V    S G GGGGG  GGGGGG   GGGGG  GGGG    GGGGG  +GGGG
Sbjct: 9   DLEVLVVVVGGVGSGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGG 68

Query: 176 YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGGGG    GGGGG+ GGG   GG G GGG GGG  G GGGGG
Sbjct: 69  GGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGG 113

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/88 (65%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGG GG   GGGGG  GGGG  GGGGG   GGGG  GGGGG +  GGGGG 
Sbjct: 35  GGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGG 94

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG G G GGG GG GGGGG
Sbjct: 95  SGGGGGGGGGGDGRGGGGGGGGGGGGGG 122

 Score =  120 bits (301), Expect = 5e-26
 Identities = 57/88 (64%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGG G  GGG + GGGGG   GGGG  GGGG     GGGGG 
Sbjct: 57  GGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGG 116

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG+GGG GG GGGGG
Sbjct: 117 GGGGGGGGGGGGGGGDGGGGGGGGGGGG 144

 Score =  120 bits (301), Expect = 5e-26
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGG   GGGGGG   GGGGG  GG G  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 79  GGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGG 138

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 166

 Score =  120 bits (300), Expect = 6e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GG GG    GGGGG 
Sbjct: 48  GGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGG----GGGGGG 103

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            G GR  GGGG GGG GGG GG GGGGG
Sbjct: 104 GGDGRGGGGGGGGGGGGGGGGGGGGGGG 131

 Score =  119 bits (299), Expect = 8e-26
 Identities = 60/94 (63%), Positives = 60/94 (63%), Gaps = 6/94 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG------GGYSGGGGGYSSR 208
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GG      GG  GGGGG   R
Sbjct: 49  GGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGR 108

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGGG  GGG   GGGG GGG G G GG GGGGG
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGG 142

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/88 (64%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGG   GGGG+ GGGGG    GGG  GGGGG    GGGGG 
Sbjct: 56  GGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGG 115

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG  GG GG GGGGG
Sbjct: 116 GGGGGGGGGGGGGGGGDGGGGGGGGGGG 143

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/88 (64%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GSGGGGG  GGG G    GGGGG  GGGG  GGGGG  +GGGG  GGGGG    GGGGG 
Sbjct: 94  GSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGG 153

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG G G+GGG GG GG GG
Sbjct: 154 GGGGGGGGGGGGGRGDGGGGGGGGGRGG 181

 Score =  117 bits (294), Expect = 3e-25
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG    G GG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 88  GGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGG 147

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG G  GGGGG
Sbjct: 148 GGGGGGGGGGGGGGGGGGGRGDGGGGGG 175

 Score =  115 bits (289), Expect = 1e-24
 Identities = 59/93 (63%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           A   G GGGG   GGGGGG   G GGG  GGGG  GGGGG   GGGG  GGGGG    GG
Sbjct: 85  AAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGG 144

Query: 215 GGGSYGGGRREGGGGYGGGEGG-GYGGSGGGGG 310
           GGG  GGG   GGGG GGG GG G GG GGGGG
Sbjct: 145 GGGGGGGGGGGGGGGGGGGGGGRGDGGGGGGGG 177

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/89 (65%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  G G GG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 96  GGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGG 155

Query: 227 YGGGRREGGGGYG-GGEGGGYGGSGGGGG 310
            GGG   GGGG G GG GGG GG GGGGG
Sbjct: 156 GGGGGGGGGGGRGDGGGGGGGGGRGGGGG 184

 Score =  114 bits (285), Expect = 3e-24
 Identities = 57/90 (63%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGY---SGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G GGGG  RGGGGGG   GGGGG     GGGG  GGGGG   GGGG  GGGGG    GGG
Sbjct: 100 GGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 159

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GG  GGGR +GGGG GGG  GG GG G  G
Sbjct: 160 GGGGGGGRGDGGGGGGGGGRGGGGGDGASG 189

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/97 (55%), Positives = 54/97 (55%)
 Frame = +2

Query: 8   DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
           DGR          G GGGGG  GGGG G   GGGGG  GGGG  GGGGG   GGGG  GG
Sbjct: 106 DGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGG 162

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 298
           GGG    GGGGG        GGGG GGG G G  GSG
Sbjct: 163 GGGGRGDGGGGG--------GGGGRGGGGGDGASGSG 191

[60][TOP]
>UniRef100_A9NML8 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NML8_PICSI
          Length = 172

 Score =  124 bits (311), Expect = 3e-27
 Identities = 69/106 (65%), Positives = 72/106 (67%), Gaps = 3/106 (2%)
 Frame = +2

Query: 5   LDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGG--SYGGGGGRREGGGGY 178
           LDGR+ITVN AQSRG+GGGGG  GGGG G+R GGGGGY GG      G GGGR  GG G 
Sbjct: 75  LDGRNITVNPAQSRGNGGGGG--GGGGRGFRGGGGGGYGGGRDRPDRGYGGGRGGGGSGG 132

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG-GGW 313
            GG GGY   GGGG  YGGG   GGGGYG   GGGYGG GG  G W
Sbjct: 133 YGGRGGYG--GGGGSRYGGG---GGGGYG---GGGYGGGGGSEGAW 170

[61][TOP]
>UniRef100_O48567 Glycine-rich RNA-binding protein n=1 Tax=Euphorbia esula
           RepID=O48567_EUPES
          Length = 164

 Score =  124 bits (310), Expect = 4e-27
 Identities = 67/105 (63%), Positives = 71/105 (67%), Gaps = 1/105 (0%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQSRGSGGG    GGGGG  R GGGGGY        GGGGRRE  GGY 
Sbjct: 72  ELDGRNITVNEAQSRGSGGG----GGGGGYSRGGGGGGY--------GGGGRRE--GGYG 117

Query: 182 GGGGGYSSR-GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGGGY+SR  GGGG YGGGR +G GG GGG     GG    G W
Sbjct: 118 GGGGGYNSRSSGGGGGYGGGRDQGYGGGGGGSRYSRGGGESDGNW 162

[62][TOP]
>UniRef100_C5YSY6 Putative uncharacterized protein Sb08g022740 n=1 Tax=Sorghum
           bicolor RepID=C5YSY6_SORBI
          Length = 165

 Score =  124 bits (310), Expect = 4e-27
 Identities = 68/96 (70%), Positives = 71/96 (73%), Gaps = 4/96 (4%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYS---GGGGSYGGGGGRREGG- 169
           +LDGR+ITVNEAQSRG  GGGG  GGG GG R GGGGGY    GGGG YGGGGG   GG 
Sbjct: 73  ELDGRNITVNEAQSRGGRGGGG--GGGYGGGR-GGGGGYGRRDGGGGGYGGGGGGYGGGR 129

Query: 170 GGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG 277
           GGY GGGGGY   GGGGG YGGG R GGGGYG  +G
Sbjct: 130 GGYGGGGGGY---GGGGGGYGGGSR-GGGGYGNSDG 161

[63][TOP]
>UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata
           RepID=UPI0001926FBD
          Length = 268

 Score =  123 bits (309), Expect = 6e-27
 Identities = 59/102 (57%), Positives = 62/102 (60%), Gaps = 14/102 (13%)
 Frame = -3

Query: 309 PPPPPL---------PP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           PPPPP+         PP PPP PPP PPPP   PPP  PPPPP+   PPPPP  PPPP+ 
Sbjct: 123 PPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPC-PPPPAP 181

Query: 156 LPPPPP-----*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPPP       PPPP  PPPPP   PPPPPP  PPP P P
Sbjct: 182 CPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAPCP 223

 Score =  120 bits (301), Expect = 5e-26
 Identities = 58/90 (64%), Positives = 59/90 (65%), Gaps = 4/90 (4%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*L--PPPPPLEE*PPP-PPLYPPPPSRLPPPPP 139
           PPPPP PP PPP PPP PPPP   PPP +  PPPPP    P P PP  PPPP  LPPPPP
Sbjct: 139 PPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPP 198

Query: 138 *LPPPPE*P-PPPPLRYPPPPPPRWPPPPP 52
             PPPP  P PPPP   PPPP P  PPPPP
Sbjct: 199 PPPPPPPCPLPPPPPPCPPPPAPCPPPPPP 228

 Score =  119 bits (297), Expect = 1e-25
 Identities = 56/92 (60%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*L--PPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPPP PP P P PPP PPPP   PPP +  PPPPP    PPPPP  PPPP   PPPPP +
Sbjct: 108 PPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVV 167

Query: 132 ---PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              PPPP  PPP P   PPPPPP   PPPP P
Sbjct: 168 FCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPP 199

 Score =  119 bits (297), Expect = 1e-25
 Identities = 56/97 (57%), Positives = 59/97 (60%), Gaps = 7/97 (7%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRL----PPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPP 142
           PPPPP PP PPP PPP PPPP  +    PPP  PPP P    PPPPP+  PPP   PPPP
Sbjct: 144 PPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPPP 203

Query: 141 P*L---PPPPE*PPPPPLRYPPPPPPRWPPPPPLPRD 40
           P     PPPP  PPPP    PPPPPP  P P P+P D
Sbjct: 204 PPCPLPPPPPPCPPPPAPCPPPPPPPACPAPMPMPCD 240

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/96 (59%), Positives = 61/96 (63%), Gaps = 8/96 (8%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSP-----PPYPPPPSRLPPP*LPPPPPLEE*PPP---PPLYPPPPSRL 154
           PPPPP P  PPP P     PP PPPP+  PPP  PPPPP+   PPP   PP  PPPP   
Sbjct: 91  PPPPPQPACPPPPPGCGPPPPCPPPPAPCPPP--PPPPPVCPPPPPMCAPPPPPPPPPPP 148

Query: 153 PPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPPP  PPPP  PPPPP+ + PPPPP  PPP P P
Sbjct: 149 PPPPPPPPPPPP-PPPPPVVFCPPPPPCPPPPAPCP 183

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/95 (60%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR----LPPPP 142
           PPP P PP PPP P   PPPP   PPP  PPPPP    PPPPP  PPPP       PPPP
Sbjct: 114 PPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPP 173

Query: 141 P*LPPP---PE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P  PPP   P  PPPPP+  PPPPPP  PPPPP P
Sbjct: 174 PCPPPPAPCPPPPPPPPMCLPPPPPP-PPPPPPCP 207

 Score =  117 bits (292), Expect = 5e-25
 Identities = 55/91 (60%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSP---PPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP 139
           PPPPP P  PPP P   PP PPPP   PPP  PPPPP    PPPP ++ PPP   PPPP 
Sbjct: 121 PPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPA 180

Query: 138 *LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPP  PPPP    PPPPPP  PPP PLP
Sbjct: 181 PCPPPP--PPPPMCLPPPPPPPPPPPPCPLP 209

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 48/85 (56%), Positives = 51/85 (60%)
 Frame = -3

Query: 300 PPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPP 121
           P LPP    S PP PP P+       PPPPP     PPPP  PPPP+  PPPPP   PPP
Sbjct: 80  PLLPPVTDGSKPPPPPQPA------CPPPPP--GCGPPPPC-PPPPAPCPPPPP---PPP 127

Query: 120 E*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPPP+  PPPPPP  PPPPP P
Sbjct: 128 VCPPPPPMCAPPPPPPPPPPPPPPP 152

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 41/87 (47%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = -3

Query: 303 PPPLPP*PPPSPPPYP-PPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           P   PP  P +P P   P  ++LP    P  PP+ +   PPP  PP P+  PPPP   PP
Sbjct: 52  PENKPPVQPAAPAPLAYPMANQLPCTLAPLLPPVTDGSKPPP--PPQPACPPPPPGCGPP 109

Query: 126 PPE*PPPPPLRYPPPPPP-RWPPPPPL 49
           PP  PPP P   PPPPPP   PPPPP+
Sbjct: 110 PPCPPPPAPCPPPPPPPPV-CPPPPPM 135

[64][TOP]
>UniRef100_UPI0001867639 hypothetical protein BRAFLDRAFT_237268 n=1 Tax=Branchiostoma
           floridae RepID=UPI0001867639
          Length = 360

 Score =  123 bits (309), Expect = 6e-27
 Identities = 66/99 (66%), Positives = 69/99 (69%), Gaps = 12/99 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG--GGYSGGGGGYSS----- 205
           G GGGGG+ GGGGGGY SGGGGGY GGGGSYGGGGG   GG  GGYS  G GY S     
Sbjct: 260 GYGGGGGY-GGGGGGY-SGGGGGYGGGGGSYGGGGGGYGGGSGGGYSDFGSGYGSQQSNY 317

Query: 206 ---RGGGGGSYGGGRREGGGGYGGG--EGGGYGGSGGGG 307
              +GGGGG YGGG R+GGG YGGG   GGG GG  GGG
Sbjct: 318 GPMKGGGGGGYGGGGRQGGGPYGGGYSSGGGGGGGYGGG 356

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/112 (59%), Positives = 69/112 (61%), Gaps = 21/112 (18%)
 Frame = +2

Query: 38  QSRGSG-GGGGHRGGG-----------GGGYRS---GGGGGYSG------GGGSYGGGGG 154
           + RG G GGGG RGGG           GGGY +   GGGGGY G      GGG YGGGGG
Sbjct: 207 RGRGGGYGGGGGRGGGYGGGGGYGGDRGGGYNNGNYGGGGGYGGGGYGGSGGGGYGGGGG 266

Query: 155 RREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
              GGGGYSGGGGGY   GGGGGSYGG    GGGGYGGG GGGY   G G G
Sbjct: 267 YGGGGGGYSGGGGGY---GGGGGSYGG----GGGGYGGGSGGGYSDFGSGYG 311

 Score =  118 bits (296), Expect = 2e-25
 Identities = 61/112 (54%), Positives = 64/112 (57%), Gaps = 24/112 (21%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSY-GGGGGRREGGGGYSGGGGGYSS------ 205
           G  GGGG+ G GGGGY  GGGGGY GGGG Y GGGGG   GGG Y GGGGGY        
Sbjct: 246 GGYGGGGYGGSGGGGY--GGGGGYGGGGGGYSGGGGGYGGGGGSYGGGGGGYGGGSGGGY 303

Query: 206 -----------------RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
                            +GGGGG YGGG R+GGG YGGG   G GG GG GG
Sbjct: 304 SDFGSGYGSQQSNYGPMKGGGGGGYGGGGRQGGGPYGGGYSSGGGGGGGYGG 355

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/98 (59%), Positives = 62/98 (63%), Gaps = 5/98 (5%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG-RREGGGGYS----GGGGG 196
           + QS G GG G  +GG GG  R GG GG  G GG YGGGGG   + GGGY+    GGGGG
Sbjct: 188 QQQSGGGGGRGQRQGGFGGRGRGGGYGGGGGRGGGYGGGGGYGGDRGGGYNNGNYGGGGG 247

Query: 197 YSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           Y   GGG G  GGG   GGGGYGGG GGGY G GGG G
Sbjct: 248 YG--GGGYGGSGGGGYGGGGGYGGG-GGGYSGGGGGYG 282

 Score =  100 bits (250), Expect = 4e-20
 Identities = 57/93 (61%), Positives = 59/93 (63%), Gaps = 13/93 (13%)
 Frame = +2

Query: 74  GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG--GGSYGGGRRE 247
           GGGG G R GG GG  G GG YGGGGGR   GGGY GGGG    RGGG   G+YGGG   
Sbjct: 193 GGGGRGQRQGGFGG-RGRGGGYGGGGGR---GGGYGGGGGYGGDRGGGYNNGNYGGGGGY 248

Query: 248 GGGGYGG------GEGGGYGG-----SGGGGGW 313
           GGGGYGG      G GGGYGG     SGGGGG+
Sbjct: 249 GGGGYGGSGGGGYGGGGGYGGGGGGYSGGGGGY 281

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 48/79 (60%), Positives = 49/79 (62%), Gaps = 13/79 (16%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG----------GGGGRREGGGGYSGG--- 187
           G GGGGG  GGGGGGY  G GGGYS  G  YG          GGGG   GGGG  GG   
Sbjct: 280 GYGGGGGSYGGGGGGYGGGSGGGYSDFGSGYGSQQSNYGPMKGGGGGGYGGGGRQGGGPY 339

Query: 188 GGGYSSRGGGGGSYGGGRR 244
           GGGYSS GGGGG YGGG+R
Sbjct: 340 GGGYSSGGGGGGGYGGGQR 358

[65][TOP]
>UniRef100_Q7UA83 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Synechococcus sp. WH 8102 RepID=Q7UA83_SYNPX
          Length = 214

 Score =  123 bits (309), Expect = 6e-27
 Identities = 68/104 (65%), Positives = 75/104 (72%), Gaps = 2/104 (1%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +L GR + +N+A+ RGS   GG     GGGYR GGGGGY GGGG YGGGGGR +GGGGY 
Sbjct: 66  ELMGRPLRINKAEPRGSAPRGG-----GGGYR-GGGGGYGGGGG-YGGGGGR-DGGGGYG 117

Query: 182 GGGGGYSSRGGGGG--SYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GGGGGY  RGGGGG    GGG R+GGGGYGGG GGGY G G  G
Sbjct: 118 GGGGGY--RGGGGGYGGGGGGGRDGGGGYGGG-GGGYRGGGDAG 158

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 54/103 (52%), Positives = 55/103 (53%), Gaps = 14/103 (13%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           R  GGG G   GGGGGYR GGGGGY       GGGGG R+GGGGY GGGGGY   G  G 
Sbjct: 110 RDGGGGYG---GGGGGYR-GGGGGYG------GGGGGGRDGGGGYGGGGGGYRGGGDAGD 159

Query: 224 SYGGGR----REGGGGYGGGEGGG----------YGGSGGGGG 310
              G R    R  G    GGEGGG           G SGGGGG
Sbjct: 160 RPSGARGWEDRSYGARDSGGEGGGGHDDGRSRRRRGSSGGGGG 202

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 50/98 (51%), Positives = 52/98 (53%), Gaps = 12/98 (12%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG--GGYSGGGGGYSSR------ 208
           GGGGG+R GGGGGY  GGGGG  GGGG  GGGGG R GG  G    G  G+  R      
Sbjct: 118 GGGGGYR-GGGGGYGGGGGGGRDGGGGYGGGGGGYRGGGDAGDRPSGARGWEDRSYGARD 176

Query: 209 ----GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
               GGGG   G  RR  G   GGG G  Y G GG  G
Sbjct: 177 SGGEGGGGHDDGRSRRRRGSSGGGGGGDDYSGYGGAEG 214

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 38/84 (45%), Positives = 40/84 (47%), Gaps = 6/84 (7%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGG------SYGGGGGRREGGGGYSGGGGGYSS 205
           R  GGG G   GGGGGYR GG  G    G       SYG      EGGGG+  G     S
Sbjct: 138 RDGGGGYG---GGGGGYRGGGDAGDRPSGARGWEDRSYGARDSGGEGGGGHDDG----RS 190

Query: 206 RGGGGGSYGGGRREGGGGYGGGEG 277
           R   G S GGG  +   GYGG EG
Sbjct: 191 RRRRGSSGGGGGGDDYSGYGGAEG 214

[66][TOP]
>UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q852P0_VOLCA
          Length = 606

 Score =  123 bits (309), Expect = 6e-27
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP PP PP  PPP PPPP   PPP  PPPPP    PPPPP  PPPPS  PPPPP  P
Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPP--PPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP  PPPP    PPPPPP  PPP P P
Sbjct: 263 SPP--PPPPSPSPPPPPPPPSPPPAPPP 288

 Score =  115 bits (288), Expect = 2e-24
 Identities = 56/101 (55%), Positives = 59/101 (58%)
 Frame = -3

Query: 354 RTFIGNPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLY 175
           +  +  P+P      PPPP  PP PPP PPP PPPP   PPP  PPPPP    PPPPP  
Sbjct: 197 QNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP----PPPPPPS 252

Query: 174 PPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
           PPPP   PPPP   PPPP   P PP   PPPPPP  PP PP
Sbjct: 253 PPPP---PPPPSPSPPPPPPSPSPP---PPPPPPSPPPAPP 287

 Score =  115 bits (287), Expect = 2e-24
 Identities = 54/85 (63%), Positives = 54/85 (63%)
 Frame = -3

Query: 300 PPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPP 121
           P  PP PPP PPP PPPP   PPP  PPPPP    PPPPP  PPPP   PPPPP  PP P
Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPP----PPPPPPSPPPP---PPPPP--PPSP 253

Query: 120 E*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPPP   PPPPPP   PPPP P
Sbjct: 254 PPPPPPPSPSPPPPPPSPSPPPPPP 278

 Score =  107 bits (268), Expect = 3e-22
 Identities = 54/91 (59%), Positives = 55/91 (60%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPPPP PP  PP PPP PPPPS  PPP  PPPP     PP PP  PPPPS 
Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP--PPPP-----PPSPPPPPPPPSP 262

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWP 64
            PPPPP  P PP  PPPPP   PP PPP  P
Sbjct: 263 SPPPPPPSPSPP--PPPPPPSPPPAPPPFVP 291

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 37/55 (67%), Positives = 38/55 (69%), Gaps = 1/55 (1%)
 Frame = -3

Query: 207 LEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPP-PPPPRWPPPPPLP 46
           +E  PPPPP  PPPPS  PPPPP  PPPP  PPPPP   PP PPPP  PPPPP P
Sbjct: 201 VEPQPPPPPPPPPPPSPPPPPPP--PPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253

[67][TOP]
>UniRef100_Q41453 Putative glycine rich RNA binding protein n=1 Tax=Solanum tuberosum
           RepID=Q41453_SOLTU
          Length = 175

 Score =  123 bits (309), Expect = 6e-27
 Identities = 74/113 (65%), Positives = 75/113 (66%), Gaps = 10/113 (8%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGG-GGGRREGGGGY 178
           DLDGR+ITVNEAQSRG    GG RGGGG G     GG   GGGG YGG GGGRREG    
Sbjct: 71  DLDGRNITVNEAQSRGGVEAGGGRGGGGYG-----GGRREGGGGGYGGYGGGRREG---- 121

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGS---------GGGGG 310
            GGGGGYS   GGGG YGGGRRE  GGYGGG GGGYGG          GGGGG
Sbjct: 122 -GGGGGYS---GGGGGYGGGRRE--GGYGGG-GGGYGGGDRYSDRSSRGGGGG 167

[68][TOP]
>UniRef100_UPI000186773D hypothetical protein BRAFLDRAFT_237208 n=1 Tax=Branchiostoma
           floridae RepID=UPI000186773D
          Length = 378

 Score =  123 bits (308), Expect = 7e-27
 Identities = 66/112 (58%), Positives = 69/112 (61%), Gaps = 24/112 (21%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG---------GGGY 199
           G GGGGG+ GGGGGGY SGGGGGY GGGGSYGGGGG   GGGG  GG         GGGY
Sbjct: 264 GYGGGGGY-GGGGGGY-SGGGGGYGGGGGSYGGGGGSYGGGGGSYGGGSSGYGGSSGGGY 321

Query: 200 SS---------------RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           S                +GGGGG YGGG R+GGG YGGG   G GG GG GG
Sbjct: 322 SDFGSGYGSQQSNYGPMKGGGGGGYGGGGRQGGGPYGGGYSSGGGGGGGYGG 373

 Score =  117 bits (294), Expect = 3e-25
 Identities = 65/104 (62%), Positives = 67/104 (64%), Gaps = 17/104 (16%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG-----GGYRSG--------GGGGYSG-GGGSYGGGGGRREGGGGYSG 184
           G G GGG+ GGGG     GGY +G        GGGGY G GGG YGGGGG   GGGGYSG
Sbjct: 221 GGGRGGGYGGGGGYGGDRGGYNNGNYGGGGGYGGGGYGGSGGGGYGGGGGYGGGGGGYSG 280

Query: 185 GGGGYSSRGGGGGSYGGGRRE---GGGGYGGGEGGGYGGSGGGG 307
           GGGGY   GGGGGSYGGG      GGG YGGG   GYGGS GGG
Sbjct: 281 GGGGY---GGGGGSYGGGGGSYGGGGGSYGGG-SSGYGGSSGGG 320

 Score =  113 bits (282), Expect = 7e-24
 Identities = 57/88 (64%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G  GGGG+ G GGGGY  GGGGGY GGGG Y GGGG   GGGG  GGGGG  S GGGGGS
Sbjct: 250 GGYGGGGYGGSGGGGY--GGGGGYGGGGGGYSGGGGGYGGGGGSYGGGGG--SYGGGGGS 305

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           YGG    G  GYGG  GGGY   G G G
Sbjct: 306 YGG----GSSGYGGSSGGGYSDFGSGYG 329

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/100 (61%), Positives = 62/100 (62%), Gaps = 11/100 (11%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGG-----GGYS----GGGGSYGGGGGRREGGGGYSGGGGG 196
           RG GGG G  GG GGGY  GGG     GGY+    GGGG YGGGG    GGGGY GGGGG
Sbjct: 212 RGRGGGYGGGGGRGGGYGGGGGYGGDRGGYNNGNYGGGGGYGGGGYGGSGGGGY-GGGGG 270

Query: 197 YSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG--GGG 310
           Y   GGG    GGG   GGG YGGG GG YGG GG  GGG
Sbjct: 271 YGGGGGGYSGGGGGYGGGGGSYGGG-GGSYGGGGGSYGGG 309

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/97 (58%), Positives = 60/97 (61%), Gaps = 4/97 (4%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS----GGGGGY 199
           + QS G GG G  +GG GG  R GG GG  G GG YGGGGG     GGY+    GGGGGY
Sbjct: 193 QQQSGGGGGRGQRQGGFGGRGRGGGYGGGGGRGGGYGGGGGYGGDRGGYNNGNYGGGGGY 252

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
              GGG G  GGG   GGGGYGGG GGGY G GGG G
Sbjct: 253 G--GGGYGGSGGGGYGGGGGYGGG-GGGYSGGGGGYG 286

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/81 (64%), Positives = 54/81 (66%), Gaps = 1/81 (1%)
 Frame = +2

Query: 74  GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG-GGGSYGGGRREG 250
           GGGG G R GG GG  G GG YGGGGGR   GGGY GGGG    RGG   G+YGGG   G
Sbjct: 198 GGGGRGQRQGGFGG-RGRGGGYGGGGGR---GGGYGGGGGYGGDRGGYNNGNYGGGGGYG 253

Query: 251 GGGYGGGEGGGYGGSGGGGGW 313
           GGGYGG  GGGYG   GGGG+
Sbjct: 254 GGGYGGSGGGGYG---GGGGY 271

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 44/77 (57%), Positives = 45/77 (58%), Gaps = 13/77 (16%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYG----------GGGGRREGGGGYSGG---GG 193
           GGGGG  GGG  GY    GGGYS  G  YG          GGGG   GGGG  GG   GG
Sbjct: 300 GGGGGSYGGGSSGYGGSSGGGYSDFGSGYGSQQSNYGPMKGGGGGGYGGGGRQGGGPYGG 359

Query: 194 GYSSRGGGGGSYGGGRR 244
           GYSS GGGGG YGGG+R
Sbjct: 360 GYSSGGGGGGGYGGGQR 376

[69][TOP]
>UniRef100_A5GHM5 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. WH 7803
           RepID=A5GHM5_SYNPW
          Length = 207

 Score =  123 bits (308), Expect = 7e-27
 Identities = 74/145 (51%), Positives = 80/145 (55%), Gaps = 42/145 (28%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGS------------GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGG 145
           +L GR + +N+A+ RGS            GGGGG+RGGGGG    GGGGGY GGGG YGG
Sbjct: 66  ELMGRPLRINKAEPRGSAPRRGGGGYGGGGGGGGYRGGGGGYNDGGGGGGYRGGGGGYGG 125

Query: 146 GGGRREG---------GGGYSGGGGGYSSRGGGGGSY--GGG--------RREGG----- 253
           GG RR G         GGG SGGGGGY   GGGGGSY  GGG        RR GG     
Sbjct: 126 GGERRSGARGWEDRSYGGGASGGGGGY---GGGGGSYSDGGGGGDDGRSRRRRGGAAPSE 182

Query: 254 ------GGYGGGEGGGYGGSGGGGG 310
                 GGYGGG G  YGG GG  G
Sbjct: 183 GGGFNDGGYGGGGGDDYGGYGGAEG 207

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 40/72 (55%), Positives = 41/72 (56%), Gaps = 16/72 (22%)
 Frame = +2

Query: 146 GGGRREGGGGYSGGGGGYSSRGGGG----GSYGGGRREGGGGYGGG----------EGGG 283
           G   R GGGGY GGGGG   RGGGG    G  GGG R GGGGYGGG          E   
Sbjct: 81  GSAPRRGGGGYGGGGGGGGYRGGGGGYNDGGGGGGYRGGGGGYGGGGERRSGARGWEDRS 140

Query: 284 YGG--SGGGGGW 313
           YGG  SGGGGG+
Sbjct: 141 YGGGASGGGGGY 152

[70][TOP]
>UniRef100_A9PIZ6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x
           Populus deltoides RepID=A9PIZ6_9ROSI
          Length = 171

 Score =  123 bits (308), Expect = 7e-27
 Identities = 67/105 (63%), Positives = 69/105 (65%), Gaps = 1/105 (0%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGR+ITVNEAQSRGSGGGGG    GGG  R+ GGGGY GGGG   GGGG   GGGGY 
Sbjct: 72  DLDGRNITVNEAQSRGSGGGGG----GGGYNRNSGGGGY-GGGGRREGGGGYSRGGGGYG 126

Query: 182 GGGGGY-SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGG GY S  GGGGG YGGGR  G G   GG      G   GG W
Sbjct: 127 GGGSGYGSGGGGGGGGYGGGRDRGYG--DGGSRYSSRGESEGGSW 169

[71][TOP]
>UniRef100_A0NCZ0 AGAP001055-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=A0NCZ0_ANOGA
          Length = 208

 Score =  123 bits (308), Expect = 7e-27
 Identities = 61/103 (59%), Positives = 63/103 (61%)
 Frame = +2

Query: 5   LDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG 184
           L    + V +   R  GGGG   GGGGGG   GGGGG  GGGG  GGGGG   GGGG  G
Sbjct: 1   LSSDKVAVIDHVVRVVGGGGNSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 185 GGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGG    GGGGG  GGG   GGGG GGG GGG GG  GGGGW
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGPGGGGW 103

 Score =  122 bits (307), Expect = 9e-27
 Identities = 58/88 (65%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 32  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG+GG  G G GG GGGGG
Sbjct: 92  GGGGGGPGGGGWGGWRGRGAGGGGGGGG 119

 Score =  122 bits (306), Expect = 1e-26
 Identities = 58/88 (65%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    G GGG 
Sbjct: 43  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGPGGGG 102

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           +GG R  G GG GGG GGG GG GGGGG
Sbjct: 103 WGGWRGRGAGGGGGGGGGGGGGGGGGGG 130

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/94 (61%), Positives = 59/94 (62%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           N     G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    
Sbjct: 21  NSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGGG  GGG   GGGG GGG  GG+ G G GGG
Sbjct: 81  GGGGGGGGGGGGGGGGGPGGGGWGGWRGRGAGGG 114

 Score =  118 bits (296), Expect = 2e-25
 Identities = 60/91 (65%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G+ GGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 20  GNSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGG 75

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGG--GGW 313
            GGG   GGGG GGG GGG GG GGG  GGW
Sbjct: 76  GGGGGGGGGGGGGGGGGGGGGGPGGGGWGGW 106

[72][TOP]
>UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E1896
          Length = 695

 Score =  122 bits (307), Expect = 9e-27
 Identities = 55/88 (62%), Positives = 55/88 (62%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP P  PP   PP P PP   PPP  PPPPP    PPPPP  PPPP   PPPPP  P
Sbjct: 601 PPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPA---PPPPPAPPPPPPPAPPPPP-AP 656

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  P PPP   PPPPPP  PPPPP P
Sbjct: 657 PPPPAPAPPPAPPPPPPPPPAPPPPPAP 684

 Score =  120 bits (301), Expect = 5e-26
 Identities = 54/88 (61%), Positives = 57/88 (64%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           P  P  PP P P+PPP P PP+  PPP  PPPPP    PPPPP  PPPP+  PPPPP  P
Sbjct: 596 PQSPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPP----PPPPPAPPPPPAPPPPPPP-AP 650

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP   PPP PP  PPPPP P
Sbjct: 651 PPPPAPPPPPAPAPPPAPPPPPPPPPAP 678

 Score =  120 bits (300), Expect = 6e-26
 Identities = 54/88 (61%), Positives = 56/88 (63%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           P PPP P  P P+PPP PPPP   PPP  PPPPP    PPPPP  PPPP+   PPPP  P
Sbjct: 607 PAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPP-PPPPPAPPPPPA---PPPPPAP 662

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP  PPPPP   P PPPP  PPPPP P
Sbjct: 663 APPPAPPPPPPPPPAPPPPPAPPPPPAP 690

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/85 (62%), Positives = 55/85 (64%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           PP P PP  PP PPP PPPP+  PPP  PPPPP    PPPPP  PPPP+  PPP P  PP
Sbjct: 615 PPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPA--PPPPPAPPPPPAPAPPPAPPPPP 672

Query: 126 PPE*PPPPPLRYPPPPPPRWPPPPP 52
           PP   PPPP   P PPPP  PPPPP
Sbjct: 673 PPPPAPPPP---PAPPPPPAPPPPP 694

 Score =  102 bits (253), Expect = 2e-20
 Identities = 52/86 (60%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSP-PPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPPPP PP PPP P PP PPPP+       PPPPP    PPPPP   PPP+  PPPPP  
Sbjct: 627 PPPPPPPPAPPPPPAPPPPPPPA-------PPPPPA---PPPPPAPAPPPA--PPPPP-- 672

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPP 55
           PPPP  PPPP     PPPPP  PPPP
Sbjct: 673 PPPPAPPPPP----APPPPPAPPPPP 694

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 34/51 (66%), Positives = 36/51 (70%), Gaps = 1/51 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PP-PSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
           PPPPP PP PP P+PPP PPPP   PPP  PPPPP    PPPPP  PPPP+
Sbjct: 650 PPPPPAPPPPPAPAPPPAPPPPP--PPPPAPPPPPA---PPPPPAPPPPPA 695

[73][TOP]
>UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q948Y6_VOLCA
          Length = 1143

 Score =  122 bits (307), Expect = 9e-27
 Identities = 58/95 (61%), Positives = 60/95 (63%)
 Frame = -3

Query: 330 PN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLP 151
           P+ R   P PP  PP P P PPP PPPP   PPP  PPPPP    PPPPP  PPPPS  P
Sbjct: 513 PSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS---PPPPPSPPPPPS--P 567

Query: 150 PPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPP  PPPP  PPPP  R+PP PPPR  PP P P
Sbjct: 568 PPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQP 602

 Score =  116 bits (290), Expect = 9e-25
 Identities = 57/89 (64%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           P PP P  P P PPP PPPP   PPP  PPPPP    PPPPP  PPPPS  PPPPP  PP
Sbjct: 515 PRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPS---PPPPPSPPPPPS--PPPPPSPPP 569

Query: 126 PPE*PPPPPLRYPPPPPPRWPP-PPPLPR 43
           PP   PPPP   PPPP PR PP PPP PR
Sbjct: 570 PPS--PPPPPSPPPPPSPRHPPSPPPRPR 596

 Score =  113 bits (282), Expect = 7e-24
 Identities = 61/107 (57%), Positives = 61/107 (57%), Gaps = 6/107 (5%)
 Frame = -3

Query: 306 PPPPLP----P*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP 139
           PPPP P    P PP   PP P PPS  PPP  PPPP     PPPPP  PPPPS   PPPP
Sbjct: 500 PPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPS----PPPPPSPPPPPS---PPPP 552

Query: 138 *LPPPPE*PPPPPLRYPPP--PPPRWPPPPPLPRD*ASLTVMLRPSR 4
             PPPP  PPPPP   PPP  PPP  PPPPP PR   S     RP R
Sbjct: 553 PSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPR 599

 Score =  109 bits (273), Expect = 8e-23
 Identities = 54/90 (60%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PP-PSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPPPP PP PP P PPP PPPP   PPP  PPPPP    PPPPP  PPPPS  PPP P  
Sbjct: 531 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS---PPPPPSPPPPPSPPPPPSPRH 587

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
           PP P   P PP   PP PP    P PP PR
Sbjct: 588 PPSPPPRPRPPRPQPPSPP---SPSPPSPR 614

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 40/66 (60%), Positives = 41/66 (62%), Gaps = 3/66 (4%)
 Frame = -3

Query: 234 PP*LPPPP-PLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPP--PPPPRWP 64
           PP +PPPP PL   P PP   PP PS   PPPP  PPPP  PPPPP   PP  PPPP  P
Sbjct: 496 PPFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 555

Query: 63  PPPPLP 46
           PPPP P
Sbjct: 556 PPPPSP 561

[74][TOP]
>UniRef100_Q0KIW2 Glycine-rich RNA-binding protein n=1 Tax=Triticum aestivum
           RepID=Q0KIW2_WHEAT
          Length = 163

 Score =  122 bits (307), Expect = 9e-27
 Identities = 70/105 (66%), Positives = 71/105 (67%), Gaps = 1/105 (0%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHR-GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGY 178
           DLDGR+ITVNEAQSR SGGGGG   GGGGGGY  GG     GGGG YGGGGG     GG 
Sbjct: 71  DLDGRNITVNEAQSRRSGGGGGGGFGGGGGGY--GGQRREGGGGGGYGGGGGGYR--GGR 126

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           SGGGGGY SR GGG  YGGG   GGGGYGG  GG      GGG W
Sbjct: 127 SGGGGGYGSRDGGG--YGGG---GGGGYGGSRGG-----SGGGNW 161

[75][TOP]
>UniRef100_B2YKT9 Glycine-rich RNA-binding protein n=1 Tax=Nicotiana tabacum
           RepID=B2YKT9_TOBAC
          Length = 157

 Score =  122 bits (307), Expect = 9e-27
 Identities = 69/100 (69%), Positives = 71/100 (71%), Gaps = 5/100 (5%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGR+ITVNEAQSRGSGGGGG RGGGGGGY  GGGGGY        GGGGRREGG  Y 
Sbjct: 71  DLDGRNITVNEAQSRGSGGGGG-RGGGGGGY--GGGGGY--------GGGGRREGG--YG 117

Query: 182 GGGGGYSSRG-----GGGGSYGGGRREGGGGYGGGEGGGY 286
           GGGGGY         GGGG YGGGRRE  GGYGGG  G +
Sbjct: 118 GGGGGYGGGRRDGGYGGGGGYGGGRRE--GGYGGGSEGSW 155

[76][TOP]
>UniRef100_A7SMB3 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SMB3_NEMVE
          Length = 218

 Score =  122 bits (307), Expect = 9e-27
 Identities = 69/110 (62%), Positives = 72/110 (65%), Gaps = 7/110 (6%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           + +GR + V EA      GGGG RGGG GG R GGGGGY  GGG Y GGGG R GGGGY 
Sbjct: 76  EYEGRRLKVAEASK--DSGGGGRRGGGYGGGR-GGGGGYRSGGG-YRGGGGYRGGGGGYR 131

Query: 182 G---GGGGYSSRGGGGGSYGGGRREGGGGYG----GGEGGGYGGSGGGGG 310
           G   GGGGY   G GGG YGGG   GGGGYG    GG GGGYGGSG GGG
Sbjct: 132 GRGRGGGGYGGGGYGGGGYGGG-GHGGGGYGGGGYGGGGGGYGGSGYGGG 180

 Score =  113 bits (282), Expect = 7e-24
 Identities = 62/96 (64%), Positives = 64/96 (66%), Gaps = 9/96 (9%)
 Frame = +2

Query: 47  GSGGGGGHRGG----GGGGYRSGGGGGYSG---GGGSYGGG--GGRREGGGGYSGGGGGY 199
           G GGGGG+R G    GGGGYR GGGGGY G   GGG YGGG  GG   GGGG+ GGG G 
Sbjct: 104 GRGGGGGYRSGGGYRGGGGYR-GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGG 162

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
              GGGGG YGG    GGGGYGGG  GG G SGGGG
Sbjct: 163 GGYGGGGGGYGGSGYGGGGGYGGGGYGG-GRSGGGG 197

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 53/84 (63%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           RG GGG   RG GGGGY  GG  GGGY GGG  +GGGG    GGGGY GGGGGY     G
Sbjct: 124 RGGGGGYRGRGRGGGGYGGGGYGGGGYGGGG--HGGGG---YGGGGYGGGGGGY-----G 173

Query: 218 GGSYGGGRREGGGGYGGGEGGGYG 289
           G  YGGG   GGGGYGGG  GG G
Sbjct: 174 GSGYGGGGGYGGGGYGGGRSGGGG 197

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 49/76 (64%), Positives = 50/76 (65%), Gaps = 1/76 (1%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGG-GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           + RG GGGG   GG GGGGY  GG GG   GGG YGGGGG   GG GY GGGGGY     
Sbjct: 131 RGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGY-GGSGY-GGGGGY----- 183

Query: 215 GGGSYGGGRREGGGGY 262
           GGG YGGG R GGGGY
Sbjct: 184 GGGGYGGG-RSGGGGY 198

[77][TOP]
>UniRef100_Q6RY61 Glycine-rich RNA-binding protein RGP-1c (Fragment) n=1
           Tax=Nicotiana sylvestris RepID=Q6RY61_NICSY
          Length = 136

 Score =  122 bits (306), Expect = 1e-26
 Identities = 70/107 (65%), Positives = 72/107 (67%), Gaps = 4/107 (3%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGR+ITVNEAQSRG GGGGG   GGGGGY    GGG   GGG Y  GGGRREGGGG  
Sbjct: 35  DLDGRNITVNEAQSRGGGGGGGR--GGGGGY----GGGRREGGGGY--GGGRREGGGGGY 86

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGS----GGGGG 310
           GGGGGY     GGG   GG   GGGGYGGG+    GGS    GGGGG
Sbjct: 87  GGGGGY-----GGGRREGGYGGGGGGYGGGDRYNDGGSRYSRGGGGG 128

[78][TOP]
>UniRef100_A1BQW1 Glycine-rich RNA-binding protein (Fragment) n=1 Tax=Nicotiana
           attenuata RepID=A1BQW1_9SOLA
          Length = 152

 Score =  122 bits (306), Expect = 1e-26
 Identities = 67/95 (70%), Positives = 68/95 (71%), Gaps = 2/95 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGR+ITVNEAQSRGSGG     GGGGGGYR GGGGGY GGG   GG G    GGGGY 
Sbjct: 71  DLDGRNITVNEAQSRGSGG-----GGGGGGYRGGGGGGYGGGGRREGGYG----GGGGYG 121

Query: 182 GG--GGGYSSRGGGGGSYGGGRREGGGGYGGGEGG 280
           GG   GGY   GGGGG YGGGRRE  GGYGGG  G
Sbjct: 122 GGRREGGYG--GGGGGGYGGGRRE--GGYGGGSEG 152

[79][TOP]
>UniRef100_UPI0000DA1BD4 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA1BD4
          Length = 250

 Score =  122 bits (305), Expect = 2e-26
 Identities = 59/87 (67%), Positives = 60/87 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 96  GDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGG-GGGGGGDGGGGGGGGG 154

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGG 307
            GGG  +GGGG GGG GGG GG GGGG
Sbjct: 155 GGGGGGDGGGGVGGGGGGGDGGGGGGG 181

 Score =  121 bits (304), Expect = 2e-26
 Identities = 62/103 (60%), Positives = 64/103 (62%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           D  GR     +    G G GGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  
Sbjct: 58  DGGGRGGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGGGGG---GGGGGG 114

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGGG    GGGGG  GGG   GGGG GGG+GGG GG GGGGG
Sbjct: 115 GGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGG 157

 Score =  121 bits (304), Expect = 2e-26
 Identities = 59/87 (67%), Positives = 61/87 (70%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG  +GGGG  GGGGG    GGGGG 
Sbjct: 82  GGGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGG---GGGGGGG 138

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGG 307
            GGG  +GGGG GGG GGG GG GGGG
Sbjct: 139 GGGGGGDGGGGGGGGGGGGGGGDGGGG 165

 Score =  120 bits (301), Expect = 5e-26
 Identities = 60/97 (61%), Positives = 63/97 (64%)
 Frame = +2

Query: 20  ITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 199
           +TV    + G GGGGG  GGG GG R GGGG   GGGG  GGG G   GGGG  GGGGG 
Sbjct: 37  VTVIVVVAGGGGGGGGGDGGGDGGGRGGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGG- 95

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
              GGGGG  GGG   GGGG GGG+GGG GG GGGGG
Sbjct: 96  GDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGG 132

 Score =  120 bits (300), Expect = 6e-26
 Identities = 59/88 (67%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 90  GGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGG----GGGGGD 145

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG+GGG  G GGGGG
Sbjct: 146 GGGGGGGGGGGGGGGDGGGGVGGGGGGG 173

 Score =  119 bits (299), Expect = 8e-26
 Identities = 57/88 (64%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGG G   GGGGG  GGGG  GGGGG  +GGGG  GGGGG     GGGG 
Sbjct: 107 GGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGV 166

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG    GGG GGG+GGG GG GGGGG
Sbjct: 167 GGGGGGGDGGGGGGGDGGGGGGGGGGGG 194

 Score =  118 bits (296), Expect = 2e-25
 Identities = 59/98 (60%), Positives = 60/98 (61%), Gaps = 10/98 (10%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGG   GGGG  GGGGG  +GGGG  GGGGG    GGGGG 
Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGD 182

Query: 227 YGGGRREGG----------GGYGGGEGGGYGGSGGGGG 310
            GGG   GG          GG GGG GGG GG GGGGG
Sbjct: 183 GGGGGGGGGGGGDGSGGGDGGVGGGSGGGDGGGGGGGG 220

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/88 (64%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG   GGGG    GGGG  
Sbjct: 137 GGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGGGDG 196

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG    GGG GGG+GGG GG GGGGG
Sbjct: 197 SGGGDGGVGGGSGGGDGGGGGGGGGGGG 224

 Score =  117 bits (294), Expect = 3e-25
 Identities = 60/89 (67%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 105 GGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGG---GGGGDGGGGGGGGGGGGGGGD 161

Query: 227 YGGG-RREGGGGYGGGEGGGYGGSGGGGG 310
            GGG    GGGG GGG GGG GG GGGGG
Sbjct: 162 GGGGVGGGGGGGDGGGGGGGDGGGGGGGG 190

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG    GGG  GGGGG    GGGGG 
Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGG 181

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG G G GGG GG GGG G
Sbjct: 182 DGGGGGGGGGGGGDGSGGGDGGVGGGSG 209

 Score =  116 bits (290), Expect = 9e-25
 Identities = 56/88 (63%), Positives = 57/88 (64%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGG   GGGG  GGGGG  +GGGG  GGGGG    GGG G 
Sbjct: 144 GDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGGGDGSGGGDGG 203

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   G GG GGG GGG GG GGG G
Sbjct: 204 VGGGSGGGDGGGGGGGGGGGGGVGGGDG 231

 Score =  114 bits (286), Expect = 3e-24
 Identities = 55/88 (62%), Positives = 56/88 (63%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GG GG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG   GGGG    GGGG  
Sbjct: 116 GGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDG 175

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG  +GGGG GGG GGG G  GG GG
Sbjct: 176 GGGGGGDGGGGGGGGGGGGDGSGGGDGG 203

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/88 (63%), Positives = 56/88 (63%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG G  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  G GGG    GGGGG 
Sbjct: 115 GGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGD 174

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG    GGG GGG GGG  GSGGG G
Sbjct: 175 GGGGGGGDGGGGGGGGGGGGDGSGGGDG 202

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 48/80 (60%), Positives = 50/80 (62%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGG  GGGGGG   GGGGG  GGGG  GGGGG    GGG  G GGG     GGGG 
Sbjct: 158 GGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGGGDGSGGGDGGVGGGSGGGDGGGGG 217

Query: 227 YGGGRREGGGGYGGGEGGGY 286
            GGG   GGGG GGG+GG +
Sbjct: 218 GGGG---GGGGVGGGDGGDH 234

[80][TOP]
>UniRef100_A5GPV8 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. RCC307
           RepID=A5GPV8_SYNR3
          Length = 204

 Score =  122 bits (305), Expect = 2e-26
 Identities = 67/115 (58%), Positives = 72/115 (62%), Gaps = 13/115 (11%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +L GR + +N+A+ RGS GGGG  G GGGG   GG GGY GGGG  GG GG   GGGGY 
Sbjct: 66  ELMGRPLRINKAEPRGSRGGGGGGGYGGGG---GGRGGYGGGGGGRGGYGG---GGGGYG 119

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG-------------YGGSGGGG 307
           GGGGGY   GGGGG YGG    GGGGYGGG GGG             YGG GGGG
Sbjct: 120 GGGGGY---GGGGGGYGG----GGGGYGGGGGGGERASGARGWEDRSYGGGGGGG 167

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 52/100 (52%), Positives = 55/100 (55%), Gaps = 12/100 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGGY  GGGGGY GGGG YGGGG    GGG  + G  G+  R  GGG 
Sbjct: 110 GYGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGGGG----GGGERASGARGWEDRSYGGGG 164

Query: 227 YGG------------GRREGGGGYGGGEGGGYGGSGGGGG 310
            GG             RR GGGG G   GG +G  GG  G
Sbjct: 165 GGGEPSRDSFDEGRSRRRRGGGGGGESSGGDWGDYGGAEG 204

[81][TOP]
>UniRef100_B9SLQ3 Glycine-rich RNA-binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9SLQ3_RICCO
          Length = 166

 Score =  122 bits (305), Expect = 2e-26
 Identities = 69/107 (64%), Positives = 73/107 (68%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQSRG G      GGGGGGYR+GGGGGY GGG   GG G    GGGGYS
Sbjct: 73  NLDGRNITVNEAQSRGGG------GGGGGGYRNGGGGGY-GGGRREGGYG----GGGGYS 121

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG---GGW 313
            GGGGY   GGGGG YGGGR  G GG GGG+GG     GGG   G W
Sbjct: 122 RGGGGY---GGGGGGYGGGRDRGYGG-GGGDGGSRYSRGGGASEGNW 164

[82][TOP]
>UniRef100_B4JMZ8 GH24721 n=1 Tax=Drosophila grimshawi RepID=B4JMZ8_DROGR
          Length = 207

 Score =  122 bits (305), Expect = 2e-26
 Identities = 59/88 (67%), Positives = 63/88 (71%), Gaps = 1/88 (1%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 229
           GGGGG  GGGGGG+  G GGGG  GGGG YGGGGG   GGGG+ GGGGG    GGGGG +
Sbjct: 18  GGGGGLGGGGGGGFGGGFGGGGGYGGGGGYGGGGGYGGGGGGHPGGGGGGHPGGGGGGYH 77

Query: 230 GGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GG    GGGGY GG GGGY G GGGGG+
Sbjct: 78  GG----GGGGYHGGGGGGYHGGGGGGGY 101

 Score =  113 bits (283), Expect = 6e-24
 Identities = 61/105 (58%), Positives = 62/105 (59%), Gaps = 16/105 (15%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GG GGG   GGGGGY GGGG  GGGGG   GGGG   GGGG    GGGGG 
Sbjct: 24  GGGGGGGFGGGFGGGGGYGGGGGYGGGGGYGGGGGGHPGGGGGGHPGGGGGGYHGGGGGG 83

Query: 227 YGGGRREGGGGY-GGGEGGGYG---------------GSGGGGGW 313
           Y GG   GGGGY GGG GGGYG               G GGGGG+
Sbjct: 84  YHGG---GGGGYHGGGGGGGYGRKPTIEVYVVKPVYQGGGGGGGY 125

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/109 (54%), Positives = 60/109 (55%), Gaps = 23/109 (21%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYG-------------------GGGGRREGGGG 175
           GGGGG+ GGGGGGY  GGGGGY GGGG  G                   GGGG   GGG 
Sbjct: 71  GGGGGYHGGGGGGYHGGGGGGYHGGGGGGGYGRKPTIEVYVVKPVYQGGGGGGGYHGGG- 129

Query: 176 YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGE----GGGYGGSGGGGG 310
              GGGGY    GGGG  GGG   GGGG GGG     GGG GG GGGGG
Sbjct: 130 --AGGGGYH---GGGGGVGGGGYHGGGGGGGGPQCCGGGGGGGHGGGGG 173

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 60/114 (52%), Positives = 61/114 (53%), Gaps = 26/114 (22%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYR----------------SGGGGGYSGGG---GSYGGGGGRREGG 169
           G GGGG H GGGGGGY                  GGGGGY GGG   G Y GGGG   GG
Sbjct: 86  GGGGGGYHGGGGGGGYGRKPTIEVYVVKPVYQGGGGGGGYHGGGAGGGGYHGGGG-GVGG 144

Query: 170 GGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGS-------GGGGG 310
           GGY GGGGG    GGG    GGG   GGGG+GGG GG Y  S       GGGGG
Sbjct: 145 GGYHGGGGG----GGGPQCCGGG---GGGGHGGGGGGSYASSSANSYSHGGGGG 191

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 46/90 (51%), Positives = 50/90 (55%), Gaps = 2/90 (2%)
 Frame = +2

Query: 44  RGSGGGGGHRGGG--GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           +G GGGGG+ GGG  GGGY  GGGG   GGGG +GGGG          GGGG     GGG
Sbjct: 117 QGGGGGGGYHGGGAGGGGYHGGGGG--VGGGGYHGGGG----------GGGGPQCCGGGG 164

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GG +GGG   GGG Y       Y   GGGG
Sbjct: 165 GGGHGGG---GGGSYASSSANSYSHGGGGG 191

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 39/68 (57%), Positives = 41/68 (60%), Gaps = 11/68 (16%)
 Frame = +2

Query: 137 YGGGGGRREGGGGYS-----GGGGGYSSRG--GGGGSYGGG----RREGGGGYGGGEGGG 283
           +GGGGG   GGGG       GGGGGY   G  GGGG YGGG       GGGG+ GG GGG
Sbjct: 16  HGGGGGGLGGGGGGGFGGGFGGGGGYGGGGGYGGGGGYGGGGGGHPGGGGGGHPGGGGGG 75

Query: 284 YGGSGGGG 307
           Y G GGGG
Sbjct: 76  YHGGGGGG 83

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/68 (54%), Positives = 40/68 (58%), Gaps = 7/68 (10%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG---GGY-RSGGGGG---YSGGGGSYGGGGGRREGGGGYSGGGGGYSS 205
           G+GGGG H GGGG   GGY   GGGGG     GGGG  G GGG   GGG Y+       S
Sbjct: 129 GAGGGGYHGGGGGVGGGGYHGGGGGGGGPQCCGGGGGGGHGGG---GGGSYASSSANSYS 185

Query: 206 RGGGGGSY 229
            GGGGGS+
Sbjct: 186 HGGGGGSH 193

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 32/47 (68%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +2

Query: 173 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG-GGYGGSGGGGG 310
           G+ GGGGG    GGGGG +GGG   GGGGYGGG G GG GG GGGGG
Sbjct: 15  GHGGGGGGLG--GGGGGGFGGG-FGGGGGYGGGGGYGGGGGYGGGGG 58

[83][TOP]
>UniRef100_C9J285 Putative uncharacterized protein ENSP00000392404 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J285_HUMAN
          Length = 446

 Score =  122 bits (305), Expect = 2e-26
 Identities = 63/100 (63%), Positives = 66/100 (66%), Gaps = 12/100 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG-------GGYRSGG-----GGGYSGGGGSYGGGGGRREGGGGYSGGG 190
           GS GGGG  GGGG       GGY SG      GGG S GGG  GGGGGR  GGGG  GGG
Sbjct: 263 GSSGGGGDNGGGGIGGRVGGGGYSSGSSGSSDGGGDSSGGGGGGGGGGRGGGGGGGGGGG 322

Query: 191 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG+SS GGGGGS GGG   GGGG GG +GGG+ G GGGGG
Sbjct: 323 GGHSSGGGGGGSDGGGHSSGGGG-GGSDGGGHSGGGGGGG 361

 Score =  119 bits (297), Expect = 1e-25
 Identities = 58/100 (58%), Positives = 63/100 (63%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG 190
           G S    ++   G GGGGG RGGGGGG   GGGG  SGGGG    GGG   GGGG    G
Sbjct: 291 GSSDGGGDSSGGGGGGGGGGRGGGGGGGGGGGGGHSSGGGGGGSDGGGHSSGGGGGGSDG 350

Query: 191 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG+S  GGGGGS GGG   GGGG GG +GGG+   GGGGG
Sbjct: 351 GGHSGGGGGGGSDGGGHSSGGGG-GGRDGGGHSSGGGGGG 389

 Score =  119 bits (297), Expect = 1e-25
 Identities = 59/95 (62%), Positives = 64/95 (67%), Gaps = 7/95 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG-------GGGYSS 205
           G GGGGG  GGGGGG+ SGGGGG S GGG   GGGG    GGG+SGG       GGG+SS
Sbjct: 310 GRGGGGGGGGGGGGGHSSGGGGGGSDGGGHSSGGGGGGSDGGGHSGGGGGGGSDGGGHSS 369

Query: 206 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGGGG  GGG   GGGG GG +GGG+   GGGGG
Sbjct: 370 GGGGGGRDGGGHSSGGGG-GGRDGGGHSSGGGGGG 403

 Score =  117 bits (294), Expect = 3e-25
 Identities = 60/89 (67%), Positives = 61/89 (68%), Gaps = 3/89 (3%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 232
           GGGGG RGGGGGG  +GGGGG  GGGG  GGGGG   GGGG  GGGG     GGGGG  G
Sbjct: 126 GGGGGGRGGGGGGRGAGGGGGGRGGGGD-GGGGGSSGGGGGDGGGGGRGGGDGGGGGRGG 184

Query: 233 GGRREGGGGYGGGEGG---GYGGSGGGGG 310
           GGR  GGGG GGG GG   G GG GGGGG
Sbjct: 185 GGRGGGGGGRGGGGGGGGRGGGGDGGGGG 213

 Score =  115 bits (289), Expect = 1e-24
 Identities = 61/100 (61%), Positives = 63/100 (63%), Gaps = 11/100 (11%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGG---GGYRSGGGGGYSGGGGSYGG--------GGGRREGGGGYSGGG 190
           RG+GGGGG RGGGG   GG  SGGGGG  GGGG  GG        GGGR  GGGG  GGG
Sbjct: 139 RGAGGGGGGRGGGGDGGGGGSSGGGGGDGGGGGRGGGDGGGGGRGGGGRGGGGGGRGGGG 198

Query: 191 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG    GGG G  GGG  +GGGG GGG G G GG GGG G
Sbjct: 199 GGGGRGGGGDGGGGGGGGDGGGGEGGGGGDGDGGGGGGDG 238

 Score =  115 bits (288), Expect = 2e-24
 Identities = 58/89 (65%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGG---GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           GGGGG  GGGGGG R GGGGG  GG   GG  GGGGG  +G GG   GGGG    GGGGG
Sbjct: 1   GGGGGRGGGGGGGGRGGGGGGGGGGSSGGGDGGGGGGDGDGDGGVGDGGGGGGGGGGGGG 60

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGGR  GG G GGG GGG GG GGGGG
Sbjct: 61  G-GGGRGSGGDGGGGGGGGGGGGGGGGGG 88

 Score =  115 bits (288), Expect = 2e-24
 Identities = 59/101 (58%), Positives = 64/101 (63%), Gaps = 13/101 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGG------YRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG---- 196
           G GGGGGH  GGGGG      + SGGGGG S GGG  GGGGG    GGG+S GGGG    
Sbjct: 318 GGGGGGGHSSGGGGGGSDGGGHSSGGGGGGSDGGGHSGGGGGGGSDGGGHSSGGGGGGRD 377

Query: 197 ---YSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
              +SS GGGGG  GGG   GGGG GG +GGG+   GGGGG
Sbjct: 378 GGGHSSGGGGGGRDGGGHSSGGGG-GGSDGGGHSSGGGGGG 417

 Score =  114 bits (285), Expect = 3e-24
 Identities = 61/89 (68%), Positives = 61/89 (68%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRG-GGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G GGGGG RG GGGGG R GGG G  GGGGS GGGGG   GGGG  GG GG   RGGGG 
Sbjct: 131 GRGGGGGGRGAGGGGGGRGGGGDG--GGGGSSGGGGG-DGGGGGRGGGDGGGGGRGGGGR 187

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG R GGGG GG  GGG GG GGGGG
Sbjct: 188 GGGGGGRGGGGGGGGRGGGGDGGGGGGGG 216

 Score =  113 bits (283), Expect = 6e-24
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GG G   GGGGGG R GGGGG   GGG  G GGG   GGGG SGGGGG    GG GG 
Sbjct: 116 GDGGVGDGDGGGGGGGRGGGGGGRGAGGGGGGRGGGGDGGGGGSSGGGGGDGGGGGRGGG 175

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 176 DGGGGGRGGGGRGGG-GGGRGGGGGGGG 202

 Score =  113 bits (283), Expect = 6e-24
 Identities = 62/106 (58%), Positives = 66/106 (62%), Gaps = 16/106 (15%)
 Frame = +2

Query: 41  SRGSGGG---GGHRGGGGGG-------YRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG- 187
           S G GGG   GGH GGGGGG          GGGGG  GGG S GGGGG R+GGG  SGG 
Sbjct: 341 SGGGGGGSDGGGHSGGGGGGGSDGGGHSSGGGGGGRDGGGHSSGGGGGGRDGGGHSSGGG 400

Query: 188 -----GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
                GGG+SS GGGGG  GGG   GGGG GG +GGG+   GGGGG
Sbjct: 401 GGGSDGGGHSSGGGGGGRDGGGHSSGGGG-GGRDGGGHSSGGGGGG 445

 Score =  113 bits (282), Expect = 7e-24
 Identities = 56/90 (62%), Positives = 59/90 (65%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           S GS  GGG   GGGGG   GGGG   GGGG  GGGGG   GGGG    GGG+SS GGGG
Sbjct: 289 SSGSSDGGGDSSGGGGG--GGGGGRGGGGGGGGGGGGGHSSGGGGGGSDGGGHSSGGGGG 346

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GS GGG   GGGG GG +GGG+   GGGGG
Sbjct: 347 GSDGGG-HSGGGGGGGSDGGGHSSGGGGGG 375

 Score =  112 bits (281), Expect = 1e-23
 Identities = 62/107 (57%), Positives = 66/107 (61%), Gaps = 17/107 (15%)
 Frame = +2

Query: 41  SRGSGGGG----GHRGGGGGG-------YRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
           S G GGGG    GH  GGGGG          GGGGG  GGG S GGGGG R+GGG  SGG
Sbjct: 326 SSGGGGGGSDGGGHSSGGGGGGSDGGGHSGGGGGGGSDGGGHSSGGGGGGRDGGGHSSGG 385

Query: 188 ------GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
                 GGG+SS GGGGGS GGG   GGGG GG +GGG+   GGGGG
Sbjct: 386 GGGGRDGGGHSSGGGGGGSDGGGHSSGGGG-GGRDGGGHSSGGGGGG 431

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/88 (61%), Positives = 56/88 (63%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G  GGGG RGGG GG    GGGG  GGGG  GGGGG    GGG  GGGGG    GGGG  
Sbjct: 164 GGDGGGGGRGGGDGGGGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGGGGGGGGDGGGGEG 223

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG  +GGGG G G+GGG GG G GGG
Sbjct: 224 GGGGDGDGGGGGGDGDGGGGGGGGDGGG 251

 Score =  112 bits (279), Expect = 2e-23
 Identities = 56/91 (61%), Positives = 58/91 (63%), Gaps = 4/91 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGG RGGGGGG   GGGGG  GGGG  GGGGG  +GGGG  GGGG     GGGG  
Sbjct: 179 GGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGGGGGGGGDGGGGEGGGGGDGDGGGGGGDG 238

Query: 227 YGGGRREGGGGYGGGEGGG----YGGSGGGG 307
            GGG   GG G GGG+GGG     G SGGGG
Sbjct: 239 DGGGGGGGGDGGGGGDGGGGDGDEGSSGGGG 269

 Score =  110 bits (276), Expect = 4e-23
 Identities = 63/105 (60%), Positives = 64/105 (60%), Gaps = 17/105 (16%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGG----------YSGGGGSYGGGG-GRREGGGGYSGG-- 187
           G GGGG   GGGGGG   GGGGG           SGGGG  GGGG G R GGGGYS G  
Sbjct: 231 GGGGGGDGDGGGGGGGGDGGGGGDGGGGDGDEGSSGGGGDNGGGGIGGRVGGGGYSSGSS 290

Query: 188 ----GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
               GGG SS GGGGG  GGG R GGGG GGG GGG+   GGGGG
Sbjct: 291 GSSDGGGDSSGGGGGG--GGGGRGGGGGGGGGGGGGHSSGGGGGG 333

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/88 (62%), Positives = 55/88 (62%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GS GGGG  GGGGG     GGGG  GGGG  GGGGGR  GGGG   GGGG    GGGGG 
Sbjct: 158 GSSGGGGGDGGGGGRGGGDGGGGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGGGGGGGGD 217

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGG   GG GGG G  GGGGG
Sbjct: 218 GGGGEGGGGGDGDGGGGGGDGDGGGGGG 245

 Score =  109 bits (273), Expect = 8e-23
 Identities = 59/102 (57%), Positives = 60/102 (58%), Gaps = 13/102 (12%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGS--------YGGGGGRREGGGGYSGGGGGY 199
           RG GGGGG RGGGGGG   G  GG  GGGG          G GGG   GGGG  GGGGG 
Sbjct: 6   RGGGGGGGGRGGGGGGGGGGSSGGGDGGGGGGDGDGDGGVGDGGGGGGGGGGGGGGGGGR 65

Query: 200 SSRGGGGGSYGGGRREGGGGYGGG-----EGGGYGGSGGGGG 310
            S G GGG  GGG   GGGG GGG     +GGG GGSGGG G
Sbjct: 66  GSGGDGGGGGGGGGGGGGGGGGGGRGSGRDGGGGGGSGGGDG 107

 Score =  108 bits (271), Expect = 1e-22
 Identities = 55/88 (62%), Positives = 56/88 (63%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  G G GG   GGGGG  GGGG  GGGGGR  GG G  GGGGG    GGGGG 
Sbjct: 30  GDGGGGGGDGDGDGGVGDGGGGGGGGGGGG-GGGGGRGSGGDGGGGGGGGGGGGGGGGGG 88

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             G  R+GGG  GGG GGG GG GGG G
Sbjct: 89  GRGSGRDGGG--GGGSGGGDGGGGGGDG 114

 Score =  108 bits (270), Expect = 2e-22
 Identities = 56/89 (62%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREG-GGGYSGGGGGYSSRGGGGG 223
           G GGGGG  GGGGGG  SGG GG  GGGG  GGGGG   G G G  GGGGG S  G GGG
Sbjct: 50  GGGGGGGGGGGGGGGRGSGGDGGGGGGGGGGGGGGGGGGGRGSGRDGGGGGGSGGGDGGG 109

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG  +G GG G G+GGG GG  GGGG
Sbjct: 110 --GGGDGDGDGGVGDGDGGGGGGGRGGGG 136

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/108 (56%), Positives = 61/108 (56%), Gaps = 20/108 (18%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGY---RSGGGGGYSGGG-----------------GSYGGGGGRREG 166
           G GGGGG  GGGGGG    R GGGGG SGGG                 G  GGGGG R G
Sbjct: 75  GGGGGGGGGGGGGGGRGSGRDGGGGGGSGGGDGGGGGGDGDGDGGVGDGDGGGGGGGRGG 134

Query: 167 GGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG  G GGG   RGGGG   GGG   GGGG GGG G G GG GGGGG
Sbjct: 135 GGGGRGAGGGGGGRGGGGDGGGGGSSGGGGGDGGGGGRG-GGDGGGGG 181

 Score =  107 bits (267), Expect = 4e-22
 Identities = 53/88 (60%), Positives = 54/88 (61%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG G  GG GGG R GGGGG  GGGG  G GGG   GGGG  G GGG    GGG G 
Sbjct: 171 GRGGGDGGGGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGGGGGGGGDGGGGEGGGGGDGD 230

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG  +G GG GGG G G GG  GGGG
Sbjct: 231 GGGGGGDGDGGGGGGGGDGGGGGDGGGG 258

 Score =  107 bits (266), Expect = 5e-22
 Identities = 59/101 (58%), Positives = 60/101 (59%), Gaps = 13/101 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGG-----YRSGGGGGYSGGGGSYGGGG--------GRREGGGGYSGG 187
           G GGGGG  GGGGGG      R GGGGG SGGG   GGGG        G  +GGGG  G 
Sbjct: 73  GGGGGGGGGGGGGGGGGRGSGRDGGGGGGSGGGDGGGGGGDGDGDGGVGDGDGGGGGGGR 132

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG   RG GGG  GGGR  GG G GGG  GG GG GGGGG
Sbjct: 133 GGGGGGRGAGGG--GGGRGGGGDGGGGGSSGGGGGDGGGGG 171

 Score =  106 bits (264), Expect = 9e-22
 Identities = 55/89 (61%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR-GGGGG 223
           G GG G   GGGGGG   GGGGG  G GG  GGGGG   GGGG  GGGG  S R GGGGG
Sbjct: 41  GDGGVGDGGGGGGGGGGGGGGGGGRGSGGDGGGGGGGGGGGGGGGGGGGRGSGRDGGGGG 100

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG   GGGG G G+GG   G GGGGG
Sbjct: 101 GSGGGDGGGGGGDGDGDGGVGDGDGGGGG 129

 Score =  105 bits (263), Expect = 1e-21
 Identities = 56/91 (61%), Positives = 56/91 (61%), Gaps = 4/91 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS----GGGGGYSSRGG 214
           G GGGGG  G G GG   G GGG  GGGG  GGGGGR  GGGG      G GGG  S GG
Sbjct: 105 GDGGGGGGDGDGDGGVGDGDGGG--GGGGRGGGGGGRGAGGGGGGRGGGGDGGGGGSSGG 162

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GGG  GGG R GG G GGG GGG  G GGGG
Sbjct: 163 GGGDGGGGGRGGGDGGGGGRGGGGRGGGGGG 193

 Score =  105 bits (263), Expect = 1e-21
 Identities = 56/95 (58%), Positives = 60/95 (63%), Gaps = 5/95 (5%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG---YSGGGGGYSSRGG 214
           RG GGGGG RGGGG G   GGGGG   GGG  GGGGG  +GGGG     GGGGG    GG
Sbjct: 194 RGGGGGGGGRGGGGDG---GGGGGGGDGGGGEGGGGGDGDGGGGGGDGDGGGGGGGGDGG 250

Query: 215 GGGSYGGGRREGGGGYGGGE--GGGYGGSGGGGGW 313
           GGG  GGG  + G   GGG+  GGG GG  GGGG+
Sbjct: 251 GGGDGGGGDGDEGSSGGGGDNGGGGIGGRVGGGGY 285

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/89 (60%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG RG GG G   GGGGG  GGGG  GG G  R+GGGG  G GGG    GGG G 
Sbjct: 57  GGGGGGGGRGSGGDGGGGGGGGGGGGGGGGGGGRGSGRDGGGG-GGSGGGDGGGGGGDGD 115

Query: 227 YGGGRREG-GGGYGGGEGGGYGGSGGGGG 310
             GG  +G GGG GGG GGG GG G GGG
Sbjct: 116 GDGGVGDGDGGGGGGGRGGGGGGRGAGGG 144

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/101 (56%), Positives = 57/101 (56%), Gaps = 13/101 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGG----------GYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG 196
           G G GGG  GGGGG          G   GGGGG  GGGG  G GGG    GGG  GGGGG
Sbjct: 99  GGGSGGGDGGGGGGDGDGDGGVGDGDGGGGGGGRGGGGGGRGAGGGGGGRGGGGDGGGGG 158

Query: 197 YSSRG---GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            S  G   GGGG  GGG   GGG  GGG GGG GG GGGGG
Sbjct: 159 SSGGGGGDGGGGGRGGGDGGGGGRGGGGRGGGGGGRGGGGG 199

 Score =  103 bits (258), Expect = 5e-21
 Identities = 54/86 (62%), Positives = 55/86 (63%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 232
           GGGGG  GGGGGG R GGG G  GGGG  GGGG   EGGGG  G GGG    G GGG  G
Sbjct: 189 GGGGGRGGGGGGGGRGGGGDGGGGGGGGDGGGG---EGGGGGDGDGGGGGGDGDGGGGGG 245

Query: 233 GGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  +GGGG  GG G G  GS GGGG
Sbjct: 246 GG--DGGGGGDGGGGDGDEGSSGGGG 269

 Score =  101 bits (251), Expect = 3e-20
 Identities = 59/110 (53%), Positives = 60/110 (54%), Gaps = 22/110 (20%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG---GGGGRREGGGGYSGGGG-GYSSRGG 214
           G GGGGG  G GGGG   GGG G  GGGG  G   GGGG  +GGGG  GGGG G     G
Sbjct: 207 GDGGGGGGGGDGGGGEGGGGGDGDGGGGGGDGDGGGGGGGGDGGGGGDGGGGDGDEGSSG 266

Query: 215 GGGSYGG---GRREGGGGY---------------GGGEGGGYGGSGGGGG 310
           GGG  GG   G R GGGGY               GGG GGG GG GGGGG
Sbjct: 267 GGGDNGGGGIGGRVGGGGYSSGSSGSSDGGGDSSGGGGGGGGGGRGGGGG 316

[84][TOP]
>UniRef100_Q40052 Glycine rich protein, RNA binding protein n=1 Tax=Hordeum vulgare
           RepID=Q40052_HORVU
          Length = 173

 Score =  121 bits (304), Expect = 2e-26
 Identities = 68/111 (61%), Positives = 72/111 (64%), Gaps = 7/111 (6%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGS--GGGGGHRG--GGGGGYRSGGGGGYSGGGGSYGGGGGRR--- 160
           +LDGR +TVNEAQSR S  GGGGG+ G  GGGGGY  GGGGGY G GG YGG GG     
Sbjct: 71  ELDGRQVTVNEAQSRRSAGGGGGGYGGQRGGGGGY--GGGGGYGGQGGGYGGQGGGGYGG 128

Query: 161 EGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           +GGGGY G  GG    GGGGG YGG    GGGGYGG  GGG      GG W
Sbjct: 129 QGGGGYGGQRGGGGGYGGGGGGYGG----GGGGYGGQRGGG----DSGGQW 171

[85][TOP]
>UniRef100_B9Q6L7 RNA recognition motif-containing protein, putative n=1
           Tax=Toxoplasma gondii VEG RepID=B9Q6L7_TOXGO
          Length = 510

 Score =  121 bits (304), Expect = 2e-26
 Identities = 60/94 (63%), Positives = 62/94 (65%), Gaps = 5/94 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG+ GGGG G    GGGGY GG G YGGGG    GGGGY GG GGY   GGGGG 
Sbjct: 303 GYGGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGYGGGGYGGGNGGY---GGGGGG 359

Query: 227 YGG-----GRREGGGGYGGGEGGGYGGSGGGGGW 313
           YGG     G   GGGGYGGG G G GG GGGGG+
Sbjct: 360 YGGGGGGYGGYGGGGGYGGGGGFGSGGYGGGGGY 393

 Score =  113 bits (282), Expect = 7e-24
 Identities = 63/99 (63%), Positives = 64/99 (64%), Gaps = 10/99 (10%)
 Frame = +2

Query: 47  GSGGGGGHR----GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           G GG GGH     GGG GG   GGGGGY GGGG YGGGG    GGGGY GG GGY   G 
Sbjct: 283 GRGGYGGHGSPYGGGGYGGGGYGGGGGYGGGGG-YGGGG---YGGGGYGGGNGGYGGGGN 338

Query: 215 ---GGGSYGGGR---REGGGGYGGGEGGGYGGSGGGGGW 313
              GGG YGGG      GGGGYGGG GGGYGG GGGGG+
Sbjct: 339 GGYGGGGYGGGNGGYGGGGGGYGGG-GGGYGGYGGGGGY 376

 Score =  108 bits (270), Expect = 2e-22
 Identities = 55/84 (65%), Positives = 56/84 (66%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGG  GGG GGY  GG GGY GGGG  GG GG   GGGGY GGGGGY   GGGGG 
Sbjct: 318 GGGYGGGGYGGGNGGYGGGGNGGY-GGGGYGGGNGGYGGGGGGYGGGGGGYGGYGGGGG- 375

Query: 227 YGGGRREGGGGYGGGEGGGYGGSG 298
           YGGG   G GGYGG  GGGY  +G
Sbjct: 376 YGGGGGFGSGGYGG--GGGYSPAG 397

 Score =  103 bits (257), Expect = 6e-21
 Identities = 57/91 (62%), Positives = 58/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG-GG 220
           G    G  RG G GG+R G G GGY G G  YGGGG    GGGGY GGGGGY   GG GG
Sbjct: 263 GGFNSGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGG---YGGGGY-GGGGGYGGGGGYGG 318

Query: 221 GSYGGGRREGG-GGYGGGEGGGYGGSGGGGG 310
           G YGGG   GG GGYGGG  GGYGG G GGG
Sbjct: 319 GGYGGGGYGGGNGGYGGGGNGGYGGGGYGGG 349

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/90 (54%), Positives = 50/90 (55%), Gaps = 1/90 (1%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG-GGGGRREGGGGYSGGGGGYSSRGGGG 220
           RG   G  H G   G  R  G GG+ GG G  G GG G   GGGGY  GGGGY    GGG
Sbjct: 254 RGGFDGFYHGGFNSGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGGY--GGGGY----GGG 307

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G YGGG     GGYGGG   GYGG G GGG
Sbjct: 308 GGYGGG-----GGYGGG---GYGGGGYGGG 329

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/72 (59%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +2

Query: 47  GSGG-GGGHRGGGGGGYRSGGGGGY-SGGGGSYGGGGGRREGGGGYSGGGG-GYSSRGGG 217
           G+GG GGG  GGG GGY  GGGGG   GGGG YGG G    GGGGY GGGG G    GGG
Sbjct: 337 GNGGYGGGGYGGGNGGY--GGGGGGYGGGGGGYGGYG----GGGGYGGGGGFGSGGYGGG 390

Query: 218 GGSYGGGRREGG 253
           GG    G   GG
Sbjct: 391 GGYSPAGPHHGG 402

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 41/79 (51%), Positives = 44/79 (55%), Gaps = 7/79 (8%)
 Frame = +2

Query: 95  RSGGGGGYSGG-GGSYGGGGGRREGGGGYSGG--GGGYSSRGGGGGSYGGGRREGGGGYG 265
           R  G GG+ G   G +  G  R  G GG+ GG   GGY   GG G  YGGG   GGGGYG
Sbjct: 250 RPPGRGGFDGFYHGGFNSGPMRGPGRGGFRGGMGRGGY---GGHGSPYGGGGY-GGGGYG 305

Query: 266 G----GEGGGYGGSGGGGG 310
           G    G GGGYGG G GGG
Sbjct: 306 GGGGYGGGGGYGGGGYGGG 324

[86][TOP]
>UniRef100_B9PW07 RNA recognition motif-containing protein, putative n=1
           Tax=Toxoplasma gondii GT1 RepID=B9PW07_TOXGO
          Length = 508

 Score =  121 bits (304), Expect = 2e-26
 Identities = 60/94 (63%), Positives = 62/94 (65%), Gaps = 5/94 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG+ GGGG G    GGGGY GG G YGGGG    GGGGY GG GGY   GGGGG 
Sbjct: 301 GYGGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGYGGGGYGGGNGGY---GGGGGG 357

Query: 227 YGG-----GRREGGGGYGGGEGGGYGGSGGGGGW 313
           YGG     G   GGGGYGGG G G GG GGGGG+
Sbjct: 358 YGGGGGGYGGYGGGGGYGGGGGFGSGGYGGGGGY 391

 Score =  110 bits (274), Expect = 6e-23
 Identities = 62/107 (57%), Positives = 63/107 (58%), Gaps = 12/107 (11%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGG----GGGYSGGGGSYGGG--GGRREGGGGYSGGG 190
           N    RG G GG   G G GGY   G    GGGY GGGG  GGG  GG   GGGGY GG 
Sbjct: 269 NSGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGGYGGGGGYGGGGGYGGGGYGGGGYGGGN 328

Query: 191 GGYSSRGG---GGGSYGGGR---REGGGGYGGGEGGGYGGSGGGGGW 313
           GGY   G    GGG YGGG      GGGGYGGG GGGYGG GGGGG+
Sbjct: 329 GGYGGGGNGGYGGGGYGGGNGGYGGGGGGYGGG-GGGYGGYGGGGGY 374

 Score =  108 bits (270), Expect = 2e-22
 Identities = 55/84 (65%), Positives = 56/84 (66%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGG  GGG GGY  GG GGY GGGG  GG GG   GGGGY GGGGGY   GGGGG 
Sbjct: 316 GGGYGGGGYGGGNGGYGGGGNGGY-GGGGYGGGNGGYGGGGGGYGGGGGGYGGYGGGGG- 373

Query: 227 YGGGRREGGGGYGGGEGGGYGGSG 298
           YGGG   G GGYGG  GGGY  +G
Sbjct: 374 YGGGGGFGSGGYGG--GGGYSPAG 395

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/92 (58%), Positives = 55/92 (59%), Gaps = 3/92 (3%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG-GGGGRREGGGGYSGGGGGYSSRGG-G 217
           RG   G  H G   G  R  G GG+ GG G  G GG G   GGGGY GGGGGY   GG G
Sbjct: 257 RGGFDGFYHGGFNSGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGGY-GGGGGYGGGGGYG 315

Query: 218 GGSYGGGRREGG-GGYGGGEGGGYGGSGGGGG 310
           GG YGGG   GG GGYGGG  GGYGG G GGG
Sbjct: 316 GGGYGGGGYGGGNGGYGGGGNGGYGGGGYGGG 347

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/72 (59%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +2

Query: 47  GSGG-GGGHRGGGGGGYRSGGGGGY-SGGGGSYGGGGGRREGGGGYSGGGG-GYSSRGGG 217
           G+GG GGG  GGG GGY  GGGGG   GGGG YGG G    GGGGY GGGG G    GGG
Sbjct: 335 GNGGYGGGGYGGGNGGY--GGGGGGYGGGGGGYGGYG----GGGGYGGGGGFGSGGYGGG 388

Query: 218 GGSYGGGRREGG 253
           GG    G   GG
Sbjct: 389 GGYSPAGPHHGG 400

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 41/78 (52%), Positives = 44/78 (56%), Gaps = 6/78 (7%)
 Frame = +2

Query: 95  RSGGGGGYSGG-GGSYGGGGGRREGGGGYSGG--GGGYSSRGGGGGSYGGGRREGGGGYG 265
           R  G GG+ G   G +  G  R  G GG+ GG   GGY   GG G  YGGG   GGGGYG
Sbjct: 253 RPPGRGGFDGFYHGGFNSGPMRGPGRGGFRGGMGRGGY---GGHGSPYGGGGYGGGGGYG 309

Query: 266 GG---EGGGYGGSGGGGG 310
           GG    GGGYGG G GGG
Sbjct: 310 GGGGYGGGGYGGGGYGGG 327

[87][TOP]
>UniRef100_A6RXS7 Putative uncharacterized protein n=1 Tax=Botryotinia fuckeliana
           B05.10 RepID=A6RXS7_BOTFB
          Length = 197

 Score =  121 bits (304), Expect = 2e-26
 Identities = 67/110 (60%), Positives = 71/110 (64%), Gaps = 10/110 (9%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRG----SGGGGGHRGG--GGGGYRSGGGGGYSGGGGSYGGGGG--R 157
           + DGR+I V++A  R     SGGGGG  GG  GGGGY   GGGGY GGGG YGGG G   
Sbjct: 74  EFDGRTIRVDKASERAGNDRSGGGGGGFGGGRGGGGYGGRGGGGYGGGGGGYGGGRGYDN 133

Query: 158 REGGGGYSGGGGGYSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGG 301
              GGGYS GGGGYS  GG  GGG Y GG   GGGGY GG GGGY G GG
Sbjct: 134 NNSGGGYS-GGGGYSGGGGYSGGGGYNGG--GGGGGYSGGGGGGYSGGGG 180

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 49/84 (58%), Positives = 53/84 (63%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 232
           GGGGG+ GGG G   +  GGGYSGGGG  GGGG    GGGGY+GGGGG    GGGGG Y 
Sbjct: 120 GGGGGY-GGGRGYDNNNSGGGYSGGGGYSGGGG--YSGGGGYNGGGGGGGYSGGGGGGY- 175

Query: 233 GGRREGGGGYGGGEGGGYGGSGGG 304
                GGGGY   + GG  GS GG
Sbjct: 176 ----SGGGGYDRNQSGGNAGSWGG 195

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 45/81 (55%), Positives = 48/81 (59%), Gaps = 16/81 (19%)
 Frame = +2

Query: 47  GSGGGGGHRGGG--------GGGYRSGGG----GGYSGGGGSYGGGGG---RREGGGGYS 181
           G GGGGG  GGG        GGGY  GGG    GGYSGGGG  GGGGG      GGGGYS
Sbjct: 117 GYGGGGGGYGGGRGYDNNNSGGGYSGGGGYSGGGGYSGGGGYNGGGGGGGYSGGGGGGYS 176

Query: 182 GGGG-GYSSRGGGGGSYGGGR 241
           GGGG   +  GG  GS+GG +
Sbjct: 177 GGGGYDRNQSGGNAGSWGGNQ 197

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 40/78 (51%), Positives = 41/78 (52%), Gaps = 22/78 (28%)
 Frame = +2

Query: 146 GGGRREGGGGYSG---GGGGYSSR-----GGGGGSYGGGR----------REGGGGYGGG 271
           G  R  GGGG  G   GGGGY  R     GGGGG YGGGR            GGGGY GG
Sbjct: 90  GNDRSGGGGGGFGGGRGGGGYGGRGGGGYGGGGGGYGGGRGYDNNNSGGGYSGGGGYSGG 149

Query: 272 ----EGGGYGGSGGGGGW 313
                GGGY G GGGGG+
Sbjct: 150 GGYSGGGGYNGGGGGGGY 167

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 34/65 (52%), Positives = 36/65 (55%), Gaps = 13/65 (20%)
 Frame = +2

Query: 158 REGGGGYSGGGGGY-SSRGGG--GGSYGGGRREGGGGYGGG-------EGGGYGGSG--- 298
           R G     GGGGG+   RGGG  GG  GGG   GGGGYGGG        GGGY G G   
Sbjct: 88  RAGNDRSGGGGGGFGGGRGGGGYGGRGGGGYGGGGGGYGGGRGYDNNNSGGGYSGGGGYS 147

Query: 299 GGGGW 313
           GGGG+
Sbjct: 148 GGGGY 152

[88][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score =  121 bits (303), Expect = 3e-26
 Identities = 61/103 (59%), Positives = 62/103 (60%), Gaps = 6/103 (5%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPP---LPP*PPPSPPPYPPPPSRLPPP*LPPPP---PLEE*PPPPPLY 175
           P P    Y PPPPP    PP PPPSPPP PPP    PPP  PPPP   P    PPPPP  
Sbjct: 282 PPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPS 341

Query: 174 PPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPPS  PPPP  LPP    PPPPP   PPPPPP + PPPP P
Sbjct: 342 PPPPS--PPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTP 382

 Score =  119 bits (299), Expect = 8e-26
 Identities = 61/116 (52%), Positives = 63/116 (54%), Gaps = 20/116 (17%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*----LPPPPPLEE*PPPPPLY- 175
           +P P    Y PPPPP  P PP   PP PPPP   PPP      PPPPP    PPPPP+Y 
Sbjct: 257 SPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYS 316

Query: 174 -----------PPPPSRLPPPPP*LPPPPE*PPPPPL----RYPPPPPPRWPPPPP 52
                      PPPP   PPPPP  PPPP  PPP PL    R PPPPPP  PPPPP
Sbjct: 317 PPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPP 372

 Score =  118 bits (295), Expect = 2e-25
 Identities = 62/110 (56%), Positives = 67/110 (60%), Gaps = 8/110 (7%)
 Frame = -3

Query: 315 YHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLY---PPPPSRLPPP 145
           Y PPPPP P   PP PPP PPPP   PPP   PPPP+   PPPPP+Y   PPPPS  PPP
Sbjct: 256 YSPPPPP-PVYSPPPPPPSPPPPVYSPPP---PPPPVYSPPPPPPVYSPPPPPPSPPPPP 311

Query: 144 PP*L--PPPPE*PPP---PPLRYPPPPPPRWPPPPPLPRD*ASLTVMLRP 10
           PP    PPPP  PPP   PP+  PPPPPP   PPPP P   + L   +RP
Sbjct: 312 PPVYSPPPPPSPPPPSPPPPVYSPPPPPP--SPPPPSPPPPSPLPPCVRP 359

 Score =  114 bits (284), Expect = 4e-24
 Identities = 59/99 (59%), Positives = 60/99 (60%), Gaps = 11/99 (11%)
 Frame = -3

Query: 309 PPPPPLPP*PPPS-----PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP- 148
           PPPPP PP PPP      PPP PPPPS  PP   PPPPP    P PPP  PPPPS LPP 
Sbjct: 301 PPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPP----PSPPPPSPPPPSPLPPC 356

Query: 147 ---PPP*LPPPPE*PPPPPLRYPPPPPPRW--PPPPPLP 46
              PPP  PPP   PPPPPL  PPPP P +   PPPP P
Sbjct: 357 VRPPPP--PPPNSPPPPPPLFSPPPPTPYYYSSPPPPSP 393

 Score =  114 bits (284), Expect = 4e-24
 Identities = 61/119 (51%), Positives = 63/119 (52%), Gaps = 22/119 (18%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*P--------PPSPPPYPPPPSRLPPP*LPP------PPPLEE 199
           P P    Y PPPPP PP P        PP PPP PPPPS  PP  LPP      PPP   
Sbjct: 308 PPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNS 367

Query: 198 *PPPPPLYPPPP-------SRLPPPPP*LPPPPE*PPPPPLR-YPPPPPPRWPPPPPLP 46
            PPPPPL+ PPP       S  PP PP  PPPP   PPPP   + PPPPP  PPPP  P
Sbjct: 368 PPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYP 426

 Score =  113 bits (282), Expect = 7e-24
 Identities = 57/98 (58%), Positives = 59/98 (60%), Gaps = 11/98 (11%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPP---PPLEE*PPPPPLY----PPPPSRLPP 148
           PPPP PP P PSPP Y PPP   PPP  PPP   PP     PPPP+Y    PPPP   PP
Sbjct: 235 PPPPSPPMPVPSPPVYLPPPVYSPPP--PPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPP 292

Query: 147 PPP*L----PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP +    PPPP  PPPPP  Y PPPPP  PPP P P
Sbjct: 293 PPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPP 330

 Score =  107 bits (266), Expect = 5e-22
 Identities = 61/111 (54%), Positives = 61/111 (54%), Gaps = 14/111 (12%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPL--PP*PPPSPPPYPP---PPSRLPPP*LPPPPPLEE*PPPPPLY- 175
           P P    Y PPPPP   PP  PP P P PP   PP   PP   PPPPPL   PPP P Y 
Sbjct: 326 PSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYY 385

Query: 174 --PPPPS--RLPPPPP*LPPPPE*P--PPPPLRYPPPP--PPRWPPPPPLP 46
             PPPPS    PPPPP  PPPP  P  PPPP   PPPP  P   PPPPP P
Sbjct: 386 SSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHP 436

 Score =  105 bits (262), Expect = 2e-21
 Identities = 61/132 (46%), Positives = 67/132 (50%), Gaps = 31/132 (23%)
 Frame = -3

Query: 348 FIGNPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*L------PPPPPLEE*PPP 187
           +  +P P    + PPPPP  P PPPSPP  PPPP   PPP +      PPPP     PPP
Sbjct: 384 YYSSPPPPSPPHSPPPPPHSP-PPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPP 442

Query: 186 PPLY--PPPPS-----RLPPPPP*L---PPPPE*PPPPPLRY-------PP--------P 82
           PP+Y  PPPPS       PPPPP     PPPP   PPPP +Y       PP        P
Sbjct: 443 PPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSP 502

Query: 81  PPPRWPPPPPLP 46
           PPP   PPPP P
Sbjct: 503 PPPSQSPPPPAP 514

 Score =  104 bits (260), Expect = 3e-21
 Identities = 59/109 (54%), Positives = 61/109 (55%), Gaps = 12/109 (11%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPY--PPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
           P P   N  PPPPPL   PPP+P  Y  PPPPS   PP  PPPPP    PP PP  PPPP
Sbjct: 360 PPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPS---PPHSPPPPPHSPPPPSPPHSPPPP 416

Query: 162 SRLPPPP--P*LPPPPE*-----PPPPPLRYPPPPP---PRWPPPPPLP 46
              PPPP  P L PPP       PPPPP+  PPPPP   P   PPPP P
Sbjct: 417 PHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPP 465

 Score =  103 bits (256), Expect = 8e-21
 Identities = 53/93 (56%), Positives = 55/93 (59%), Gaps = 7/93 (7%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPP-PYPPPPSRLPPP*LPPPPPLEE*PPPPPLY-PPPPSRLPPPPP* 136
           P  P LP  PPPSPP P P PP  LPPP   PPPP       PP+Y PPPP   PPPP  
Sbjct: 227 PFVPTLPAPPPPSPPMPVPSPPVYLPPPVYSPPPP-------PPVYSPPPPPPSPPPPVY 279

Query: 135 LPPPP-----E*PPPPPLRYPPPPPPRWPPPPP 52
            PPPP       PPPPP+  PPPPPP  PPPPP
Sbjct: 280 SPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPP 312

 Score =  102 bits (255), Expect = 1e-20
 Identities = 54/102 (52%), Positives = 55/102 (53%), Gaps = 15/102 (14%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPY-------------PPPPSRLPPP*LPPPPPLEE*PPPPPLYPPP 166
           PPPP PP  PP PPP              PPPPS   PP  PPPPP    PP PP  PPP
Sbjct: 359 PPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPS---PPHSPPPPPHSPPPPSPPHSPPP 415

Query: 165 PSRLPPPP--P*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P   PPPP  P L PP   PPP P+  PPPPP   PPPPP P
Sbjct: 416 PPHSPPPPIYPYLSPP---PPPHPVYSPPPPPVYSPPPPPSP 454

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/120 (50%), Positives = 63/120 (52%), Gaps = 24/120 (20%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPL---PP*PPPSPP--------PYPPPPSRLPPP*LPPPPPL---- 205
           +P P   +  PPPPP+   PP P P PP        P PPPPS  PPP  PPP PL    
Sbjct: 299 SPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSP-PPPSPPPPSPLPPCV 357

Query: 204 EE*PPPPPLYPPPPSRL--PPPP-------P*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
              PPPPP  PPPP  L  PPPP       P  P PP  PPPPP   PPP PP  PPPPP
Sbjct: 358 RPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPP 417

 Score =  102 bits (254), Expect = 1e-20
 Identities = 56/113 (49%), Positives = 61/113 (53%), Gaps = 16/113 (14%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PP------PSPPPYP----PPPSRLPPP*LPPPPPLEE*PP 190
           +P P    + PPPPP  P PP      P PPP+P    PPP    PP  P PPP  E PP
Sbjct: 403 SPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPP 462

Query: 189 PPPLY---PPPPSRLPPPPP*LPPPPE*-PPPPPLRY--PPPPPPRWPPPPPL 49
           PPP     PPPPS  PPPP    PPP   PPPPP+ Y  PPPP    PPP P+
Sbjct: 463 PPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQSPPPPAPV 515

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/70 (50%), Positives = 37/70 (52%), Gaps = 11/70 (15%)
 Frame = -3

Query: 222 PPPPPLEE*PPPPPLYP--------PPPSRLPPPPP*L---PPPPE*PPPPPLRYPPPPP 76
           P  P L   PPP P  P        PPP   PPPPP +   PPPP  PPPP    PPPPP
Sbjct: 227 PFVPTLPAPPPPSPPMPVPSPPVYLPPPVYSPPPPPPVYSPPPPPPSPPPPVYSPPPPPP 286

Query: 75  PRWPPPPPLP 46
           P + PPPP P
Sbjct: 287 PVYSPPPPPP 296

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 37/73 (50%), Positives = 40/73 (54%)
 Frame = -3

Query: 264 PYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPP 85
           P PPPPS        PP P+    P PP+Y PPP   PPPPP +  PP   PPPP    P
Sbjct: 233 PAPPPPS--------PPMPV----PSPPVYLPPPVYSPPPPPPVYSPP---PPPP---SP 274

Query: 84  PPPPRWPPPPPLP 46
           PPP   PPPPP P
Sbjct: 275 PPPVYSPPPPPPP 287

[89][TOP]
>UniRef100_B3MYN1 GF22178 n=1 Tax=Drosophila ananassae RepID=B3MYN1_DROAN
          Length = 223

 Score =  121 bits (303), Expect = 3e-26
 Identities = 61/104 (58%), Positives = 66/104 (63%), Gaps = 17/104 (16%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGG   GGGGGG  +GGGGGY+GGGG Y GGGG   GGGGY GGGGG +  GGGGG 
Sbjct: 44  GGGGGGFGWGGGGGGGFNGGGGGYNGGGGGYHGGGGGYNGGGGYHGGGGGGNYGGGGGGY 103

Query: 227 YGGG--------------RREGGGG---YGGGEGGGYGGSGGGG 307
           +GGG                 GGGG   +GGG GGGYGG GGGG
Sbjct: 104 HGGGGGGKTIDIYVVKPVYSSGGGGGHRWGGGGGGGYGGGGGGG 147

 Score =  111 bits (278), Expect = 2e-23
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 22/111 (19%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGG--------------SYGGGGGRR---EGGGG 175
           G  GGGG+ GGGGGG   GGGGGY GGGG              S GGGGG R    GGGG
Sbjct: 80  GYNGGGGYHGGGGGGNYGGGGGGYHGGGGGGKTIDIYVVKPVYSSGGGGGHRWGGGGGGG 139

Query: 176 YSGGGGGYSSRGGGGGSY---GGGRREGGGGYGGGE--GGGYGGSGGGGGW 313
           Y GGGGG    GGGGG Y   GGG   GGGG GG +  GGG GG GG G W
Sbjct: 140 YGGGGGG-GYHGGGGGGYPGGGGGGYHGGGGGGGPQWGGGGGGGGGGAGSW 189

 Score =  105 bits (263), Expect = 1e-21
 Identities = 53/80 (66%), Positives = 56/80 (70%), Gaps = 2/80 (2%)
 Frame = +2

Query: 74  GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGG 253
           GGGGGG+  GGGGG+  GGG   GGGG   GGGGY+GGGGGY   GGGGG  GGG   GG
Sbjct: 36  GGGGGGWGGGGGGGFGWGGG---GGGGFNGGGGGYNGGGGGY--HGGGGGYNGGGGYHGG 90

Query: 254 GGYG--GGEGGGYGGSGGGG 307
           GG G  GG GGGY G GGGG
Sbjct: 91  GGGGNYGGGGGGYHGGGGGG 110

 Score =  105 bits (261), Expect = 2e-21
 Identities = 54/90 (60%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +2

Query: 50  SGGGGGHR--GGGGGGYRSGGGGGY-SGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           SGGGGGHR  GGGGGGY  GGGGGY  GGGG Y GG     GGGGY GGGGG   + GGG
Sbjct: 124 SGGGGGHRWGGGGGGGYGGGGGGGYHGGGGGGYPGG-----GGGGYHGGGGGGGPQWGGG 178

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G  GGG   G G +       + GSGGGGG
Sbjct: 179 GGGGGG---GAGSWASSSANSWAGSGGGGG 205

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 39/67 (58%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +2

Query: 122 GGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY---GGGRREGGGGYGGGEGGGYGG 292
           GGGG  G GGG   GGGG+  GGGG     GGGG Y   GGG   GGGGY G  GGGY G
Sbjct: 35  GGGGGGGWGGG---GGGGFGWGGGGGGGFNGGGGGYNGGGGGYHGGGGGYNG--GGGYHG 89

Query: 293 SGGGGGW 313
            GGGG +
Sbjct: 90  GGGGGNY 96

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 40/82 (48%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +2

Query: 53  GGGGGH-RGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 229
           GGGGG   GGGGGGY  GGG    GGG  +GGGGG   GGGG  G G   SS        
Sbjct: 150 GGGGGGYPGGGGGGYHGGGG----GGGPQWGGGGG---GGGG--GAGSWASSSANSWAGS 200

Query: 230 GGGRREGGGGYGGGEGGGYGGS 295
           GGG   G G Y       Y GS
Sbjct: 201 GGGGGGGSGAYAKASANAYAGS 222

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 31/81 (38%), Positives = 35/81 (43%), Gaps = 18/81 (22%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGY------------------SGGGGSYGGGGGRREGGG 172
           G GGGGG+ GGGGGGY  GGGGGY                   GG GS+         G 
Sbjct: 141 GGGGGGGYHGGGGGGYPGGGGGGYHGGGGGGGPQWGGGGGGGGGGAGSWASSSANSWAGS 200

Query: 173 GYSGGGGGYSSRGGGGGSYGG 235
           G  GGGG  +       +Y G
Sbjct: 201 GGGGGGGSGAYAKASANAYAG 221

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 8/54 (14%)
 Frame = +2

Query: 176 YSGGGGGYSSRGGG-----GGSYGGGRREGGGGYGGGEGGGYGGSG---GGGGW 313
           + GGGGG    GGG     GG  GGG   GGGGY GG GG +GG G   GGGG+
Sbjct: 34  FGGGGGGGWGGGGGGGFGWGGGGGGGFNGGGGGYNGGGGGYHGGGGGYNGGGGY 87

[90][TOP]
>UniRef100_UPI0001862007 hypothetical protein BRAFLDRAFT_58365 n=1 Tax=Branchiostoma
           floridae RepID=UPI0001862007
          Length = 178

 Score =  120 bits (302), Expect = 4e-26
 Identities = 64/99 (64%), Positives = 68/99 (68%), Gaps = 1/99 (1%)
 Frame = +2

Query: 17  SITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSG-GGGSYGGGGGRREGGGGYSGGGG 193
           S+   + + RG GGGGG+RG GGGGY  GGGGGY G GGG YGG  G   GGGGY GGGG
Sbjct: 79  SVAKPQGERRGGGGGGGYRGRGGGGY--GGGGGYRGRGGGGYGGSYG---GGGGYGGGGG 133

Query: 194 GYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GY   GGGGGSYGGG      GYGGG  GG GGS GGGG
Sbjct: 134 GY---GGGGGSYGGG------GYGGGSYGGGGGSYGGGG 163

 Score =  104 bits (260), Expect = 3e-21
 Identities = 62/107 (57%), Positives = 66/107 (61%), Gaps = 4/107 (3%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +L  R I V+ A+ +G   GGG    GGGGYR  GGGGY GGGG  G GGG   G GG  
Sbjct: 70  ELGTRVINVSVAKPQGERRGGG----GGGGYRGRGGGGYGGGGGYRGRGGG---GYGGSY 122

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGG--EGGGYGGSGG--GGG 310
           GGGGGY   GGGGG YGGG    GG YGGG   GG YGG GG  GGG
Sbjct: 123 GGGGGY---GGGGGGYGGG----GGSYGGGGYGGGSYGGGGGSYGGG 162

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 41/74 (55%), Positives = 45/74 (60%), Gaps = 2/74 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GS GGGG  GGGGGG        Y GGGGSYGGGG    GGG Y GGGG Y    GGGG+
Sbjct: 120 GSYGGGGGYGGGGGG--------YGGGGGSYGGGG---YGGGSYGGGGGSY----GGGGN 164

Query: 227 YGGGRR--EGGGGY 262
           Y   ++  +G GGY
Sbjct: 165 YSQQQQYDQGYGGY 178

[91][TOP]
>UniRef100_Q31DH1 RNA-binding region RNP-1 n=1 Tax=Prochlorococcus marinus str. MIT
           9312 RepID=Q31DH1_PROM9
          Length = 222

 Score =  120 bits (302), Expect = 4e-26
 Identities = 70/111 (63%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGG-GHRGGG--GGGYRSGGGGGYSGG--GGSYGGGGGRREG 166
           +L GR + +N+A+ RGSGG   G RGGG  GGGY   GGGGY GG  GG YGGGGG   G
Sbjct: 66  ELMGRPLRINKAEPRGSGGSRRGGRGGGNNGGGY---GGGGYGGGNNGGGYGGGGGG--G 120

Query: 167 GGGYSGG--GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGY GG  GGGY   GGGGG YGGG    GGGYGGG GGGYGG   GGG+
Sbjct: 121 GGGYGGGNNGGGY---GGGGGGYGGG--NNGGGYGGG-GGGYGGGNNGGGY 165

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 46/82 (56%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G GGGG   GGGGGGY  G  GGGY GGGG YGGG      GGGY GGGGGY   G  GG
Sbjct: 112 GYGGGG---GGGGGGYGGGNNGGGYGGGGGGYGGG----NNGGGYGGGGGGYGG-GNNGG 163

Query: 224 SYGGGRREGGGGYGGGEGGGYG 289
            YGGG  E    Y     G  G
Sbjct: 164 GYGGGNPEPKTSYTNNSSGAEG 185

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 36/74 (48%), Positives = 37/74 (50%), Gaps = 9/74 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGG--GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGY---SGGGGGYSSRG 211
           G GGGGG  GGG  GGGY  GGGGGY GG    G GGG  E    Y   S G  G+  R 
Sbjct: 132 GYGGGGGGYGGGNNGGGYG-GGGGGYGGGNNGGGYGGGNPEPKTSYTNNSSGAEGWEDRS 190

Query: 212 GGGGS----YGGGR 241
            G  S    Y  GR
Sbjct: 191 YGNSSENSEYESGR 204

[92][TOP]
>UniRef100_Q40426 RNA-binding glycine-rich protein-1a n=1 Tax=Nicotiana sylvestris
           RepID=Q40426_NICSY
          Length = 156

 Score =  120 bits (302), Expect = 4e-26
 Identities = 66/97 (68%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           DLDGR+ITVNEAQSRGSGG     GGGGGGYR G GGGY GGG   GG G    GGGGY 
Sbjct: 71  DLDGRNITVNEAQSRGSGG-----GGGGGGYRGGSGGGYGGGGRREGGYG----GGGGYG 121

Query: 182 GG--GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
           GG   GGY   GGGGG YGGGRRE  GGYGGG  G +
Sbjct: 122 GGRREGGYG--GGGGGGYGGGRRE--GGYGGGSEGNW 154

[93][TOP]
>UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO
          Length = 1765

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/92 (63%), Positives = 60/92 (65%), Gaps = 3/92 (3%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPP---P 139
            PPPPP PP P P PPP PPPP   PPP  PPPPP    PPP P+ PPPPS +PPPP   P
Sbjct: 1173 PPPPPSPPPPRPPPPPSPPPPVHEPPP-SPPPPPNPSPPPPSPM-PPPPSPMPPPPSPPP 1230

Query: 138  *LPPPPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
              PPPP   PPPP   PPPP P  PPPPP PR
Sbjct: 1231 PSPPPPSPMPPPP--SPPPPIPSPPPPPPTPR 1260

 Score =  117 bits (293), Expect = 4e-25
 Identities = 56/91 (61%), Positives = 57/91 (62%), Gaps = 4/91 (4%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP----PPP 139
            PPPP PP PPP PPP PPPP   PPP   PPPP+ E PP PP   PPPS  PP    PPP
Sbjct: 1094 PPPPPPPSPPPPPPPSPPPPRPPPPP--SPPPPVHEPPPSPP---PPPSPPPPTPDAPPP 1148

Query: 138  *LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              PPPP  PPP P   PPPPP   PPPPP P
Sbjct: 1149 SPPPPPPSPPPSPPPSPPPPPSPMPPPPPSP 1179

 Score =  117 bits (293), Expect = 4e-25
 Identities = 61/106 (57%), Positives = 64/106 (60%), Gaps = 9/106 (8%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP----*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLY 175
            P P+     PPPPP PP     PPPS  PPP PPPP+   PP  PPPPP    P PPP  
Sbjct: 1106 PPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSP 1165

Query: 174  PPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPP---PPRWPPPPPLP 46
            PPPPS +PPPPP  PPPP  PPPP    PPPP   PP  PPPPP P
Sbjct: 1166 PPPPSPMPPPPP-SPPPPRPPPPPS---PPPPVHEPPPSPPPPPNP 1207

 Score =  115 bits (289), Expect = 1e-24
 Identities = 59/101 (58%), Positives = 61/101 (60%), Gaps = 4/101 (3%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPP----PLEE*PPPPPLYPP 169
            P P   +  PPPPP PP P P PPP PPPP   PPP  PPPP    P  + PPP P  PP
Sbjct: 1095 PPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPP-PP 1153

Query: 168  PPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPS  P PPP  PPPP   PPPP   P PPPPR PPPPP P
Sbjct: 1154 PPSPPPSPPPSPPPPPSPMPPPP---PSPPPPR-PPPPPSP 1190

 Score =  115 bits (287), Expect = 2e-24
 Identities = 54/89 (60%), Positives = 55/89 (61%), Gaps = 3/89 (3%)
 Frame = -3

Query: 303  PPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP---PPP*L 133
            PPP PP PPPSPPP PPP    PP  +PPPPP     PPPP  PPPPS  PP   PPP  
Sbjct: 1146 PPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPP----SPPPPRPPPPPSPPPPVHEPPPSP 1201

Query: 132  PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPP   PPPP   PPPP P  PPP P P
Sbjct: 1202 PPPPNPSPPPPSPMPPPPSPMPPPPSPPP 1230

 Score =  115 bits (287), Expect = 2e-24
 Identities = 59/102 (57%), Positives = 62/102 (60%), Gaps = 3/102 (2%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPP-SRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            P P+     PPPPP PP P   PPP PPPP +  PPP  P PPP    PPPP   PPPPS
Sbjct: 1175 PPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPPPS--PPPPS 1232

Query: 159  RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPP--PPPLPRD 40
              PPPP  +PPPP  PPP P   PPPP PR PP  PPPLP D
Sbjct: 1233 --PPPPSPMPPPPSPPPPIPSPPPPPPTPRSPPPAPPPLPGD 1272

 Score =  113 bits (282), Expect = 7e-24
 Identities = 56/96 (58%), Positives = 59/96 (61%), Gaps = 8/96 (8%)
 Frame = -3

Query: 309  PPPPPLPP*PPP-SPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLP--PPPP 139
            PPPPP PP P P +PPP PPPP   PPP  PP PP    PPP P+ PPPPS  P  PPPP
Sbjct: 1132 PPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSPP----PPPSPMPPPPPSPPPPRPPPP 1187

Query: 138  *LPP-----PPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              PP     PP  PPPPP   PPPP P  PPP P+P
Sbjct: 1188 PSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMP 1223

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/86 (54%), Positives = 47/86 (54%), Gaps = 3/86 (3%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSP---PPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP 139
            PPPPP P  PPPSP   PP P PP   PPP  PPPP     P PPP  PPPP   PPPPP
Sbjct: 1201 PPPPPNPSPPPPSPMPPPPSPMPPPPSPPPPSPPPPS----PMPPPPSPPPPIPSPPPPP 1256

Query: 138  *LPPPPE*PPPPPLRYPPPPPPRWPP 61
              P  P  P PPPL     P P  PP
Sbjct: 1257 PTPRSPP-PAPPPLPGDVDPTPASPP 1281

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 26/52 (50%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPP-PYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
            PPP P+PP P P PP P PPPP   P    P PPPL     P P  PP   R
Sbjct: 1234 PPPSPMPPPPSPPPPIPSPPPPPPTPRSPPPAPPPLPGDVDPTPASPPVTGR 1285

[94][TOP]
>UniRef100_Q7VEJ9 RNA-binding protein, RRM domain n=1 Tax=Prochlorococcus marinus
           RepID=Q7VEJ9_PROMA
          Length = 252

 Score =  120 bits (301), Expect = 5e-26
 Identities = 65/106 (61%), Positives = 71/106 (66%), Gaps = 4/106 (3%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGG---GHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG 172
           +L GR + +N+A+ RG GGGG   G+ GGG GGY  GGGGGY GGGG  GGG G   G G
Sbjct: 66  ELMGRPLRINKAEPRGGGGGGRGGGYGGGGRGGY--GGGGGYGGGGGYGGGGYGGGGGQG 123

Query: 173 GYSGGG-GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GY GGG GGY   GGG G YGGG   G GGYGGG  GGYGG G GG
Sbjct: 124 GYGGGGQGGYG--GGGQGGYGGG---GQGGYGGGGQGGYGGGGQGG 164

 Score =  106 bits (264), Expect = 9e-22
 Identities = 58/99 (58%), Positives = 60/99 (60%), Gaps = 10/99 (10%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG-GSYGGGGGRREGGGGYSG-GGGGYSSRGGGG 220
           G GG GG+ GGG GGY  GG GGY GGG G YGGGG    GGGG  G GGGG    GGGG
Sbjct: 118 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGG 177

Query: 221 -GSYGGGRREGGGGYGGGEGGGYGG-------SGGGGGW 313
            G YGGG   G GGYGGG  GGYGG       + G  GW
Sbjct: 178 QGGYGGG---GQGGYGGGGQGGYGGGQDTEQRASGAQGW 213

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 49/90 (54%), Positives = 51/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGG-GSYGGGGGRREGGGGYSGGG-GGYSSRGGG 217
           +G  GGGG  G GGGG      GGY GGG G YGGG     G GGY GGG GGY   GGG
Sbjct: 138 QGGYGGGGQGGYGGGGQ-----GGYGGGGQGGYGGG-----GQGGYGGGGQGGYG--GGG 185

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
            G YGGG   G GGYGGG+      SG  G
Sbjct: 186 QGGYGGG---GQGGYGGGQDTEQRASGAQG 212

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 39/102 (38%), Positives = 43/102 (42%), Gaps = 17/102 (16%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGG---YSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G GG GG+ GGG GGY  GG GG     GG G YGGG     G GGY GG        G 
Sbjct: 158 GGGGQGGYGGGGQGGYGGGGQGGYGG--GGQGGYGGG-----GQGGYGGGQDTEQRASGA 210

Query: 218 GG----SYGG----------GRREGGGGYGGGEGGGYGGSGG 301
            G    SYG            +R  G      +   YGG+ G
Sbjct: 211 QGWEDRSYGSSDSSERDDTRSKRRRGASSEADQDADYGGAEG 252

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 29/46 (63%), Positives = 30/46 (65%), Gaps = 10/46 (21%)
 Frame = +2

Query: 206 RGGGGG----SYGGGRR---EGGGGYGGG---EGGGYGGSGGGGGW 313
           RGGGGG     YGGG R    GGGGYGGG    GGGYGG GG GG+
Sbjct: 80  RGGGGGGRGGGYGGGGRGGYGGGGGYGGGGGYGGGGYGGGGGQGGY 125

[95][TOP]
>UniRef100_Q6ZD62 Os08g0108300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6ZD62_ORYSJ
          Length = 342

 Score =  120 bits (301), Expect = 5e-26
 Identities = 59/98 (60%), Positives = 59/98 (60%), Gaps = 10/98 (10%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPY-PPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP--- 139
           PPPP PP  PPSPP   PPPP R PPP    PPP    PPPP L PPPP R PPPP    
Sbjct: 51  PPPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPP 110

Query: 138 -----*LPPPPE*PPPPPLRYPPPP-PPRWPPPPPLPR 43
                  PPPP  PPPPP R PPPP PP  PPPPP PR
Sbjct: 111 PPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPR 148

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/104 (54%), Positives = 58/104 (55%), Gaps = 11/104 (10%)
 Frame = -3

Query: 330 PN*RNYHP--PPPPLPP*PPPSPPPYPPPPSRLPPP*LP---PPPPLEE*PPPPPLYPPP 166
           PN   Y P  P  P PP  PP P   PPPP R PPP  P   PP P    PPPP   PPP
Sbjct: 19  PNPNPYAPLNPNAPKPPVMPPRPQA-PPPPQRFPPPPAPPIRPPSPPGRAPPPPGRAPPP 77

Query: 165 PSRLPPPPP*LPPPPE*PPPPPLR------YPPPPPPRWPPPPP 52
           PS+ PPPP   PPPP  PPPPP R       PPPPPPR  PPPP
Sbjct: 78  PSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPP 121

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/106 (53%), Positives = 60/106 (56%), Gaps = 9/106 (8%)
 Frame = -3

Query: 336 PKPN*RNYHP--PPPPLPP*PPPSPPPYPP-PPSRLPPP*LPPPPPLEE*PPPPPLYPPP 166
           PKP      P  PPPP    PPP+PP  PP PP R PPP    PPP  + PPPP   PPP
Sbjct: 32  PKPPVMPPRPQAPPPPQRFPPPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPP 91

Query: 165 PSRLPPPPP*LPPPPE*PPPPPLR------YPPPPPPRWPPPPPLP 46
           P+  PPPP   PPPP  PPPPP R        PPPPPR  PPPP P
Sbjct: 92  PALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAPPPPSP 137

 Score =  107 bits (266), Expect = 5e-22
 Identities = 53/91 (58%), Positives = 56/91 (61%), Gaps = 5/91 (5%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPP   P PPPS    PPPP R PPP   PPPP    PPPP + PPPP R  PPPP  P
Sbjct: 68  PPPPGRAP-PPPSQA--PPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATP 124

Query: 129 PPP----E*PPPPPLRYPPPPPPR-WPPPPP 52
           PPP      PP PP+R PPPP PR + PPPP
Sbjct: 125 PPPPRRAPPPPSPPIRPPPPPTPRPYAPPPP 155

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/99 (54%), Positives = 56/99 (56%), Gaps = 11/99 (11%)
 Frame = -3

Query: 309 PPPPPLPP*PP---PSPPPYPPPPSRL--PPP*LPPPPPLEE*PPPPPLYPPPPSRLPPP 145
           PPPP   P PP   P PP  PPPP R   PPP +PPPPP    PPPP   PPPP R PPP
Sbjct: 75  PPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAPPP 134

Query: 144 --PP*LPPPPE*P----PPPPLRYPPPPPPRWPPPPPLP 46
             PP  PPPP  P    PPPP     PPPP   PP P+P
Sbjct: 135 PSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVP 173

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/89 (57%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPP-PPLYPPPPSRLPPPPP*L 133
           PPPPP    PPPS PP PPP    PPP  PPPPP    PPP PP+ PPPP   P P P  
Sbjct: 95  PPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPP---PTPRPYA 151

Query: 132 PPPPE*P--PPPPLRYPPPPPPRWPPPPP 52
           PPPP  P  PPPP   PP P P  P PPP
Sbjct: 152 PPPPSHPLAPPPPHISPPAPVPPPPSPPP 180

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 44/91 (48%), Positives = 49/91 (53%), Gaps = 15/91 (16%)
 Frame = -3

Query: 279 PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS----------RLPPPPP*LP 130
           PP+P PY P     P P + PP P  + PPPP  +PPPP+          R PPPP   P
Sbjct: 18  PPNPNPYAPLNPNAPKPPVMPPRP--QAPPPPQRFPPPPAPPIRPPSPPGRAPPPPGRAP 75

Query: 129 PPPE*PPPPPLRYP-----PPPPPRWPPPPP 52
           PPP   PPPP R P     PPPPPR  PPPP
Sbjct: 76  PPPSQAPPPPRRAPPPPALPPPPPRRAPPPP 106

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 39/76 (51%), Positives = 40/76 (52%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P      PPPP  PP PP   PP P PP R PPP  P P P    PP  PL PPPP  
Sbjct: 109 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPP--PTPRPYAPPPPSHPLAPPPPHI 166

Query: 156 LPPPPP*LPPPPE*PP 109
            PP P  +PPPP  PP
Sbjct: 167 SPPAP--VPPPPSPPP 180

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 41/81 (50%), Positives = 43/81 (53%), Gaps = 6/81 (7%)
 Frame = -3

Query: 267 PPYPPPPSRLPP--P*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLR 94
           P YPP P+   P  P  P PP +    PP P  PPPP R PPPP     PP  PP PP R
Sbjct: 15  PFYPPNPNPYAPLNPNAPKPPVM----PPRPQAPPPPQRFPPPPA----PPIRPPSPPGR 66

Query: 93  YPPPPPPRWPPP----PPLPR 43
             PPPP R PPP    PP PR
Sbjct: 67  -APPPPGRAPPPPSQAPPPPR 86

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/53 (50%), Positives = 31/53 (58%), Gaps = 7/53 (13%)
 Frame = -3

Query: 189 PPPLYPPPPSRL------PPPPP*LPPPPE*PPPPPLRYPPPP-PPRWPPPPP 52
           P P YPP P+         P PP +PP P+  PPPP R+PPPP PP  PP PP
Sbjct: 13  PFPFYPPNPNPYAPLNPNAPKPPVMPPRPQ-APPPPQRFPPPPAPPIRPPSPP 64

[96][TOP]
>UniRef100_B6SP74 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays
           RepID=B6SP74_MAIZE
          Length = 156

 Score =  120 bits (301), Expect = 5e-26
 Identities = 67/102 (65%), Positives = 70/102 (68%), Gaps = 2/102 (1%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGY 178
           +LDGR+ITVNEAQSRG       RGGGGGGY  G GGGGY        GGGGRR+GGGGY
Sbjct: 73  ELDGRNITVNEAQSRGG------RGGGGGGYGGGRGGGGY--------GGGGRRDGGGGY 118

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGG-EGGGYGGSGG 301
            GGGGGY    GGGG YGG    GGGGYGGG  GGGYG S G
Sbjct: 119 GGGGGGY----GGGGGYGG----GGGGYGGGNRGGGYGNSDG 152

[97][TOP]
>UniRef100_B9PV72 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1
           RepID=B9PV72_TOXGO
          Length = 488

 Score =  120 bits (301), Expect = 5e-26
 Identities = 60/89 (67%), Positives = 62/89 (69%), Gaps = 2/89 (2%)
 Frame = +2

Query: 50  SGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG-YSGGGGGYSSRGGGGGS 226
           SGG    RG GGGGY  GGGGGY GGGG YGGGGG   GGGG Y GGGGGY + GGG G+
Sbjct: 51  SGGPQSDRGYGGGGY-GGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGAGGGGYGA 109

Query: 227 YGGGRREGGGGYG-GGEGGGYGGSGGGGG 310
            GGG   GGGGYG GG GGGYG  GG  G
Sbjct: 110 GGGGYGAGGGGYGAGGGGGGYGAGGGNSG 138

 Score =  119 bits (298), Expect = 1e-25
 Identities = 59/88 (67%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRR-EGGGGYSGGGGGYSSRGGGGG 223
           G GGGGG  GGGGGGY  GGGGGY GGGG YGGGGG    GGGGY  GGGGY   G GGG
Sbjct: 64  GYGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGY---GAGGG 119

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGG 307
            YG G   GG G GGG  GGYG   GGG
Sbjct: 120 GYGAGGGGGGYGAGGGNSGGYGSGYGGG 147

 Score =  114 bits (286), Expect = 3e-24
 Identities = 60/101 (59%), Positives = 62/101 (61%), Gaps = 14/101 (13%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG-GGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G GGGGG  GGGGGGY  GGGGGY GGGG YG GGGG   GGGGY  GGGGY + GGGGG
Sbjct: 71  GYGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGGGG 129

Query: 224 SYGGGRREG--GGGYGGGEGG-----------GYGGSGGGG 307
              GG   G  G GYGGG  G           G GG+ GGG
Sbjct: 130 YGAGGGNSGGYGSGYGGGRSGREKHRSRSRSPGGGGAAGGG 170

 Score =  114 bits (284), Expect = 4e-24
 Identities = 56/88 (63%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSY-GGGGGRREGGGGYSGGGGGYSSRGGGGGSY 229
           G G G   GG    R  GGGGY GGGG Y GGGGG   GGGGY GGGGGY   GGG G+ 
Sbjct: 44  GYGPGSSSGGPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGAG 103

Query: 230 GGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGG   GGGGYG G GGGYG  GGGGG+
Sbjct: 104 GGGYGAGGGGYGAG-GGGYGAGGGGGGY 130

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/96 (54%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG---RREGGGGYSGGGGGYSSRGGG 217
           G GGGGG  GGGGGGY   GGGGY  GGG YG GGG      GGGGY  GGG   + GG 
Sbjct: 85  GYGGGGGGYGGGGGGY-GAGGGGYGAGGGGYGAGGGGYGAGGGGGGYGAGGG---NSGGY 140

Query: 218 GGSYGGGR--------REGGGGYGGGEGGGYGGSGG 301
           G  YGGGR        R    G GG  GGG G  GG
Sbjct: 141 GSGYGGGRSGREKHRSRSRSPGGGGAAGGGKGARGG 176

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/77 (58%), Positives = 45/77 (58%)
 Frame = +2

Query: 80  GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGG 259
           G   YR    GGY  G  S G    R  GGGGY GGGGGY   GGG G  GGG   GGGG
Sbjct: 33  GDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 92

Query: 260 YGGGEGGGYGGSGGGGG 310
           YGGG GGGYG  GGG G
Sbjct: 93  YGGG-GGGYGAGGGGYG 108

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 47/91 (51%), Positives = 47/91 (51%), Gaps = 6/91 (6%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG---GGGGYSSRGGGGGS 226
           GGG  R   G   R    G     G  YGG G     GG  S    GGGGY   GGGGG 
Sbjct: 15  GGGRDRDARGPRSRDSFRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGY---GGGGGG 71

Query: 227 Y---GGGRREGGGGYGGGEGGGYGGSGGGGG 310
           Y   GGG   GGGGYGGG GGGYGG GGG G
Sbjct: 72  YGGGGGGYGGGGGGYGGG-GGGYGGGGGGYG 101

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/85 (48%), Positives = 43/85 (50%), Gaps = 8/85 (9%)
 Frame = +2

Query: 80  GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG-------GGGYSSRGGGGGSYGGG 238
           G   +R GG    + G  S     G RE  G Y GG       GG  S RG GGG YGGG
Sbjct: 9   GRDAWRGGGRDRDARGPRSRDSFRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYGGG 68

Query: 239 RREGGGGYGGGEGG-GYGGSGGGGG 310
               GGGYGGG GG G GG G GGG
Sbjct: 69  ----GGGYGGGGGGYGGGGGGYGGG 89

[98][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score =  120 bits (300), Expect = 6e-26
 Identities = 64/105 (60%), Positives = 64/105 (60%), Gaps = 3/105 (2%)
 Frame = -3

Query: 306  PPPPLPP*P---PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP* 136
            PPPPLPP P   PPSPPP PPPP  LPPP LPPPP     PPP P   PPPS  P PPP 
Sbjct: 1198 PPPPLPPPPVPPPPSPPPLPPPP--LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPP 1255

Query: 135  LPPPPE*PPPPPLRYPPPPPPRWPPPPPLPRD*ASLTVMLRPSRS 1
             PPPP   PPPP   P PPPP  PPPPPL    A  T   R SRS
Sbjct: 1256 TPPPP--APPPPTPPPSPPPPTPPPPPPL----APFTCEDRASRS 1294

 Score =  120 bits (300), Expect = 6e-26
 Identities = 62/102 (60%), Positives = 65/102 (63%), Gaps = 14/102 (13%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSR------LPPP*LPPP--PPLEE*PPP-----PPLYPP 169
            PPP P PP PPPSPPP PPPP+       LPPP  PPP  PPL   PPP     PPL PP
Sbjct: 2120 PPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPP 2179

Query: 168  PPSRLPPPPP*LPPPPE*PPPPPLRYP-PPPPPRWPPPPPLP 46
             PS LPPPP  +PPPP  PP PP + P PP PP  PPPPPLP
Sbjct: 2180 SPSPLPPPP--IPPPPSPPPHPPPQSPLPPSPPPPPPPPPLP 2219

 Score =  119 bits (298), Expect = 1e-25
 Identities = 60/91 (65%), Positives = 61/91 (67%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
            PPP P PP PPPSPPP PPPP+  PPP  PPPP      PPPPL PPPPS  PP PPP L
Sbjct: 1146 PPPAPPPPAPPPSPPPSPPPPT--PPPPAPPPPNPPPPSPPPPL-PPPPSPPPPLPPPPL 1202

Query: 132  PPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PPPP  PP  PPPL  PP PPP  PPPP  P
Sbjct: 1203 PPPPVPPPPSPPPLPPPPLPPPPLPPPPSPP 1233

 Score =  119 bits (297), Expect = 1e-25
 Identities = 59/91 (64%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
            PPP P PP PPPSPPP PPPP+  PPP  PPP P    PPPP   PPPPS  PP PPP L
Sbjct: 877  PPPAPPPPAPPPSPPPSPPPPTP-PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPL 935

Query: 132  PPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PPPP  PP  PPPL  PP PPP  PPPP  P
Sbjct: 936  PPPPVPPPPSPPPLPPPPLPPPPLPPPPSPP 966

 Score =  119 bits (297), Expect = 1e-25
 Identities = 62/95 (65%), Positives = 62/95 (65%), Gaps = 8/95 (8%)
 Frame = -3

Query: 306  PPPPLPP*P---PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP 139
            PPPPLPP P   PPSPPP PPPP  LPPP LPPPP     PPP P   PPPS  PP PPP
Sbjct: 931  PPPPLPPPPVPPPPSPPPLPPPP--LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPP 988

Query: 138  *LPPPPE*P---PPPPLRYPPPPPPRWP-PPPPLP 46
              PPPP  P   PPPPL  PPPP P  P PPPPLP
Sbjct: 989  PAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLP 1023

 Score =  118 bits (296), Expect = 2e-25
 Identities = 57/89 (64%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
            PPP P PP PPPSPPP PPPP+  PPP  PPP P    PPPP   PPPPS  PP PPP L
Sbjct: 786  PPPAPPPPTPPPSPPPSPPPPTP-PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPL 844

Query: 132  PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPP  PPP P   PPP PP  PPP P P
Sbjct: 845  PPPPLPPPPSPPPSPPPSPPPSPPPSPPP 873

 Score =  118 bits (296), Expect = 2e-25
 Identities = 57/89 (64%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
            PPP P PP PPPSPPP PPPP+  PPP  PPP P    PPPP   PPPPS  PP PPP L
Sbjct: 1055 PPPAPPPPAPPPSPPPSPPPPTP-PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPL 1113

Query: 132  PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPP  PPP P   PPP PP  PPP P P
Sbjct: 1114 PPPPLPPPPSPPPSPPPSPPPSPPPSPPP 1142

 Score =  118 bits (295), Expect = 2e-25
 Identities = 59/99 (59%), Positives = 60/99 (60%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
            P P+     PPP P PP PPP   PPP PPPP  LPPP   PPPPL   P PPP  PPPP
Sbjct: 886  PPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP-PSPPPPLPPPPLPPPPVPPPP 944

Query: 162  SRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            S  P PPP LPPPP  PPP P   PPP PP  PPP P P
Sbjct: 945  SPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPP 983

 Score =  117 bits (292), Expect = 5e-25
 Identities = 55/89 (61%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
            PPPP  PP PPPSPPP  PPP   PPP  PPP P    P PPP  PPPP   PP PPP L
Sbjct: 790  PPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPL 849

Query: 132  PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPP  PP PP   PP PPP  PPP P P
Sbjct: 850  PPPPSPPPSPPPSPPPSPPPSPPPPTPPP 878

 Score =  117 bits (292), Expect = 5e-25
 Identities = 55/89 (61%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
            PPPP  PP PPPSPPP  PPP   PPP  PPP P    P PPP  PPPP   PP PPP L
Sbjct: 1059 PPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPL 1118

Query: 132  PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPP  PP PP   PP PPP  PPP P P
Sbjct: 1119 PPPPSPPPSPPPSPPPSPPPSPPPPTPPP 1147

 Score =  117 bits (292), Expect = 5e-25
 Identities = 58/91 (63%), Positives = 58/91 (63%), Gaps = 4/91 (4%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPP----PLEE*PPPPPLYPPPPSRLPPPPP 139
            PPPP PP PP  PPP PPPPS  PPP LPPPP    PL   P PPP  PPPPS  P PPP
Sbjct: 1163 PPPPTPP-PPAPPPPNPPPPS--PPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPP 1219

Query: 138  *LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             LPPPP  PPP P   PPP PP  PPP P P
Sbjct: 1220 PLPPPPLPPPPSPPPSPPPSPPPSPPPSPPP 1250

 Score =  116 bits (291), Expect = 7e-25
 Identities = 57/88 (64%), Positives = 57/88 (64%), Gaps = 1/88 (1%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PPP  PP PPPSPPP PPPP  LPPP  P PPP    P PPP  PPPPS  P PPP LPP
Sbjct: 1585 PPPSPPPSPPPSPPPSPPPPLPLPPP--PSPPP----PLPPPPVPPPPSPPPLPPPPLPP 1638

Query: 126  PPE*PPPPPLRYPPPPPPRWPP-PPPLP 46
            PP  PP PP   PP PPP  PP P PLP
Sbjct: 1639 PPSPPPSPPPSPPPSPPPSPPPSPSPLP 1666

 Score =  116 bits (290), Expect = 9e-25
 Identities = 56/94 (59%), Positives = 58/94 (61%), Gaps = 7/94 (7%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP------P 145
            PPP  PP PPPSPPP PPPP+  PP   PP PP    P PPP  PPPP+  PP      P
Sbjct: 1124 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSP 1183

Query: 144  PP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
            PP LPPPP  PPP PP   PPPP P  P PPPLP
Sbjct: 1184 PPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLP 1217

 Score =  116 bits (290), Expect = 9e-25
 Identities = 56/90 (62%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = -3

Query: 306  PPPPLPP*P--PPSPPPYPPP-PSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP* 136
            PPPP+PP P  PPSPPP PPP P   PPP  PPP PL   P PPP  PPPP   PP PP 
Sbjct: 1571 PPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPP 1630

Query: 135  LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            LPPPP  PPP P   PPP PP  PPP P P
Sbjct: 1631 LPPPPLPPPPSPPPSPPPSPPPSPPPSPPP 1660

 Score =  115 bits (289), Expect = 1e-24
 Identities = 58/97 (59%), Positives = 58/97 (59%), Gaps = 9/97 (9%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPP--PSRLPPP*LPPPPPLEE*PPPPPL-YPPPPSRLPP--- 148
            PPPP  PP PPPSPPP PPP  P   PPP  PPPP      PPPPL  PPPPS  PP   
Sbjct: 960  PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPP 1019

Query: 147  ---PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
               PPP LPPPP  PP PP   PP PPP  PPP P P
Sbjct: 1020 PPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPP 1056

 Score =  115 bits (288), Expect = 2e-24
 Identities = 57/97 (58%), Positives = 58/97 (59%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPP P PP PPPSPPP P PP  LPPP LPPPP     PPP P   PPPS 
Sbjct: 683 PSPPPPSPSPPPSPPPPSPPPSPPP-PSPPPPLPPPPLPPPPL----PPPSPPPSPPPSP 737

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            P PPP  PPPP  PPP P   PPP PP  PPP P P
Sbjct: 738 PPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPP 774

 Score =  115 bits (288), Expect = 2e-24
 Identities = 60/103 (58%), Positives = 62/103 (60%), Gaps = 5/103 (4%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            +P P+     PPP P PP PPP  PP P PPS LPPP  PPP P    PP PP  PPPP 
Sbjct: 1547 SPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPP-SPPPSPPPSPPPSPPPSPPPPL 1605

Query: 159  RLPPPP---P*LPPPPE*PPP--PPLRYPPPPPPRWPPPPPLP 46
             LPPPP   P LPPPP  PPP  PPL  PP PPP  PPP P P
Sbjct: 1606 PLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPP 1648

 Score =  115 bits (287), Expect = 2e-24
 Identities = 60/101 (59%), Positives = 61/101 (60%), Gaps = 4/101 (3%)
 Frame = -3

Query: 336  PKPN*RNYHPPPP-PLPP*PPPSPPPYPPPPSRLPPP*LPPPP---PLEE*PPPPPLYPP 169
            P PN     PPPP PLPP PP  PPP PPPP  LPPP +PPPP   PL   P PPP  PP
Sbjct: 905  PPPNPPPPSPPPPLPLPP-PPSPPPPLPPPP--LPPPPVPPPPSPPPLPPPPLPPPPLPP 961

Query: 168  PPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPS  P PPP  PP P   PPPP   PP PPP  PPPP  P
Sbjct: 962  PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 1002

 Score =  115 bits (287), Expect = 2e-24
 Identities = 59/96 (61%), Positives = 60/96 (62%), Gaps = 8/96 (8%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPP-PSRLPPP*LPPP--PPLEE*PPPPPLYPPPPSRLPP-PP 142
            PPP P PP PPPSPPP PPP P   PPP  PPP  PP    PP PP  PPPP+  PP PP
Sbjct: 1024 PPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPP 1083

Query: 141  P*LPPPPE*PPPPPLRYPPPPPPRWP----PPPPLP 46
            P  PPPP  PPP PL  PP PPP  P    PPPPLP
Sbjct: 1084 PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLP 1119

 Score =  114 bits (286), Expect = 3e-24
 Identities = 59/98 (60%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = -3

Query: 336  PKPN*RNYHPPPP-PLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            P PN     PPPP PLPP PP  PPP PPPP  LPPP LPPPP     PPP P   PPPS
Sbjct: 814  PPPNPPPPSPPPPLPLPP-PPSPPPPLPPPP--LPPPPLPPPPS----PPPSPPPSPPPS 866

Query: 159  RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              P PPP  PPPP  PPP P   PPP PP   PPPP P
Sbjct: 867  PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 904

 Score =  114 bits (286), Expect = 3e-24
 Identities = 59/98 (60%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = -3

Query: 336  PKPN*RNYHPPPP-PLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            P PN     PPPP PLPP PP  PPP PPPP  LPPP LPPPP     PPP P   PPPS
Sbjct: 992  PPPNPPPPSPPPPLPLPP-PPSPPPPLPPPP--LPPPPLPPPPS----PPPSPPPSPPPS 1044

Query: 159  RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              P PPP  PPPP  PPP P   PPP PP   PPPP P
Sbjct: 1045 PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 1082

 Score =  114 bits (286), Expect = 3e-24
 Identities = 59/98 (60%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = -3

Query: 336  PKPN*RNYHPPPP-PLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            P PN     PPPP PLPP PP  PPP PPPP  LPPP LPPPP     PPP P   PPPS
Sbjct: 1083 PPPNPPPPSPPPPLPLPP-PPSPPPPLPPPP--LPPPPLPPPPS----PPPSPPPSPPPS 1135

Query: 159  RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              P PPP  PPPP  PPP P   PPP PP   PPPP P
Sbjct: 1136 PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 1173

 Score =  114 bits (286), Expect = 3e-24
 Identities = 63/106 (59%), Positives = 64/106 (60%), Gaps = 18/106 (16%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPP-----PSRLPPP*LPPPP--PLEE*P---PPPPLYPPP-- 166
            PPPP  PP PPPSPPP PPP     PS LPPP  PPPP  PL   P   PPPP  PPP  
Sbjct: 1637 PPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNA 1696

Query: 165  --PSRLPP---PPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
              PS +PP   PPP LPPPP  PPP PP   PPPP P  PPPP  P
Sbjct: 1697 PSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPP 1742

 Score =  114 bits (285), Expect = 3e-24
 Identities = 59/100 (59%), Positives = 60/100 (60%), Gaps = 12/100 (12%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPP-----PSRLPPP*LPPPP--PLEE*PPPPPLYPPPPSRLP 151
            PPPP  PP PPPSPPP PPP     P   PPP  PPPP  P    PP PP  PPPP+  P
Sbjct: 751  PPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPP 810

Query: 150  P-PPP*LPPPPE*PPPPPLRYPPPPPPRWP----PPPPLP 46
            P PPP  PPPP  PPP PL  PP PPP  P    PPPPLP
Sbjct: 811  PAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLP 850

 Score =  114 bits (285), Expect = 3e-24
 Identities = 57/92 (61%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPP-PSRLPPP*LPPP--PPLEE*PPPPPLYPPPPSRLPP-PP 142
            PPP P PP PPPSPPP PPP P   PPP  PPP  PP    PP PP  PPPP+  PP PP
Sbjct: 846  PPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPP 905

Query: 141  P*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            P  PPPP  PPP PL  PP PPP  PPPP  P
Sbjct: 906  PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPP 937

 Score =  114 bits (285), Expect = 3e-24
 Identities = 58/94 (61%), Positives = 59/94 (62%), Gaps = 6/94 (6%)
 Frame = -3

Query: 309  PPPPPLPP*PPP-SPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP* 136
            PPP P PP PPP  PPP PPPP  LPPP  PPP P    PP PP  PPPP+  PP PPP 
Sbjct: 937  PPPVPPPPSPPPLPPPPLPPPP--LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 994

Query: 135  LPPPPE*PPPPPLRYPPPPPPRWP----PPPPLP 46
             PPPP  PPP PL  PP PPP  P    PPPPLP
Sbjct: 995  NPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLP 1028

 Score =  114 bits (284), Expect = 4e-24
 Identities = 58/100 (58%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
            P P   +  PPP P PP PPPSPPP P PP  LPPP +PP P     PPP P   PPPS 
Sbjct: 1539 PSPPPPSPSPPPSPPPPSPPPSPPP-PSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSP 1597

Query: 156  LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWP---PPPPLP 46
             P PPP LP PP   PPPPL  PP PPP  P   PPPPLP
Sbjct: 1598 PPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLP 1637

 Score =  113 bits (283), Expect = 6e-24
 Identities = 55/97 (56%), Positives = 57/97 (58%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPP P P  PPPSPPP P PP  LPPP LPPP P    PP PP  PPPP+ 
Sbjct: 688 PSPSPPPSPPPPSPPPSPPPPSPPP-PLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTP 746

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP PP   PPP  PP PP   PP PPP  PP PP P
Sbjct: 747 PPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPP 783

 Score =  113 bits (282), Expect = 7e-24
 Identities = 56/99 (56%), Positives = 59/99 (59%), Gaps = 1/99 (1%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            +P P+     PP PP  P PP  PPP PPPP+  P P   PPPP    P PPP  PPPPS
Sbjct: 854  SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 913

Query: 159  RLPPPPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
              PPPP  LPPPP  PPP PP   PPPP P  P PPPLP
Sbjct: 914  --PPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLP 950

 Score =  112 bits (281), Expect = 1e-23
 Identities = 53/89 (59%), Positives = 54/89 (60%), Gaps = 2/89 (2%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYP--PPPSRLPPPPP*L 133
           PPP  PP PPPSPPP PPPP+  PP   PP PP    P PPP  P  PPPS  P PPP  
Sbjct: 725 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPT 784

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPP  PPP P   PPP PP   PPPP P
Sbjct: 785 PPPPAPPPPTPPPSPPPSPPPPTPPPPAP 813

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/97 (57%), Positives = 56/97 (57%), Gaps = 9/97 (9%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPP--------PLYPPPPSRL 154
            PPPP  PP PPPSPPP  PPP   PPP  PPP P    PPPP        P  PPPP   
Sbjct: 1150 PPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPP 1209

Query: 153  PPPPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
            PP PP LPPPP  PPP PP   PPP PP  PPP P P
Sbjct: 1210 PPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 1246

 Score =  112 bits (281), Expect = 1e-23
 Identities = 54/88 (61%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PPPP PP P PSPPP PPPPS  P P  P PPP    PP PP   PPPS  P PPP  PP
Sbjct: 1536 PPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPP 1595

Query: 126  PPE*PPPPPLRYPPPPPPRWP-PPPPLP 46
             P   PPPPL  PPPP P  P PPPP+P
Sbjct: 1596 SPPPSPPPPLPLPPPPSPPPPLPPPPVP 1623

 Score =  112 bits (280), Expect = 1e-23
 Identities = 57/96 (59%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -3

Query: 309  PPPPPLPP*PPP--SPPPYPPPPSRLPPP*LP------PPPPLEE*PPPPPLYPPPPSRL 154
            PPP P PP PPP   PPP PPPPS  PPP LP      PPPPL   P PPP  PPPPS  
Sbjct: 799  PPPSPPPPTPPPPAPPPPNPPPPS--PPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPP 856

Query: 153  PPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            P PPP  PP P   PPPP   PP PPP  PPP P P
Sbjct: 857  PSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP 892

 Score =  112 bits (280), Expect = 1e-23
 Identities = 55/88 (62%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PPPPLPP PP  PPP PPPPS  PPP  PP PP    P PPP  PPPP+  PP PP  PP
Sbjct: 835  PPPPLPP-PPLPPPPLPPPPS--PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 891

Query: 126  PPE*PPPPPLRYPPPP-PPRWPPPPPLP 46
            P   PP PP   PPPP PP   PPPPLP
Sbjct: 892  PSPPPPTPPPPAPPPPNPPPPSPPPPLP 919

 Score =  112 bits (280), Expect = 1e-23
 Identities = 59/99 (59%), Positives = 59/99 (59%), Gaps = 12/99 (12%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPP------PPPLEE*PPPPPLYPPPPSRLPPP 145
            PPP  PP PPPSPPP  PPP   PPP  PP      PPP    P PPP  PPPPS  PPP
Sbjct: 859  PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS--PPP 916

Query: 144  PP*LPPPPE*PPP---PPLRYPPPPPPRWP---PPPPLP 46
            P  LPPPP  PPP   PPL  PP PPP  P   PPPPLP
Sbjct: 917  PLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLP 955

 Score =  112 bits (280), Expect = 1e-23
 Identities = 57/96 (59%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -3

Query: 309  PPPPPLPP*PPP--SPPPYPPPPSRLPPP*LP------PPPPLEE*PPPPPLYPPPPSRL 154
            PPP P PP PPP   PPP PPPPS  PPP LP      PPPPL   P PPP  PPPPS  
Sbjct: 977  PPPSPPPPTPPPPAPPPPNPPPPS--PPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPP 1034

Query: 153  PPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            P PPP  PP P   PPPP   PP PPP  PPP P P
Sbjct: 1035 PSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP 1070

 Score =  112 bits (280), Expect = 1e-23
 Identities = 55/88 (62%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PPPPLPP PP  PPP PPPPS  PPP  PP PP    P PPP  PPPP+  PP PP  PP
Sbjct: 1013 PPPPLPP-PPLPPPPLPPPPS--PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 1069

Query: 126  PPE*PPPPPLRYPPPP-PPRWPPPPPLP 46
            P   PP PP   PPPP PP   PPPPLP
Sbjct: 1070 PSPPPPTPPPPAPPPPNPPPPSPPPPLP 1097

 Score =  112 bits (280), Expect = 1e-23
 Identities = 57/96 (59%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -3

Query: 309  PPPPPLPP*PPP--SPPPYPPPPSRLPPP*LP------PPPPLEE*PPPPPLYPPPPSRL 154
            PPP P PP PPP   PPP PPPPS  PPP LP      PPPPL   P PPP  PPPPS  
Sbjct: 1068 PPPSPPPPTPPPPAPPPPNPPPPS--PPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPP 1125

Query: 153  PPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            P PPP  PP P   PPPP   PP PPP  PPP P P
Sbjct: 1126 PSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP 1161

 Score =  112 bits (280), Expect = 1e-23
 Identities = 55/88 (62%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PPPPLPP PP  PPP PPPPS  PPP  PP PP    P PPP  PPPP+  PP PP  PP
Sbjct: 1104 PPPPLPP-PPLPPPPLPPPPS--PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 1160

Query: 126  PPE*PPPPPLRYPPPP-PPRWPPPPPLP 46
            P   PP PP   PPPP PP   PPPPLP
Sbjct: 1161 PSPPPPTPPPPAPPPPNPPPPSPPPPLP 1188

 Score =  112 bits (280), Expect = 1e-23
 Identities = 59/104 (56%), Positives = 60/104 (57%), Gaps = 7/104 (6%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPP----PYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPP 169
            P P+     PPP P P  PPPSPP    P P PPS LPPP  PPP P    PP PP  PP
Sbjct: 1544 PSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPP-SPPPSPPPSPPPSPPPSPP 1602

Query: 168  PPSRLPP---PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP  LPP   PPP LPPPP  PPP P   PPPP P  P PPP P
Sbjct: 1603 PPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSP 1646

 Score =  112 bits (279), Expect = 2e-23
 Identities = 56/91 (61%), Positives = 57/91 (62%), Gaps = 4/91 (4%)
 Frame = -3

Query: 306  PPPPLP-P*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
            PPPP P P PPPSPPP  PPP   PPP  PPP P    P PPP  PPPP   PP PPP +
Sbjct: 881  PPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPV 940

Query: 132  PPPPE*P--PPPPLRYPPPPPPRWPPPPPLP 46
            PPPP  P  PPPPL  PP PPP  PPP P P
Sbjct: 941  PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP 971

 Score =  112 bits (279), Expect = 2e-23
 Identities = 59/94 (62%), Positives = 59/94 (62%), Gaps = 7/94 (7%)
 Frame = -3

Query: 306  PPPPLPP*P---PPSPPPYPPP-PSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP 139
            PPPPLPP P   PPSPPP PPP P   PPP   PPPP    P PPP  PPPPS  PPPP 
Sbjct: 950  PPPPLPPPPLPPPPSPPPSPPPSPPPSPPP--SPPPPTPPPPAPPPPNPPPPS--PPPPL 1005

Query: 138  *LPPPPE*P---PPPPLRYPPPPPPRWPPPPPLP 46
             LPPPP  P   PPPPL  PP PPP  PPP P P
Sbjct: 1006 PLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 1039

 Score =  112 bits (279), Expect = 2e-23
 Identities = 58/100 (58%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPP---PPPLEE*PPPPPLYPPP 166
            P P   N  PP PP P  PPPSPPP P PP  LPPP +PP   PPPL   P PPP  PPP
Sbjct: 1171 PAPPPPNPPPPSPPPPLPPPPSPPP-PLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPP 1229

Query: 165  PSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PS  P PPP   PPP  PP PP   PPP PP   PPPP P
Sbjct: 1230 PSPPPSPPP--SPPPSPPPSPPPSPPPPTPPPPAPPPPTP 1267

 Score =  111 bits (278), Expect = 2e-23
 Identities = 58/99 (58%), Positives = 59/99 (59%), Gaps = 11/99 (11%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPP-PSRLPPP*LPP-PPPLEE*PPPPPLYPPPPSRLPPPPP* 136
            PPP P PP PPP+PPP PPP P   PPP  PP PPP    PP PP   PPPS  P PPP 
Sbjct: 747  PPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPP 806

Query: 135  LPPPPE*P--------PPPPLRYPPPPPPRWP-PPPPLP 46
             PPPP  P        PPPPL  PPPP P  P PPPPLP
Sbjct: 807  TPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLP 845

 Score =  111 bits (278), Expect = 2e-23
 Identities = 56/101 (55%), Positives = 59/101 (58%), Gaps = 3/101 (2%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            +P P+     PP PP  P PP  PPP PPPP+  P P   PPPP    P PPP  PPPPS
Sbjct: 763  SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPS 822

Query: 159  RLPPPPP*LPPPPE*P---PPPPLRYPPPPPPRWPPPPPLP 46
              PPPP  LPPPP  P   PPPPL  PP PPP  PPP P P
Sbjct: 823  --PPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 861

 Score =  111 bits (278), Expect = 2e-23
 Identities = 56/101 (55%), Positives = 59/101 (58%), Gaps = 3/101 (2%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            +P P+     PP PP  P PP  PPP PPPP+  P P   PPPP    P PPP  PPPPS
Sbjct: 1032 SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 1091

Query: 159  RLPPPPP*LPPPPE*P---PPPPLRYPPPPPPRWPPPPPLP 46
              PPPP  LPPPP  P   PPPPL  PP PPP  PPP P P
Sbjct: 1092 --PPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 1130

 Score =  111 bits (278), Expect = 2e-23
 Identities = 56/100 (56%), Positives = 59/100 (59%), Gaps = 2/100 (2%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            +P P+     PP PP  P PP  PPP PPPP+  P P   PPPP    P PPP  PPPPS
Sbjct: 1123 SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 1182

Query: 159  RLPP-PPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
              PP PPP  PPPP  PPP PP   PPPP P   PPPPLP
Sbjct: 1183 PPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLP 1222

 Score =  111 bits (277), Expect = 3e-23
 Identities = 58/103 (56%), Positives = 61/103 (59%), Gaps = 5/103 (4%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLP-PP*LPPPPPLEE*PPPPPLYPPPP 163
            +P P+     PP PP P  PPP+PPP  PPPS  P PP   PPPP    P PPP  PPPP
Sbjct: 767  SPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPP 826

Query: 162  SRLPP---PPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
              LPP   PPP LPPPP  PPP PP   PPP PP  PPP P P
Sbjct: 827  LPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 869

 Score =  111 bits (277), Expect = 3e-23
 Identities = 61/97 (62%), Positives = 61/97 (62%), Gaps = 10/97 (10%)
 Frame = -3

Query: 306  PPPPLPP---*PPPSPPPYPPP-PSRLPPP*LPPP-PPLEE*PPPPPLYPPPPSRLPP-P 145
            PPPPLPP    PPPSPPP PPP P   PPP  PPP PP    PPP P   PPPS  PP P
Sbjct: 840  PPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTP 899

Query: 144  PP*LPPPPE*P---PPPPLRYPPPPPPRWP-PPPPLP 46
            PP  PPPP  P   PPPPL  PPPP P  P PPPPLP
Sbjct: 900  PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLP 936

 Score =  111 bits (277), Expect = 3e-23
 Identities = 56/94 (59%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP------ 148
            P PPPLPP PP  PPP PPPPS  PPP  PP PP    P PPP  PPPP+  PP      
Sbjct: 944  PSPPPLPP-PPLPPPPLPPPPS--PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPS 1000

Query: 147  PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP LP PP   PPPPL  PP PPP  PPPP  P
Sbjct: 1001 PPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPP 1034

 Score =  111 bits (277), Expect = 3e-23
 Identities = 58/103 (56%), Positives = 61/103 (59%), Gaps = 5/103 (4%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLP-PP*LPPPPPLEE*PPPPPLYPPPP 163
            +P P+     PP PP P  PPP+PPP  PPPS  P PP   PPPP    P PPP  PPPP
Sbjct: 1036 SPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPP 1095

Query: 162  SRLPP---PPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
              LPP   PPP LPPPP  PPP PP   PPP PP  PPP P P
Sbjct: 1096 LPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 1138

 Score =  110 bits (276), Expect = 4e-23
 Identities = 61/105 (58%), Positives = 61/105 (58%), Gaps = 18/105 (17%)
 Frame = -3

Query: 306  PPPPLPP*P---PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPP-PSRLPPPPP 139
            PPPPLPP P   PPSPPP PPPP  LPPP  PPP P    PP PP  PPP PS LPPPP 
Sbjct: 1613 PPPPLPPPPVPPPPSPPPLPPPP--LPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPT 1670

Query: 138  *LPPPPE*P-PPPPLRYPPPP-------------PPRWPPPPPLP 46
              PPPP  P P PPL  PPPP             PP   PPPPLP
Sbjct: 1671 --PPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLP 1713

 Score =  110 bits (275), Expect = 5e-23
 Identities = 56/102 (54%), Positives = 59/102 (57%), Gaps = 4/102 (3%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPP 166
           +P P+     PPP P PP PPP   PPP PPPP  LPPP  PP PP    P PPP  PPP
Sbjct: 691 SPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPP--LPPPSPPPSPPPSPPPSPPPPTPPP 748

Query: 165 PSRLPPPPP*LPP--PPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P+  PP PP  PP  PP  PPP P   PPP PP   PPPP P
Sbjct: 749 PAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAP 790

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/99 (55%), Positives = 58/99 (58%), Gaps = 1/99 (1%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            +P P+     PPP P PP PPP  PP  PPPS  PPP  PP PP    P PPP  PPPP+
Sbjct: 732  SPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPS--PPPSPPPSPPPSPPPSPPPPTPPPPA 789

Query: 159  RLPPPPP*LPPPPE*PPPPPLRYPPPP-PPRWPPPPPLP 46
              PP PP  PPP   PP PP   PPPP PP   PPPPLP
Sbjct: 790  PPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLP 828

 Score =  110 bits (274), Expect = 6e-23
 Identities = 58/107 (54%), Positives = 60/107 (56%), Gaps = 9/107 (8%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPP 166
            +P P+     PPP P PP PPP   PPP PPPP  LPPP  PPPP      PPPPL PPP
Sbjct: 972  SPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPP 1031

Query: 165  ------PSRLPPPPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
                  P   PP PP  PPPP  PPP PP   PPP PP  PPPP  P
Sbjct: 1032 SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPP 1078

 Score =  109 bits (273), Expect = 8e-23
 Identities = 58/106 (54%), Positives = 59/106 (55%), Gaps = 9/106 (8%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPP- 166
            P P+     PPP P PP PPP   PPP PPPP  LPPP  PPPP      PPPPL PPP 
Sbjct: 795  PPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 854

Query: 165  -----PSRLPPPPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
                 P   PP PP  PPPP  PPP PP   PPP PP  PPPP  P
Sbjct: 855  PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPP 900

 Score =  109 bits (273), Expect = 8e-23
 Identities = 58/106 (54%), Positives = 59/106 (55%), Gaps = 9/106 (8%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPP- 166
            P P+     PPP P PP PPP   PPP PPPP  LPPP  PPPP      PPPPL PPP 
Sbjct: 1064 PPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 1123

Query: 165  -----PSRLPPPPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
                 P   PP PP  PPPP  PPP PP   PPP PP  PPPP  P
Sbjct: 1124 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPP 1169

 Score =  109 bits (272), Expect = 1e-22
 Identities = 60/103 (58%), Positives = 61/103 (59%), Gaps = 6/103 (5%)
 Frame = -3

Query: 336  PKPN*RNYHPPPP---PLPP*PPPSPPPYPPPPSRLPPP*LPPPP-PLEE*PPPPPLYPP 169
            P P+     PPPP   P P  PPPSPPP PPPPS  PPP LPPPP P    PPP P   P
Sbjct: 1532 PSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPS--PPPPLPPPPVPPSPLPPPSPPPSP 1589

Query: 168  PPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPP--PPPLP 46
            PPS  P PPP  PPP   PPPP    P PPPP  PP  PPPLP
Sbjct: 1590 PPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLP 1632

 Score =  108 bits (270), Expect = 2e-22
 Identities = 58/94 (61%), Positives = 58/94 (61%), Gaps = 7/94 (7%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPP---YPPPPSRLPPP*LPP---PPPLEE*PPPPPLYPPPPSRLPPP 145
            PPP  PP PPPSPPP    PPPPS  PPP LPP   PPP    P PPP  PPPPS  P P
Sbjct: 1589 PPPSPPPSPPPSPPPPLPLPPPPS--PPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSP 1646

Query: 144  PP*LPP-PPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP  PP PP  PPP P   PPPP P  PP PPLP
Sbjct: 1647 PPSPPPSPPPSPPPSPSPLPPPPTPP-PPSPPLP 1679

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/92 (59%), Positives = 55/92 (59%), Gaps = 4/92 (4%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP---PPP 139
            PPPP  PP  PP P P P PP   PPP   PPPP    P PPP  PPPP  LPP   PPP
Sbjct: 871  PPPPTPPPPAPPPPAPPPSPPPSPPPP--TPPPPAPPPPNPPPPSPPPPLPLPPPPSPPP 928

Query: 138  *LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
             LPPPP  PPP PP   PPP PP   PPPPLP
Sbjct: 929  PLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLP 960

 Score =  106 bits (265), Expect = 7e-22
 Identities = 56/97 (57%), Positives = 56/97 (57%), Gaps = 11/97 (11%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPP----LYPPPPSRLP-PP 145
            PPP P PP PPPSPPP PPPPS  PP   P PPP    P PPP      PPPPS  P PP
Sbjct: 1737 PPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPP 1796

Query: 144  PP*L---PPPPE---*PPPPPLRYPPPPPPRWPPPPP 52
            PP L   PPPP     PPPPP    PPPP   P PPP
Sbjct: 1797 PPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPP 1833

 Score =  106 bits (264), Expect = 9e-22
 Identities = 58/103 (56%), Positives = 61/103 (59%), Gaps = 5/103 (4%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PP-PSPP-PYPPPPSRLPPP*LPPP---PPLEE*PPPPPLY 175
            +P P+     PPP P PP PP PSPP P PPPPS  PPP  P P   PP +   PPPPL 
Sbjct: 1657 SPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSP-PPPNAPSPSSMPPSQS--PPPPLP 1713

Query: 174  PPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPP    P PPP LPPPP  P PPP   PPP PP  PPP P P
Sbjct: 1714 PPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPP 1756

 Score =  106 bits (264), Expect = 9e-22
 Identities = 55/91 (60%), Positives = 57/91 (62%), Gaps = 4/91 (4%)
 Frame = -3

Query: 306  PPPPLP---P*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP* 136
            PPP LP   P PPP  PP PP P  LPPP +PPPP     PP PP  PPPP+  P PPP 
Sbjct: 2093 PPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTP---PPSPPPLPPPPTPPPSPPP- 2148

Query: 135  LPPPPE*PP-PPPLRYPPPPPPRWPPPPPLP 46
            LPPPP  PP  PPL  PPPP P  P PPPLP
Sbjct: 2149 LPPPPTPPPQSPPLPSPPPPSP--PTPPPLP 2177

 Score =  105 bits (262), Expect = 2e-21
 Identities = 60/116 (51%), Positives = 61/116 (52%), Gaps = 20/116 (17%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*------PPPSPPPYPPPPSRLP---PP*L---PPPPPLEE*P 193
           P P   +  P PPP PP       PPPS  P PPPPS  P   PP L   PPPP     P
Sbjct: 300 PSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSP 359

Query: 192 PPPPLYPPPPSRLPPP-------PP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPL 49
           PPP L P PP   PPP       PP LPPPP  PPP PP   PPPP P  PPPPPL
Sbjct: 360 PPPSLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPLPPPPIPPPPSPPPPPPPPL 415

 Score =  104 bits (259), Expect = 3e-21
 Identities = 59/118 (50%), Positives = 61/118 (51%), Gaps = 20/118 (16%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPP-----SPPPYPPPPSRLPPP---------*LPPPPPLE 202
           +P P   +  PPPP L P PPP     SPPP PPPPS  P P           PPPP L 
Sbjct: 270 SPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLS 329

Query: 201 E*PPPPPL--YPPPPSRLPPPPP----*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPP L   PPPPS  P PPP      PPPP   P PP   PPP PP   PPPPLP
Sbjct: 330 PSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLP 387

 Score =  103 bits (257), Expect = 6e-21
 Identities = 55/95 (57%), Positives = 56/95 (58%), Gaps = 8/95 (8%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPP------PYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPP 145
            P PPLP  PPPSPP      P   PPS+ PPP L PPPPL   P PPP  PPPPS   PP
Sbjct: 1679 PSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPL-PPPPLPPPPNPPPPLPPPPSPPSPP 1737

Query: 144  PP*LPPPPE*PPPPPLRYPP--PPPPRWPPPPPLP 46
            PP  PPPP  PP PP   PP  PPPP   P PP P
Sbjct: 1738 PP-SPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPP 1771

 Score =  103 bits (257), Expect = 6e-21
 Identities = 57/106 (53%), Positives = 57/106 (53%), Gaps = 11/106 (10%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSR--LPPP*LPPPPPLEE*PPPPPL--YPP 169
            P PN     PPPP  P  PPPSPPP  PPPS    PPP  PPPP L   PPPP     PP
Sbjct: 1719 PPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPP 1778

Query: 168  PPSRLPPPPP----*LPPPPE---*PPPPPLRYPPPPPPRWPPPPP 52
            PPS  P PPP      PPPP     PPPP     PPPPP  P PPP
Sbjct: 1779 PPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPP 1824

 Score =  103 bits (256), Expect = 8e-21
 Identities = 53/89 (59%), Positives = 53/89 (59%), Gaps = 2/89 (2%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PPPPLPP PP  PPP PPPP  LPPP  PP PP    PP PP   PPPS  P PPP  PP
Sbjct: 1708 PPPPLPP-PPLPPPPNPPPP--LPPPPSPPSPP----PPSPPPPSPPPSPPPSPPPPSPP 1760

Query: 126  PP--E*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP     PPPP   P PPPP   P PP P
Sbjct: 1761 PPSLSPSPPPPSTSPSPPPPSASPSPPPP 1789

 Score =  102 bits (254), Expect = 1e-20
 Identities = 51/94 (54%), Positives = 53/94 (56%), Gaps = 8/94 (8%)
 Frame = -3

Query: 306  PPPPLPP*P----PPSPPPYPPPPSRLPPP*LP----PPPPLEE*PPPPPLYPPPPSRLP 151
            PPPP PP P    P  PPP PPPP+   P  +P    PPPPL   P PPP  PPPP   P
Sbjct: 1671 PPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPP 1730

Query: 150  PPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPL 49
            P PP  PPP   PP PP   PP PPP  PPPP L
Sbjct: 1731 PSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSL 1764

 Score =  102 bits (253), Expect = 2e-20
 Identities = 53/92 (57%), Positives = 53/92 (57%), Gaps = 5/92 (5%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PPPPLPP PP  PPP PPPPS   PP  PP PP    PP PP  PPPPS   PPPP L P
Sbjct: 1713 PPPPLPP-PPNPPPPLPPPPSPPSPP--PPSPPPPSPPPSPPPSPPPPS---PPPPSLSP 1766

Query: 126  PPE*P-----PPPPLRYPPPPPPRWPPPPPLP 46
             P  P     PPPP   P PPPP   P PP P
Sbjct: 1767 SPPPPSTSPSPPPPSASPSPPPPSASPSPPPP 1798

 Score =  101 bits (252), Expect = 2e-20
 Identities = 55/99 (55%), Positives = 55/99 (55%), Gaps = 11/99 (11%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLP--PP*LPPPPPLEE*PPPPPL--YPPPPSRLPPPP 142
            PPP P PP PPP  PP PPPPS  P  PP  PPP P    PPPP L   PPPPS  P PP
Sbjct: 1719 PPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPP 1778

Query: 141  P----*LPPPPE---*PPPPPLRYPPPPPPRWPPPPPLP 46
            P      PPPP     PPPP L   PPPP   P PPP P
Sbjct: 1779 PPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPP 1817

 Score =  101 bits (251), Expect = 3e-20
 Identities = 59/112 (52%), Positives = 59/112 (52%), Gaps = 24/112 (21%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPY----PPPPSRLP---PP*L---PPPPPLEE*PPPPPLYP--PP 166
           PPPP   P PPP PPP     PPPPS  P   PP L   PPPP L   PPPP   P  PP
Sbjct: 302 PPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPP 361

Query: 165 PSRLPPPPP*LPPP----PE*P--------PPPPLRYPPPPPPRWPPPPPLP 46
           PS  P PPP  PPP    P  P        PPPPL  PP PPP  PPPPP P
Sbjct: 362 PSLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPLPPPPIPPPPSPPPPPPP 413

 Score =  101 bits (251), Expect = 3e-20
 Identities = 52/95 (54%), Positives = 54/95 (56%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
            P PN  +    PP   P PP  PPP PPPP+  PPP LPPPP     P PPP  PPPPS 
Sbjct: 1692 PPPNAPSPSSMPPSQSPPPPLPPPPLPPPPN--PPPPLPPPP---SPPSPPPPSPPPPSP 1746

Query: 156  LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
             P PPP   PPP  PPPP L   PPPP   P PPP
Sbjct: 1747 PPSPPP--SPPPPSPPPPSLSPSPPPPSTSPSPPP 1779

 Score =  100 bits (248), Expect = 7e-20
 Identities = 56/106 (52%), Positives = 59/106 (55%), Gaps = 8/106 (7%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRL--PPP*L---PPPPPLEE*PPPPPLY 175
           +P P   +  PPP P PP   PSPPP PPP +    PPP L   PPPP L   PPPP L 
Sbjct: 288 SPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLS 347

Query: 174 P--PPPSRLP-PPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P  PPPS  P PPPP L P P    PPP   PP PPP  PPPP  P
Sbjct: 348 PSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPSPP 393

 Score =  100 bits (248), Expect = 7e-20
 Identities = 56/103 (54%), Positives = 56/103 (54%), Gaps = 15/103 (14%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPP-PYPPPPSRLPPP*LP-----PPPPLEE*PPPPPL---YPPPPSR 157
            PPPP  PP PPPSPP P PPPPS  P P  P     PPPP     PPPP     PPPPS 
Sbjct: 1741 PPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSL 1800

Query: 156  LPPPPP*L-----PPPPE*P-PPPPLRYPPPPPPRWPPPPPLP 46
             P PPP       PPPP  P PPPP   P PPPP   P PP P
Sbjct: 1801 SPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPP 1843

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 48/86 (55%), Positives = 48/86 (55%)
 Frame = -3

Query: 303 PPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPP 124
           P P PP PP  PPP P PP   PPP  PP PP    PPP P  P PP  LPPP P   PP
Sbjct: 676 PSPSPP-PPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPP 734

Query: 123 PE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P  PP PP   PPPP P  P PPP P
Sbjct: 735 PSPPPSPPPPTPPPPAPPPPAPPPAP 760

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 56/111 (50%), Positives = 58/111 (52%), Gaps = 13/111 (11%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPP-SPPPYPPPPSRLPPP------*LPPPPPLEE*PPPPP 181
           +P P   +  PPPP L P PPP S  P PPPPS  P P        PPPP L   PPPP 
Sbjct: 225 SPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPS 284

Query: 180 LYP-PPPSRLPPPPP*LPPPPE*PPPPPLRYPP-----PPPPRWPPPPPLP 46
           L P PPP  L P PP  PPPP   P PP R PP     PPPP   P PP P
Sbjct: 285 LSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPP 335

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 54/106 (50%), Positives = 55/106 (51%), Gaps = 9/106 (8%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LP-----PPPPLEE*PPPPPL-- 178
            P P+     PPP   P  PPPS  P PPPPS  P P  P     PPPP     PPPP   
Sbjct: 1778 PPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSS 1837

Query: 177  -YPPPPSRLP-PPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              PPPPS  P PPPP L P P  PP PP   PPPP P  PP PP P
Sbjct: 1838 PSPPPPSSSPSPPPPSLSPSP--PPSPPPSSPPPPSPPTPPAPPRP 1881

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/98 (54%), Positives = 53/98 (54%), Gaps = 10/98 (10%)
 Frame = -3

Query: 309  PPPPPLPP*PPPS--PPPYP--PPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPP 142
            PPP P PP PPP   PPP P  PPP   PPP  PP PP    P PPP  PPPPS  P PP
Sbjct: 1714 PPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPP----PSPPPPSPPPPSLSPSPP 1769

Query: 141  P----*LPPPP--E*PPPPPLRYPPPPPPRWPPPPPLP 46
            P      PPPP     PPPP   P PPPP   P PP P
Sbjct: 1770 PPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPP 1807

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 50/92 (54%), Positives = 52/92 (56%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
            P P       PPPP PP PPP PPP P P   LPPP +PP       PP PP +PPP S 
Sbjct: 2155 PPPQSPPLPSPPPPSPPTPPPLPPPSPSP---LPPPPIPP-------PPSPPPHPPPQSP 2204

Query: 156  LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPP 61
            LPP PP  PP    PPPPPL  PP PPP  PP
Sbjct: 2205 LPPSPP--PP----PPPPPLPPPPSPPPSQPP 2230

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 54/103 (52%), Positives = 56/103 (54%), Gaps = 5/103 (4%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPP-SPPPYPPPPSRLP---PP*LPP-PPPLEE*PPPPPLY 175
           +P P   +  PPPP L P PPP S  P PPPPS  P   PP L P PPP    P PPP  
Sbjct: 243 SPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPS- 301

Query: 174 PPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPPPS  P PPP  PP     PPPP   P PPPP   P PP P
Sbjct: 302 PPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPP 344

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 57/113 (50%), Positives = 58/113 (51%), Gaps = 16/113 (14%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLP---PP*L---PPPPPLEE*PPPPPLY 175
            P P+     PPP   P  PPPS  P PPPPS  P   PP L   PPPP     PPPPP  
Sbjct: 1760 PPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPAS 1819

Query: 174  P--PPPSRLPPPPP----*LPPPPE---*PPPPPLR-YPPPPPPRWPPPPPLP 46
            P  PPPS  P PPP      PPPP     PPPP L   PPP PP   PPPP P
Sbjct: 1820 PSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPPPSP 1872

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/99 (52%), Positives = 54/99 (54%), Gaps = 10/99 (10%)
 Frame = -3

Query: 312 HPPPPPLPP*-PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPL--YPPPPSRLPPPP 142
           +PP  P PP  PPPS  P PPPPS  P    PPPP L   PPPP +   PPPPS  P PP
Sbjct: 207 YPPSLPSPPSLPPPSASPSPPPPSLSPS---PPPPSLSPSPPPPSISPSPPPPSLSPSPP 263

Query: 141 P----*LPPPPE---*PPPPPLRYPPPPPPRWPPPPPLP 46
           P      PPPP     PPPP L   PPPP   P PPP P
Sbjct: 264 PPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSP 302

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 50/88 (56%), Positives = 51/88 (57%), Gaps = 9/88 (10%)
 Frame = -3

Query: 282  PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYP----PPPSRLPPPPP*LPPPPE* 115
            PPPSPPP  P  S  PPP   P PPL   PP PP  P    PPP   PP PP LPPPP  
Sbjct: 2089 PPPSPPPSLPSSSPSPPP---PSPPL---PPSPPPLPPPPVPPPPTPPPSPPPLPPPPTP 2142

Query: 114  PP-PPPLRYPPPPPPRWP----PPPPLP 46
            PP PPPL  PP PPP+ P    PPPP P
Sbjct: 2143 PPSPPPLPPPPTPPPQSPPLPSPPPPSP 2170

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 46/81 (56%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPP-PSRLPPP*LPPPP-PLEE*PPPPPLYPPPP 163
            P P      PP P  PP  PP+PPP PPP PS LPPP +PPPP P    PP  PL P PP
Sbjct: 2151 PPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPP 2210

Query: 162  SRLPPPPP*LPPPPE*PPPPP 100
               PPPPP LPPPP  PP  P
Sbjct: 2211 P--PPPPPPLPPPPSPPPSQP 2229

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 48/82 (58%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPP-SPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
           +P P   +  PPPP L P PPP +PPP PPPPS  PPP LPPPP      PPPPL PPP 
Sbjct: 349 SPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPS--PPPPLPPPP-----SPPPPLPPPP- 400

Query: 162 SRLPPPPP*LPPPPE*PPPPPL 97
             +PPPP   PPP   PPPPPL
Sbjct: 401 --IPPPPS--PPP---PPPPPL 415

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/93 (53%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = -3

Query: 297 PLPP*PPPSP-PPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYP--PPPSRLP-PPPP*LP 130
           P PP PP  P PP  PPPS  P P   PPP L   PPPP L P  PPPS  P PPPP L 
Sbjct: 203 PSPPYPPSLPSPPSLPPPSASPSP---PPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLS 259

Query: 129 PPPE*P-----PPPPLRYPPPPPPRWPPPPPLP 46
           P P  P     PPPP   P PPPP   P PP P
Sbjct: 260 PSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPP 292

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 42/71 (59%), Positives = 43/71 (60%)
 Frame = -3

Query: 258  PPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPP 79
            PPPPS  PPP LP   P     PPPP  P PPS  P PPP +PPPP  PPP P   PPPP
Sbjct: 2088 PPPPS--PPPSLPSSSP----SPPPPSPPLPPSPPPLPPPPVPPPPT-PPPSPPPLPPPP 2140

Query: 78   PPRWPPPPPLP 46
             P  P PPPLP
Sbjct: 2141 TPP-PSPPPLP 2150

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/63 (63%), Positives = 42/63 (66%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PPPP+PP  PPSPPP+PPP S LPP   PPPP     PPPPPL PPPPS    PPP  PP
Sbjct: 2185 PPPPIPP--PPSPPPHPPPQSPLPPS--PPPP-----PPPPPL-PPPPS----PPPSQPP 2230

Query: 126  PPE 118
              E
Sbjct: 2231 SLE 2233

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 39/77 (50%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = -3

Query: 351 TFIGNPKPN*RNYHPPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPL 178
           +F  +P P   +  PPP   PP PPP   PPP PPPPS  PPP LPPPP           
Sbjct: 354 SFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPS--PPPPLPPPP----------- 400

Query: 177 YPPPPSRLPPPPP*LPP 127
            PPPPS  PPPPP L P
Sbjct: 401 IPPPPSPPPPPPPPLAP 417

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 30/56 (53%), Positives = 33/56 (58%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYP 172
            +P P+     PP PP  P PP  PPP PPPP+  PPP  PPP P    PPPPPL P
Sbjct: 1235 SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPT--PPPSPPPPTP----PPPPPLAP 1284

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/73 (46%), Positives = 36/73 (49%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            +P P   +  P PPP    P P PP   P P   PPP L P PP    P PPP  PPPPS
Sbjct: 1819 SPSPPPPSASPSPPPPSSSPSPPPPSSSPSP---PPPSLSPSPP----PSPPPSSPPPPS 1871

Query: 159  RLPPPPP*LPPPP 121
               PP P  PP P
Sbjct: 1872 ---PPTPPAPPRP 1881

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 35/83 (42%), Positives = 37/83 (44%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
            P P+     PPP   P  PPPS  P PPPPS  P P  P PPP    PP PP  P PP  
Sbjct: 1823 PPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSP-PPSPPPSSPPPPSPPTPPAPPRP 1881

Query: 156  LPPPPP*LPPPPE*PPPPPLRYP 88
                   +   P     PP RYP
Sbjct: 1882 FLVSLDIIATQPS-SSNPPERYP 1903

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 30/64 (46%), Positives = 31/64 (48%), Gaps = 4/64 (6%)
 Frame = -3

Query: 225 LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPP----E*PPPPPLRYPPPPPPRWPPP 58
           +P PP     P PP L PP  S  PPPP   P PP       PPPP   P PPPP   P 
Sbjct: 202 IPSPPYPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPS 261

Query: 57  PPLP 46
           PP P
Sbjct: 262 PPPP 265

[99][TOP]
>UniRef100_O24601 Glycine-rich RNA binding protein 1 n=1 Tax=Pelargonium x hortorum
           RepID=O24601_PELHO
          Length = 166

 Score =  120 bits (300), Expect = 6e-26
 Identities = 66/106 (62%), Positives = 69/106 (65%), Gaps = 2/106 (1%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHR-GGGGGGY-RSGGGGGYSGGGGSYGGGGGRREGGGG 175
           +LDGR+ITVNEAQSRGSGGGGG R GGGGGGY R  GGGGYS GG           GGGG
Sbjct: 73  NLDGRNITVNEAQSRGSGGGGGRREGGGGGGYGRREGGGGYSRGG-----------GGGG 121

Query: 176 YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           Y GGGGGY   GG GG YGGGR + G G  GG G  Y     GG W
Sbjct: 122 YGGGGGGYG--GGNGGGYGGGREQRGYGDSGG-GSRYSRDSDGGNW 164

[100][TOP]
>UniRef100_B7QAD8 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7QAD8_IXOSC
          Length = 164

 Score =  120 bits (300), Expect = 6e-26
 Identities = 59/86 (68%), Positives = 59/86 (68%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 232
           GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG  G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGGGGG 57

Query: 233 GGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG   GGGG GGG GGG GG GGGGG
Sbjct: 58  GGGGGGGGGGGGGGGGGGGGGGGGGG 83

 Score =  119 bits (298), Expect = 1e-25
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGG 56

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGG 307
            GGG   GGGG GGG GGG GG GGGG
Sbjct: 57  GGGGGGGGGGGGGGGGGGGGGGGGGGG 83

 Score =  115 bits (288), Expect = 2e-24
 Identities = 60/88 (68%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 5   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGG----GGGGGG 57

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 58  GGGG---GGGGGGGGGGGGGGGGGGGGG 82

 Score =  112 bits (280), Expect = 1e-23
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 8   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGG----GGGGGG 60

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGG G
Sbjct: 61  GGGG---GGGGGGGGGGGGGGGGGGGTG 85

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 25/38 (65%), Positives = 26/38 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRR 160
           G GGGGG  GGGGGG   GGGGG  GGGG  GG G +R
Sbjct: 51  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGTGPQR 88

[101][TOP]
>UniRef100_B7P9A9 HyFMR1 protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7P9A9_IXOSC
          Length = 506

 Score =  120 bits (300), Expect = 6e-26
 Identities = 61/100 (61%), Positives = 65/100 (65%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG 190
           G  + + +  + G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGG
Sbjct: 413 GNQLILWKLGATGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGG 469

Query: 191 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG    GGGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 470 GGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGGG 506

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 35/64 (54%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +2

Query: 122 GGGGSYGGGGGR-REGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 298
           GG  SY GG    R GGGG         + GGGGG   GG   GGGG GGG GGG GG G
Sbjct: 395 GGPPSYQGGFPLPRRGGGGNQLILWKLGATGGGGG---GG---GGGGGGGGGGGGGGGGG 448

Query: 299 GGGG 310
           GGGG
Sbjct: 449 GGGG 452

[102][TOP]
>UniRef100_B6KME4 RRM domain-containing protein n=1 Tax=Toxoplasma gondii ME49
           RepID=B6KME4_TOXGO
          Length = 513

 Score =  120 bits (300), Expect = 6e-26
 Identities = 61/96 (63%), Positives = 62/96 (64%), Gaps = 7/96 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           G GG GG   GGGGGY  GG  GGGY GG G YGGGG    GGGGY GG GGY   GGGG
Sbjct: 303 GGGGYGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGYGGGGYGGGNGGYG--GGGG 360

Query: 221 GSYGG-----GRREGGGGYGGGEGGGYGGSGGGGGW 313
           G YGG     G   GGGGYGGG G G GG GGGGG+
Sbjct: 361 GGYGGGGGGYGGYGGGGGYGGGGGFGSGGYGGGGGY 396

 Score =  114 bits (284), Expect = 4e-24
 Identities = 61/91 (67%), Positives = 61/91 (67%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGG-GGGGYRSGG-GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           G GG GGH    GGGGY  GG GGG  GGGG YGGGG    GGGGY GG GGY   GGG 
Sbjct: 286 GRGGYGGHGSPYGGGGYGGGGYGGGGYGGGGGYGGGG---YGGGGYGGGNGGYG--GGGN 340

Query: 221 GSYGGGRREGG-GGYGGGEGGGYGGSGGGGG 310
           G YGGG   GG GGYGGG GGGYGG GGG G
Sbjct: 341 GGYGGGGYGGGNGGYGGGGGGGYGGGGGGYG 371

 Score =  105 bits (261), Expect = 2e-21
 Identities = 53/82 (64%), Positives = 55/82 (67%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 232
           GG GG+ GGG GGY   GGGGY GG G YGGG     GGGGY GGGGGY   GGGGG YG
Sbjct: 330 GGNGGYGGGGNGGY---GGGGYGGGNGGYGGG-----GGGGYGGGGGGYGGYGGGGG-YG 380

Query: 233 GGRREGGGGYGGGEGGGYGGSG 298
           GG   G GGYGG  GGGY  +G
Sbjct: 381 GGGGFGSGGYGG--GGGYSPAG 400

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/88 (59%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G    G  RG G GG+R G G GGY G G  YGGGG    GGGGY  GGGGY    GGGG
Sbjct: 266 GGFNSGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGG---YGGGGY--GGGGY----GGGG 316

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGG 307
            YGGG   GGGGYGGG GG     GGGG
Sbjct: 317 GYGGGGY-GGGGYGGGNGG----YGGGG 339

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/67 (62%), Positives = 44/67 (65%), Gaps = 7/67 (10%)
 Frame = +2

Query: 47  GSGG-GGGHRGGGGGGYRSGGGGGYSGGGGSYGG--GGGRREGGGGYS----GGGGGYSS 205
           G+GG GGG  GGG GGY  GGGGGY GGGG YGG  GGG   GGGG+     GGGGGYS 
Sbjct: 339 GNGGYGGGGYGGGNGGYGGGGGGGYGGGGGGYGGYGGGGGYGGGGGFGSGGYGGGGGYSP 398

Query: 206 RGGGGGS 226
            G   GS
Sbjct: 399 AGPHHGS 405

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/87 (52%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGG 235
           G GG  G   GG+ SG   G   G G + GG GR    GGY G G  Y   G GGG YGG
Sbjct: 256 GRGGFDGFYHGGFNSGPMRG--PGRGGFRGGMGR----GGYGGHGSPYGGGGYGGGGYGG 309

Query: 236 GRREGGGGYGGG--EGGGYGGSGGGGG 310
           G   GGGGYGGG   GGGYGG  GG G
Sbjct: 310 GGYGGGGGYGGGGYGGGGYGGGNGGYG 336

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 39/77 (50%), Positives = 42/77 (54%), Gaps = 5/77 (6%)
 Frame = +2

Query: 95  RSGGGGGYSGG-GGSYGGGGGRREGGGGYSGG--GGGYSSRGGGGGSYGGGRREGGGGYG 265
           R  G GG+ G   G +  G  R  G GG+ GG   GGY   GG G  YGGG   GGG  G
Sbjct: 253 RPPGRGGFDGFYHGGFNSGPMRGPGRGGFRGGMGRGGY---GGHGSPYGGGGYGGGGYGG 309

Query: 266 G--GEGGGYGGSGGGGG 310
           G  G GGGYGG G GGG
Sbjct: 310 GGYGGGGGYGGGGYGGG 326

[103][TOP]
>UniRef100_A7EC48 Glycine-rich RNA-binding protein n=1 Tax=Sclerotinia sclerotiorum
           1980 UF-70 RepID=A7EC48_SCLS1
          Length = 193

 Score =  120 bits (300), Expect = 6e-26
 Identities = 66/116 (56%), Positives = 70/116 (60%), Gaps = 13/116 (11%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRG----SGGGGGHRGGG--GGGYRSGGGGGYSGGGGSYGGGGGRRE 163
           + DGR+I V++A  R     SGGGGG  GGG  GGGY   GGGGY GGGG YGGG G   
Sbjct: 73  EFDGRTIRVDKASERSGNDRSGGGGGGFGGGRGGGGYGGRGGGGYGGGGGGYGGGRGYDN 132

Query: 164 GGGGYSGGGGGYSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGG-----GGG 310
             GG   GGGGYS  GG  GGG Y GG   GGGGY GG GGGY   GG     GGG
Sbjct: 133 NSGGGYSGGGGYSGGGGYSGGGGYNGG---GGGGYSGGGGGGYSSGGGYDRGQGGG 185

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/97 (51%), Positives = 51/97 (52%), Gaps = 12/97 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGG-------GGGYRSGGG----GGYSGGGGSYGGGGGRREGGGGYS-GGG 190
           G GGGGG  GGG       GGGY  GGG    GGYSGGGG  GG      GGGGYS GGG
Sbjct: 116 GYGGGGGGYGGGRGYDNNSGGGYSGGGGYSGGGGYSGGGGYNGG------GGGGYSGGGG 169

Query: 191 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG 301
           GGYSS               GGGY  G+GGG  G  G
Sbjct: 170 GGYSS---------------GGGYDRGQGGGNAGQWG 191

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 34/64 (53%), Positives = 36/64 (56%), Gaps = 12/64 (18%)
 Frame = +2

Query: 158 REGGGGYSGGGGGY-SSRGGG--GGSYGGGRREGGGGYGGG------EGGGYGGSG---G 301
           R G     GGGGG+   RGGG  GG  GGG   GGGGYGGG       GGGY G G   G
Sbjct: 87  RSGNDRSGGGGGGFGGGRGGGGYGGRGGGGYGGGGGGYGGGRGYDNNSGGGYSGGGGYSG 146

Query: 302 GGGW 313
           GGG+
Sbjct: 147 GGGY 150

[104][TOP]
>UniRef100_A9B9L1 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. MIT 9211
           RepID=A9B9L1_PROM4
          Length = 245

 Score =  119 bits (299), Expect = 8e-26
 Identities = 68/125 (54%), Positives = 77/125 (61%), Gaps = 21/125 (16%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGG---GGHRGGG-GGGYRSGG----GGGYSGGGGSYGGGGGR 157
           +L GR + +N+A+ RG GGG   GG+ GGG GGGY  GG    GGGY GGGG  G GGG 
Sbjct: 66  ELMGRPLRINKAEPRGGGGGPRRGGYGGGGYGGGYGGGGQGGYGGGYGGGGGQGGYGGGG 125

Query: 158 REGG------GGYSGGGGGYSSRGGGGGSYGGGRREG--GGGYGGGEG-----GGYGGSG 298
            +GG      GGY GGGG     GGG G YGGG + G  GGGYGGG G     GGYGG G
Sbjct: 126 GQGGYGGGGQGGYGGGGGQGGYGGGGQGGYGGGGQGGYGGGGYGGGYGGGGGQGGYGGGG 185

Query: 299 GGGGW 313
           G GG+
Sbjct: 186 GQGGY 190

 Score =  102 bits (254), Expect = 1e-20
 Identities = 56/97 (57%), Positives = 59/97 (60%), Gaps = 8/97 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG-GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G GG GG+ GGGG GGY  GG GGY GGGG  G GGG   G GGY GGG G    GG GG
Sbjct: 114 GGGGQGGYGGGGGQGGYGGGGQGGYGGGGGQGGYGGG---GQGGYGGGGQGGYGGGGYGG 170

Query: 224 SYGGGRREGGGGYGGGEGGGYGG-------SGGGGGW 313
            YGGG  +GG G GGG+ GGYGG       S G  GW
Sbjct: 171 GYGGGGGQGGYGGGGGQ-GGYGGDQDPGQRSSGAKGW 206

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/89 (56%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGG-GSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           +G  GGGG  G GGG    GG GGY GGG G YGGGG    GGGGY GG GG    GGG 
Sbjct: 127 QGGYGGGGQGGYGGG----GGQGGYGGGGQGGYGGGGQGGYGGGGYGGGYGG----GGGQ 178

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G YGGG   G GGYGG +  G   SG  G
Sbjct: 179 GGYGGG--GGQGGYGGDQDPGQRSSGAKG 205

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 45/85 (52%), Positives = 49/85 (57%), Gaps = 2/85 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG--GGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           G GG GG+ GGG GGY  GG GGY GG  GG YGGGGG+    GGY GGGG    +GG G
Sbjct: 140 GGGGQGGYGGGGQGGYGGGGQGGYGGGGYGGGYGGGGGQ----GGYGGGGG----QGGYG 191

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGS 295
           G    G+R  G    G E   YG S
Sbjct: 192 GDQDPGQRSSGA--KGWEDRSYGSS 214

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 37/90 (41%), Positives = 42/90 (46%), Gaps = 4/90 (4%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGG----GYSSRG 211
           +G  GGGG+ GG GGG   GG GGY GGGG  GG GG ++ G   SG  G     Y S  
Sbjct: 160 QGGYGGGGYGGGYGGG---GGQGGYGGGGGQ-GGYGGDQDPGQRSSGAKGWEDRSYGSSD 215

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGG 301
                    RR  G      E   YGG+ G
Sbjct: 216 TSDRDENRSRRRRGAASETDETSDYGGAEG 245

[105][TOP]
>UniRef100_C0PEX7 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PEX7_MAIZE
          Length = 98

 Score =  119 bits (299), Expect = 8e-26
 Identities = 63/97 (64%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGG--GGSYGGGGGRREGGGG 175
           +LDGR+ITVN+AQSRG GGGGG  GGG      GGGGGY GG   G YGGGGG    GG 
Sbjct: 12  ELDGRNITVNQAQSRGGGGGGGGYGGG-----RGGGGGYGGGRRDGGYGGGGGY---GGR 63

Query: 176 YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
             GGGGGY    GGGG YGG R  GGGGYGGG GGG+
Sbjct: 64  REGGGGGY----GGGGGYGGRREGGGGGYGGGGGGGW 96

[106][TOP]
>UniRef100_B4FFJ9 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FFJ9_MAIZE
          Length = 234

 Score =  119 bits (299), Expect = 8e-26
 Identities = 63/97 (64%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGG--GGSYGGGGGRREGGGG 175
           +LDGR+ITVN+AQSRG GGGGG  GGG      GGGGGY GG   G YGGGGG    GG 
Sbjct: 148 ELDGRNITVNQAQSRGGGGGGGGYGGG-----RGGGGGYGGGRRDGGYGGGGGY---GGR 199

Query: 176 YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
             GGGGGY    GGGG YGG R  GGGGYGGG GGG+
Sbjct: 200 REGGGGGY----GGGGGYGGRREGGGGGYGGGGGGGW 232

[107][TOP]
>UniRef100_UPI00016C4BFC hypothetical protein GobsU_21505 n=1 Tax=Gemmata obscuriglobus UQM
           2246 RepID=UPI00016C4BFC
          Length = 121

 Score =  119 bits (298), Expect = 1e-25
 Identities = 59/89 (66%), Positives = 60/89 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GG  G  GGGG  G GGG R GGGG  GG GG  S GGGGG 
Sbjct: 27  GGGGGGGELGGGGGGGGGGGAWGGRGGGGGGGEGGGGRGGGGGRGGGAGGGGSHGGGGG- 85

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
            GGGR   GGG GGG+GGG GG GGGGGW
Sbjct: 86  -GGGR---GGGGGGGDGGGVGGRGGGGGW 110

 Score =  116 bits (291), Expect = 7e-25
 Identities = 61/92 (66%), Positives = 64/92 (69%), Gaps = 3/92 (3%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           RG GGGGG  GGGGGG   GGGG  +GGGG  GGGGG   GGGG  GGGG +  RGGGGG
Sbjct: 2   RGGGGGGGGGGGGGGG---GGGGWGTGGGG--GGGGGELGGGGGGGGGGGAWGGRGGGGG 56

Query: 224 S-YGGGRREGGGGYGGGEGGG--YGGSGGGGG 310
              GGG R GGGG GGG GGG  +GG GGGGG
Sbjct: 57  GGEGGGGRGGGGGRGGGAGGGGSHGGGGGGGG 88

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 47/72 (65%), Positives = 50/72 (69%), Gaps = 2/72 (2%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGR--REGGGGYSGGGGGYSSRGGG 217
           RG GGGGG  GGG GG   GG GG +GGGGS+GGGGG   R GGGG  G GGG   RGGG
Sbjct: 51  RGGGGGGGEGGGGRGG--GGGRGGGAGGGGSHGGGGGGGGRGGGGG-GGDGGGVGGRGGG 107

Query: 218 GGSYGGGRREGG 253
           GG +GGG  EGG
Sbjct: 108 GG-WGGGGGEGG 118

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 35/53 (66%), Positives = 36/53 (67%), Gaps = 1/53 (1%)
 Frame = +2

Query: 158 REGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGE-GGGYGGSGGGGGW 313
           R GGGG  GGGGG    GGGGG +G G   GGGG GGGE GGG GG GGGG W
Sbjct: 2   RGGGGGGGGGGGG---GGGGGGGWGTG---GGGGGGGGELGGGGGGGGGGGAW 48

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 32/53 (60%), Positives = 33/53 (62%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG 169
           GR        S G GGGGG RGGGGGG   GGG G  GGGG +GGGGG  EGG
Sbjct: 69  GRGGGAGGGGSHGGGGGGGGRGGGGGG-GDGGGVGGRGGGGGWGGGGG--EGG 118

[108][TOP]
>UniRef100_Q8VX74 Glycine-rich RNA-binding protein n=1 Tax=Ricinus communis
           RepID=Q8VX74_RICCO
          Length = 165

 Score =  119 bits (298), Expect = 1e-25
 Identities = 68/107 (63%), Positives = 72/107 (67%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQSRG G      GGGGGGYR+GGGGGY GGG   GG G    GGGGYS
Sbjct: 73  NLDGRNITVNEAQSRGGG------GGGGGGYRNGGGGGY-GGGRREGGYG----GGGGYS 121

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG---GGW 313
            GGGGY   GGGGG YGGGR  G G  GGG+GG     GGG   G W
Sbjct: 122 RGGGGY---GGGGGGYGGGRDRGYG--GGGDGGSRYSRGGGASEGNW 163

[109][TOP]
>UniRef100_P17816 Glycine-rich cell wall structural protein n=1 Tax=Hordeum vulgare
           RepID=GRP1_HORVU
          Length = 200

 Score =  119 bits (298), Expect = 1e-25
 Identities = 65/102 (63%), Positives = 66/102 (64%), Gaps = 14/102 (13%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSG----GGGSYGGGGGRR----EGGGGYSGGGGGYS 202
           G GGGGG   GGGGGY  GGGGGY G    GGG YGGGGG      EGGGGY GGGG + 
Sbjct: 67  GYGGGGGGYPGGGGGY-GGGGGGYPGHGGEGGGGYGGGGGYPGHGGEGGGGYGGGGGYHG 125

Query: 203 SRGGGGGSYGGG------RREGGGGYGGGEGGGYGGSGGGGG 310
             G GGG YGGG        EGGGGYGGG GGGY G GGGGG
Sbjct: 126 HGGEGGGGYGGGGGYHGHGGEGGGGYGGG-GGGYPGHGGGGG 166

 Score =  118 bits (295), Expect = 2e-25
 Identities = 66/106 (62%), Positives = 69/106 (65%), Gaps = 13/106 (12%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG-----RREGGGGYSGGGG 193
           +    RG  GGGG+  GGGGGY  GGGGGY GGGG YGGGGG       EGGGGY GGGG
Sbjct: 49  HHGHGRGGHGGGGY--GGGGGY-GGGGGGYPGGGGGYGGGGGGYPGHGGEGGGGY-GGGG 104

Query: 194 GYSSRGG-GGGSYGGG------RREGGGGYGGGEG-GGYGGSGGGG 307
           GY   GG GGG YGGG        EGGGGYGGG G  G+GG GGGG
Sbjct: 105 GYPGHGGEGGGGYGGGGGYHGHGGEGGGGYGGGGGYHGHGGEGGGG 150

 Score =  116 bits (291), Expect = 7e-25
 Identities = 60/92 (65%), Positives = 62/92 (67%), Gaps = 8/92 (8%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG-GGGSYG 232
           GGGGH G G GG+   GGGGY GGGG  GGGGG   GGGGY GGGGGY   GG GGG YG
Sbjct: 45  GGGGHHGHGRGGH---GGGGYGGGGGYGGGGGGYPGGGGGYGGGGGGYPGHGGEGGGGYG 101

Query: 233 GGRR------EGGGGYGGGEG-GGYGGSGGGG 307
           GG        EGGGGYGGG G  G+GG GGGG
Sbjct: 102 GGGGYPGHGGEGGGGYGGGGGYHGHGGEGGGG 133

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/84 (60%), Positives = 53/84 (63%), Gaps = 11/84 (13%)
 Frame = +2

Query: 47  GSGGGGG---HRGGGGGGYRSGGGGGYSG----GGGSYGGGGGRR----EGGGGYSGGGG 193
           G GGGGG   H G GGGGY  GGGGGY G    GGG YGGGGG      EGGGGY GGGG
Sbjct: 99  GYGGGGGYPGHGGEGGGGY--GGGGGYHGHGGEGGGGYGGGGGYHGHGGEGGGGYGGGGG 156

Query: 194 GYSSRGGGGGSYGGGRREGGGGYG 265
           GY   GGGGG  GG  + G  G+G
Sbjct: 157 GYPGHGGGGGHGGGRCKWGCCGHG 180

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 36/60 (60%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = +2

Query: 137 YGGGGGRREGGGGYSGGG-GGYSSRGGGGGSYGGGRREGGGGYGGGEGG--GYGGSGGGG 307
           +GGGG    G GG+ GGG GG    GGGGG Y G    GGGGYGGG GG  G+GG GGGG
Sbjct: 44  HGGGGHHGHGRGGHGGGGYGGGGGYGGGGGGYPG----GGGGYGGGGGGYPGHGGEGGGG 99

[110][TOP]
>UniRef100_Q9SL23 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9SL23_ARATH
          Length = 154

 Score =  119 bits (297), Expect = 1e-25
 Identities = 63/102 (61%), Positives = 68/102 (66%), Gaps = 9/102 (8%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGY--RSGGGG----GYSGGGGSYGGGGGRREGGGGYSGGGG 193
           E    G GG GGH GGGG G+   +GGGG    GY GGGG YGGGGG   GGGG+ GGGG
Sbjct: 41  EGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGG 100

Query: 194 GYSSRGGGGGSY-GGGRREGGGGYGGGEGGGYGGSGG--GGG 310
           G+   GGGGG Y GGG   GGGG+ GG GGGYGG GG  GGG
Sbjct: 101 GH--YGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGG 140

 Score =  110 bits (274), Expect = 6e-23
 Identities = 57/92 (61%), Positives = 62/92 (67%), Gaps = 5/92 (5%)
 Frame = +2

Query: 47  GSGGG---GGHRGGGGGGYRS-GGGGGY-SGGGGSYGGGGGRREGGGGYSGGGGGYSSRG 211
           G GGG   GGH GGGG G    GGGGG+  GGGG YGGGGG   GGGG+ GGGGG+   G
Sbjct: 54  GGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGH--YG 111

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GGGG +GGG   GGGG G G GGG+ G GG G
Sbjct: 112 GGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143

 Score =  103 bits (258), Expect = 5e-21
 Identities = 51/76 (67%), Positives = 52/76 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGGH GGGGG Y  GGGG Y GGGG YGGGGG   GGGG  GGGG Y   GGGGG 
Sbjct: 74  GYGGGGGHYGGGGGHY-GGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYG--GGGGGY 130

Query: 227 YGGGRREGGGGYGGGE 274
            GGG   GGGG+G  E
Sbjct: 131 GGGGGHHGGGGHGLNE 146

[111][TOP]
>UniRef100_Q7Y218 Putative uncharacterized protein At5g46730 n=1 Tax=Arabidopsis
           thaliana RepID=Q7Y218_ARATH
          Length = 290

 Score =  119 bits (297), Expect = 1e-25
 Identities = 59/93 (63%), Positives = 61/93 (65%), Gaps = 8/93 (8%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSG--GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG---GG 217
           GGGGGH GGGGGG   G  GG GY GG G   GGGG   G GGY GGGGG S  G   GG
Sbjct: 166 GGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGG 225

Query: 218 GGSYGGGRREG---GGGYGGGEGGGYGGSGGGG 307
           GG++GGG   G   GGGYGGG  GGYGG GGGG
Sbjct: 226 GGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGG 258

 Score =  111 bits (277), Expect = 3e-23
 Identities = 60/106 (56%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGG---GGSYGGGGGRREGGGGYSGGGGGYS 202
           E    G+ G GG   GGGGG+  GGGGG +GG   G  YGGG G   GGGG  GG GGY 
Sbjct: 151 EGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYG 210

Query: 203 SRG----GGGGSYGGGRREGGG-GYGGGEGGGYGGS-----GGGGG 310
             G    GGGG+YGGG   GGG G GGGEGGGYGG      GGGGG
Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGG 256

 Score =  109 bits (273), Expect = 8e-23
 Identities = 54/93 (58%), Positives = 60/93 (64%), Gaps = 1/93 (1%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGS-YGGGGGRREGGGGYSGGGGGYSSRG 211
           A   G GGGGG+ GG  GG+  GGGGG  GGGGS YG GG    G G  +G GGG  + G
Sbjct: 101 ASGAGEGGGGGY-GGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASG 159

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG+YGGG   GGGG GG  GG +GGSG GGG
Sbjct: 160 YGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGG 192

 Score =  109 bits (273), Expect = 8e-23
 Identities = 57/90 (63%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GSG GGG  GG GGG   GG GGY GGGG   GGGG   GGG +   GGGY S GG GG 
Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAH---GGGYGSGGGEGGG 242

Query: 227 YGGGRREG-GGGYGGGEGGG--YGGSGGGG 307
           YGGG   G GGG GGGEGGG  YGG  GGG
Sbjct: 243 YGGGAAGGYGGGGGGGEGGGGSYGGEHGGG 272

 Score =  108 bits (269), Expect = 2e-22
 Identities = 55/93 (59%), Positives = 59/93 (63%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G+GGGG H  GG GGY  GGGGG SGGGG+YGGGG    G G   G GGGY     GG  
Sbjct: 196 GAGGGGSH--GGAGGYGGGGGGG-SGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYG 252

Query: 227 YGGGRREGGGG-----YGGGEGGGYGGSGGGGG 310
            GGG  EGGGG     +GGG GGG+GG GG GG
Sbjct: 253 GGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGG 285

 Score =  107 bits (267), Expect = 4e-22
 Identities = 57/101 (56%), Positives = 59/101 (58%), Gaps = 9/101 (8%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           A+   SGGG GH GGGGG   SGG   G   GGGG YGG  G   GGGG   GGGG S+ 
Sbjct: 76  AEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAY 135

Query: 209 GGGG---GSYGGGRREGGG----GYGGGEGGGYGGSGGGGG 310
           G GG     YG G  EGGG    GYGGG  GG GG GGGGG
Sbjct: 136 GAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGG 176

 Score =  103 bits (258), Expect = 5e-21
 Identities = 60/102 (58%), Positives = 62/102 (60%), Gaps = 14/102 (13%)
 Frame = +2

Query: 47  GSGGGGG--------HRGGGGGGYRSGGGGGYSG-GGGSYGGGGGRREGGGGYSGGG--G 193
           GSGGGGG        H  G G G   GGG G SG GGG+YGGGGG   GGGG S GG  G
Sbjct: 126 GSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHG 185

Query: 194 GYSSRGG-GGGSYGGGRREGGGGYGGGEGGGYGGSG--GGGG 310
           G    GG GGG+ GGG   G GGYGGG GGG GG G  GGGG
Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227

 Score =  103 bits (257), Expect = 6e-21
 Identities = 56/101 (55%), Positives = 60/101 (59%), Gaps = 9/101 (8%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGG--------GGGYSGGGGSYGGGGGRREGGGGYSGGG 190
           A     GGGGG  GGGG  Y +GG        G G  GG G+ G GGG   GGGG+ GGG
Sbjct: 116 AGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGG 175

Query: 191 GGYSSRGGGGGS-YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG S+ G  GGS YGGG  EGGG  GGG  GG GG GGGGG
Sbjct: 176 GGGSAGGAHGGSGYGGG--EGGGAGGGGSHGGAGGYGGGGG 214

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 59/102 (57%), Positives = 61/102 (59%), Gaps = 15/102 (14%)
 Frame = +2

Query: 50  SGGGGGHRGGGG-GGYRSGGGGGYSGGGGSYGGGGGRREGGG-----GYSGGGGGYSSRG 211
           + GGGGH GGGG GG  SGG GG SGGG  YGGG G   GGG     GY+ GGG     G
Sbjct: 33  ASGGGGHGGGGGSGGVSSGGYGGESGGG--YGGGSGEGAGGGYGGAEGYASGGGSGHGGG 90

Query: 212 GGG----GSYGGGRREGGGG-YGGG----EGGGYGGSGGGGG 310
           GGG    G Y  G  EGGGG YGG      GGG GGSGGGGG
Sbjct: 91  GGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGG 132

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 56/89 (62%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG--GGYSGGGGGYSSRGGGG 220
           G  GGGG  G GGGG   GGGG + GG GS GG GG   GG  GGY GGGGG     GGG
Sbjct: 207 GGYGGGGGGGSGGGG-AYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGE---GGG 262

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GSYGG   E GGG GGG GGG GG GGGG
Sbjct: 263 GSYGG---EHGGGSGGGHGGG-GGHGGGG 287

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 40/70 (57%), Positives = 42/70 (60%), Gaps = 4/70 (5%)
 Frame = +2

Query: 113 GYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREG-GGGYGGGEG---G 280
           G + GGG +GGGGG     GG S GG G    G  GG YGGG  EG GGGYGG EG   G
Sbjct: 31  GQASGGGGHGGGGG----SGGVSSGGYG----GESGGGYGGGSGEGAGGGYGGAEGYASG 82

Query: 281 GYGGSGGGGG 310
           G  G GGGGG
Sbjct: 83  GGSGHGGGGG 92

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/76 (50%), Positives = 39/76 (51%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           A   G G GGG  GG GG           G  G YGGGGG  EGGGG  GG  G    GG
Sbjct: 228 AHGGGYGSGGGEGGGYGG-----------GAAGGYGGGGGGGEGGGGSYGGEHG----GG 272

Query: 215 GGGSYGGGRREGGGGY 262
            GG +GGG   GGGGY
Sbjct: 273 SGGGHGGGGGHGGGGY 288

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 10/55 (18%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGG----------GGGRREGGGGYS 181
           G G GGG+ GG  GGY  GGGGG  GGGGSYGG          GGG   GGGGY+
Sbjct: 236 GGGEGGGYGGGAAGGYGGGGGGG-EGGGGSYGGEHGGGSGGGHGGGGGHGGGGYA 289

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 30/54 (55%), Positives = 32/54 (59%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGG 193
           E    G G  GG+ GGGGGG   GGGG Y   GG +GGG G   GGGG  GGGG
Sbjct: 239 EGGGYGGGAAGGYGGGGGGG--EGGGGSY---GGEHGGGSGGGHGGGGGHGGGG 287

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 30/55 (54%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +2

Query: 152 GRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGS-GGGGGW 313
           G+  GGGG+ GGGG   S G   G YGG   E GGGYGGG G G GG  GG  G+
Sbjct: 31  GQASGGGGHGGGGG---SGGVSSGGYGG---ESGGGYGGGSGEGAGGGYGGAEGY 79

[112][TOP]
>UniRef100_C0P2F3 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0P2F3_MAIZE
          Length = 326

 Score =  119 bits (297), Expect = 1e-25
 Identities = 57/96 (59%), Positives = 62/96 (64%), Gaps = 7/96 (7%)
 Frame = -3

Query: 309 PPPPPLPP*PPP--SPPP---YPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPP 145
           PPPP LP  PPP  +PPP    PPPP+  PPP    PPP  + PPPP   PPPP++ PPP
Sbjct: 36  PPPPTLPQPPPPRRAPPPPALAPPPPTMPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPP 95

Query: 144 PP*LPPPPE*PPPPPLRYPPPP--PPRWPPPPPLPR 43
           P   PPPP  PPPPP R PPPP  PP  PPPPP PR
Sbjct: 96  PRRAPPPPTQPPPPPRRAPPPPPSPPIRPPPPPTPR 131

 Score =  115 bits (287), Expect = 2e-24
 Identities = 56/101 (55%), Positives = 61/101 (60%), Gaps = 4/101 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPP----PPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPP 169
           P+P  + + PP    PPP  P PPP P   PPPP+  PPP   PPPP    PPPP   PP
Sbjct: 22  PRPPQQPFPPPRRAPPPPTLPQPPP-PRRAPPPPALAPPPPTMPPPPPRRAPPPPTQPPP 80

Query: 168 PPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP R PPPP   PPPP   PPPP + PPPPP R PPPPP P
Sbjct: 81  PPRRAPPPPTQPPPPPRRAPPPPTQ-PPPPPRRAPPPPPSP 120

 Score =  113 bits (282), Expect = 7e-24
 Identities = 58/103 (56%), Positives = 61/103 (59%), Gaps = 6/103 (5%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P+P      PPPP L P PPP+ PP  PPP R PPP   PPPP    PPPP   PPPP R
Sbjct: 42  PQPPPPRRAPPPPALAP-PPPTMPP--PPPRRAPPPPTQPPPPPRRAPPPPTQPPPPPRR 98

Query: 156 LPPPPP*LPPPPE----*PPPPPLRYPPPPPPR--WPPPPPLP 46
            PPPP   PPPP      PP PP+R PPPP PR   PPPP LP
Sbjct: 99  APPPPTQPPPPPRRAPPPPPSPPIRPPPPPTPRPQAPPPPHLP 141

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/101 (54%), Positives = 58/101 (57%), Gaps = 5/101 (4%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
           NP P    + P  PP P  P P   P+PPP    PPP LP PPP    PPPP L PPPP+
Sbjct: 4   NPTPPGLGF-PYLPPNPYLPRPPQQPFPPPRRAPPPPTLPQPPPPRRAPPPPALAPPPPT 62

Query: 159 RLPPPPP*LPPPPE*PPPPPLRYP-----PPPPPRWPPPPP 52
             PPPP   PPPP  PPPPP R P     PPPPPR  PPPP
Sbjct: 63  MPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPPPRRAPPPP 103

 Score =  109 bits (273), Expect = 8e-23
 Identities = 53/98 (54%), Positives = 55/98 (56%), Gaps = 12/98 (12%)
 Frame = -3

Query: 309 PPPPPLPP*PP----PSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPP 142
           PPPP +PP PP    P P   PPPP R PPP   PPPP    PPPP   PPPP R PPPP
Sbjct: 58  PPPPTMPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPPPRRAPPPP 117

Query: 141 P*LP--------PPPE*PPPPPLRYPPPPPPRWPPPPP 52
           P  P        P P+ PPPP L  PPPP P  PPP P
Sbjct: 118 PSPPIRPPPPPTPRPQAPPPPHLPMPPPPAPVPPPPSP 155

 Score =  102 bits (253), Expect = 2e-20
 Identities = 51/95 (53%), Positives = 55/95 (57%), Gaps = 6/95 (6%)
 Frame = -3

Query: 318 NYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*-LPPPPPLEE*PPPPPLYPPPPSRLPPPP 142
           N + P PP  P PPP   P PP   + PPP   PPPP L   PPPP + PPPP R PPPP
Sbjct: 18  NPYLPRPPQQPFPPPRRAPPPPTLPQPPPPRRAPPPPALA--PPPPTMPPPPPRRAPPPP 75

Query: 141 P*LPPPPE*PPPPPLRYPP-----PPPPRWPPPPP 52
              PPPP   PPPP + PP     PPPP  PPPPP
Sbjct: 76  TQPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPPP 110

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 48/94 (51%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = -3

Query: 315 YHPPPPPLP-P*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP 139
           ++P PP L  P  PP+P    PP    PPP   PPPP    PPPP   PPPP+  PPPP 
Sbjct: 3   FNPTPPGLGFPYLPPNPYLPRPPQQPFPPPRRAPPPPTLPQPPPPRRAPPPPALAPPPPT 62

Query: 138 *LPPPPE*PPPPPLRYPP-----PPPPRWPPPPP 52
             PPPP   PPPP + PP     PPPP  PPPPP
Sbjct: 63  MPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPPP 96

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/75 (56%), Positives = 44/75 (58%), Gaps = 6/75 (8%)
 Frame = -3

Query: 306 PPPPLPP*PPP--SPPPY---PPPPSRLPPP*LPPPPPLEE*PPPPPL-YPPPPSRLPPP 145
           PPPP  P PPP  +PPP    PPPP R PPP  PP PP+   PPP P    PPP  LP P
Sbjct: 86  PPPPTQPPPPPRRAPPPPTQPPPPPRRAPPP--PPSPPIRPPPPPTPRPQAPPPPHLPMP 143

Query: 144 PP*LPPPPE*PPPPP 100
           PP  P PP  PP PP
Sbjct: 144 PPPAPVPP--PPSPP 156

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 31/60 (51%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = -3

Query: 219 PPPPLEE*P--PPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P PP    P  PP P  P PP +  PPP   PPPP  P PPP R  PPPP   PPPP +P
Sbjct: 5   PTPPGLGFPYLPPNPYLPRPPQQPFPPPRRAPPPPTLPQPPPPRRAPPPPALAPPPPTMP 64

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/56 (62%), Positives = 36/56 (64%), Gaps = 2/56 (3%)
 Frame = -3

Query: 309 PPPPP--LPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP 148
           PPPPP   PP PPPSPP  PPPP   P P  PPPP L   PPP P+ PPPPS  PP
Sbjct: 106 PPPPPRRAPP-PPPSPPIRPPPPP-TPRPQAPPPPHLPMPPPPAPV-PPPPS--PP 156

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 29/57 (50%), Positives = 32/57 (56%), Gaps = 2/57 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPP--PLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYP 172
           P P  R   PPPP  P+ P PPP+P P  PPP  LP P  PPP P+    PPPP  P
Sbjct: 106 PPPPPRRAPPPPPSPPIRPPPPPTPRPQAPPPPHLPMP--PPPAPV----PPPPSPP 156

[113][TOP]
>UniRef100_B4NC76 GK25807 n=1 Tax=Drosophila willistoni RepID=B4NC76_DROWI
          Length = 234

 Score =  119 bits (297), Expect = 1e-25
 Identities = 59/96 (61%), Positives = 63/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRR--EGGGGY--SGGGGGYSSRGG 214
           G  GGG H GGGGGGY   GG G  G GG+ GGGGG+    GGGGY  +GGGGG    GG
Sbjct: 139 GGFGGGKHGGGGGGGYGGNGGNGGGGYGGNGGGGGGKHGGNGGGGYGGNGGGGGGKHGGG 198

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGG---GGGW 313
           GGG YGG    GGG +GGG GGGYGG GG   GGGW
Sbjct: 199 GGGGYGGNGGGGGGKHGGGGGGGYGGGGGGKHGGGW 234

 Score =  118 bits (295), Expect = 2e-25
 Identities = 55/88 (62%), Positives = 60/88 (68%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG+ GGG GG+  G  GG  GGGG YGG GG   GG G +GGGGG    G GGG 
Sbjct: 126 GGGGGGGYGGGGSGGFGGGKHGG--GGGGGYGGNGGNGGGGYGGNGGGGGGKHGGNGGGG 183

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           YGG    GGG +GGG GGGYGG+GGGGG
Sbjct: 184 YGGNGGGGGGKHGGGGGGGYGGNGGGGG 211

 Score =  116 bits (290), Expect = 9e-25
 Identities = 60/111 (54%), Positives = 67/111 (60%), Gaps = 12/111 (10%)
 Frame = +2

Query: 14  RSITVNEAQS---RGSGGGGGHRGGGGGGYRSGGGGGY-------SGGGGSYGGGGGRRE 163
           +S+  N   S   +G G GG   GGGGGGY  GG GG+        GGGG YGGGG    
Sbjct: 82  KSLAGNRGSSISWQGGGNGGKQGGGGGGGYGGGGSGGFGGGKHGGGGGGGGYGGGGSGGF 141

Query: 164 GGGGY-SGGGGGYSSRGG-GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG +  GGGGGY   GG GGG YGG    GGG +GG  GGGYGG+GGGGG
Sbjct: 142 GGGKHGGGGGGGYGGNGGNGGGGYGGNGGGGGGKHGGNGGGGYGGNGGGGG 192

 Score =  115 bits (289), Expect = 1e-24
 Identities = 62/113 (54%), Positives = 66/113 (58%), Gaps = 25/113 (22%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG    GGGGY GGGGS+GGGGG   GGGGY GGGG +   GGGGG 
Sbjct: 24  GGGGGGGGYGGGGGG---NGGGGYGGGGGSHGGGGG--NGGGGYGGGGGSHG--GGGGGG 76

Query: 227 YGGGRRE-----------------------GGGGYGGGEGGGYGGS--GGGGG 310
           YGGG +                        GGGGYGGG  GG+GG   GGGGG
Sbjct: 77  YGGGSKSLAGNRGSSISWQGGGNGGKQGGGGGGGYGGGGSGGFGGGKHGGGGG 129

 Score =  110 bits (276), Expect = 4e-23
 Identities = 59/112 (52%), Positives = 63/112 (56%), Gaps = 23/112 (20%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG-------------------GGSYGGGGGRREGG 169
           G G GGG  GGGGG +  GGGGGY GG                   GG  GGGGG   GG
Sbjct: 54  GGGNGGGGYGGGGGSHGGGGGGGYGGGSKSLAGNRGSSISWQGGGNGGKQGGGGGGGYGG 113

Query: 170 GGYSGGGGGYSSRGGGGGSYGGGRREG--GGGYGGGEGGGYGGSG--GGGGW 313
           GG  G GGG    GGGGG YGGG   G  GG +GGG GGGYGG+G  GGGG+
Sbjct: 114 GGSGGFGGGKHGGGGGGGGYGGGGSGGFGGGKHGGGGGGGYGGNGGNGGGGY 165

 Score =  108 bits (269), Expect = 2e-22
 Identities = 59/116 (50%), Positives = 64/116 (55%), Gaps = 27/116 (23%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG------------------ 172
           G GGGGG  GGGGG     GGGGY GGGGS+GGGGG   GGG                  
Sbjct: 43  GYGGGGGSHGGGGGN----GGGGYGGGGGSHGGGGGGGYGGGSKSLAGNRGSSISWQGGG 98

Query: 173 --GYSGGGGGYSSRGGGGGSYGGGRREGGGG---YGGGEGGGYGG----SGGGGGW 313
             G  GGGGG    GGG G +GGG+  GGGG   YGGG  GG+GG     GGGGG+
Sbjct: 99  NGGKQGGGGGGGYGGGGSGGFGGGKHGGGGGGGGYGGGGSGGFGGGKHGGGGGGGY 154

 Score =  107 bits (266), Expect = 5e-22
 Identities = 57/108 (52%), Positives = 61/108 (56%), Gaps = 20/108 (18%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG--------GGYRSGGGGGYSGGGGSYGGGGGRREGGG---------- 172
           G GGGGG  GGGG        GG    GGGGY GGGGS+GGGGG   GGG          
Sbjct: 31  GYGGGGGGNGGGGYGGGGGSHGGGGGNGGGGYGGGGGSHGGGGGGGYGGGSKSLAGNRGS 90

Query: 173 --GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
              + GGG G    GGGGG YGGG   G GG+GGG+ GG GG GG GG
Sbjct: 91  SISWQGGGNGGKQGGGGGGGYGGG---GSGGFGGGKHGGGGGGGGYGG 135

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/113 (52%), Positives = 61/113 (53%), Gaps = 23/113 (20%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYR--SGGGGGYSGG-------------------GGSYGGGGGR 157
           S G GGG G  G GGGG     GGGGGY GG                   GG  GGGGG 
Sbjct: 50  SHGGGGGNGGGGYGGGGGSHGGGGGGGYGGGSKSLAGNRGSSISWQGGGNGGKQGGGGGG 109

Query: 158 REGGGGYSGGGGGYSSRGGGGGSYGGGRRE--GGGGYGGGEGGGYGGSGGGGG 310
             GGGG  G GGG    GGGGG YGGG     GGG +GGG GGGYGG+GG GG
Sbjct: 110 GYGGGGSGGFGGGKHGGGGGGGGYGGGGSGGFGGGKHGGGGGGGYGGNGGNGG 162

 Score =  102 bits (254), Expect = 1e-20
 Identities = 56/110 (50%), Positives = 59/110 (53%), Gaps = 24/110 (21%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGG------------------GGGYSGGGGSYGGGGGRREGGGGY 178
           GGGG H GGGGGGY  G                   GG   GGGG   GGGG    GGG 
Sbjct: 64  GGGGSHGGGGGGGYGGGSKSLAGNRGSSISWQGGGNGGKQGGGGGGGYGGGGSGGFGGGK 123

Query: 179 SGGGGGYSSRGGGG-GSYGGGRREGG-----GGYGGGEGGGYGGSGGGGG 310
            GGGGG    GGGG G +GGG+  GG     GG GG  GGGYGG+GGGGG
Sbjct: 124 HGGGGGGGGYGGGGSGGFGGGKHGGGGGGGYGGNGGNGGGGYGGNGGGGG 173

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 43/65 (66%), Positives = 45/65 (69%)
 Frame = +2

Query: 113 GYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGG 292
           G  GGGG  GG GG   GGGG   GGGGY   GGGGGS+GGG   GGGGYGGG GG +GG
Sbjct: 21  GLLGGGGGGGGYGG---GGGG--NGGGGY---GGGGGSHGGGGGNGGGGYGGG-GGSHGG 71

Query: 293 SGGGG 307
            GGGG
Sbjct: 72  GGGGG 76

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 1/40 (2%)
 Frame = +2

Query: 194 GYSSRGGGGGSY-GGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G    GGGGG Y GGG   GGGGYGGG GG +GG GG GG
Sbjct: 21  GLLGGGGGGGGYGGGGGGNGGGGYGGG-GGSHGGGGGNGG 59

[114][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score =  118 bits (296), Expect = 2e-25
 Identities = 59/100 (59%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPP--PPLYPPPP 163
           P P   +  PP PP P  PPPSPPP PPPPS  PP   PP PP    PPP  PP  PPPP
Sbjct: 237 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 296

Query: 162 SRLPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           S  PP PPP  PPPP  PPPPP   P PPPP  PPP P P
Sbjct: 297 SPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPP 336

 Score =  118 bits (296), Expect = 2e-25
 Identities = 59/98 (60%), Positives = 60/98 (61%), Gaps = 1/98 (1%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPP  PP PPPSPPP PPPPS  PP    PPPP    P PPP  PPPPS 
Sbjct: 299 PPPSPPPPSPPPPSPPP-PPPSPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSP 354

Query: 156 LPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP  PPPPP   P PPPP  PPP P P
Sbjct: 355 PPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPP 392

 Score =  118 bits (296), Expect = 2e-25
 Identities = 57/91 (62%), Positives = 57/91 (62%), Gaps = 4/91 (4%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLP--PP*LPPPPPLEE*PPPPPLYPPPPSRLPP--PPP 139
           PPPP PP PPPSPPP PPPPS  P  PP   PPPP    P PPP  PPPPS  PP  PPP
Sbjct: 364 PPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPP 423

Query: 138 *LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPP  PPP P   PPP PP   PPPP P
Sbjct: 424 PSPPPPSPPPPSPPSPPPPSPPPPSPPPPSP 454

 Score =  117 bits (294), Expect = 3e-25
 Identities = 57/99 (57%), Positives = 58/99 (58%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PP--PPPLYPPPP 163
           P P   +  PP PP P  PPPSPPP  PPP   PPP  PPPPP    PP  PPP  PPPP
Sbjct: 222 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPP 281

Query: 162 SRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           S  PP PP   PPP  PPPP    P PPPP  PPPPP P
Sbjct: 282 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSP 320

 Score =  117 bits (292), Expect = 5e-25
 Identities = 61/104 (58%), Positives = 62/104 (59%), Gaps = 7/104 (6%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PP--PPPLYPP 169
           P P+     PPP P PP PPP   PPP PPPPS  PPP  PPPPP    PP  PPP  PP
Sbjct: 116 PPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPP 175

Query: 168 PPSRLPP-PPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
           PPS  PP PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 176 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 219

 Score =  116 bits (290), Expect = 9e-25
 Identities = 61/101 (60%), Positives = 62/101 (61%), Gaps = 4/101 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPP-PYPPPPSRLPPP*LP-PPPPLEE*PPPPPLYPPPP 163
           P P   +  PP PP P  PPPSPP P PPPPS  PPP  P PPPP    P PPP  PPPP
Sbjct: 227 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPP 286

Query: 162 SRLPP-PPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
           S  PP PPP  PPPP  PPP PP   PPPPPP  PP PP P
Sbjct: 287 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPP 327

 Score =  116 bits (290), Expect = 9e-25
 Identities = 57/93 (61%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
           PPP P PP PPP  PP P PP   PPP  PPPPP    P PPP  PPPPS  PP PPP  
Sbjct: 284 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPS 343

Query: 132 PPPPE*PPP-PPLRYPP---PPPPRWPPPPPLP 46
           PPPP  PPP PP   PP   PPPP  PPPPP P
Sbjct: 344 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSP 376

 Score =  116 bits (290), Expect = 9e-25
 Identities = 56/100 (56%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP  PPP P    PPPPP  PPP   
Sbjct: 322 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPP 381

Query: 156 LPPPPP*LPPPPE*P---PPPPLRYPPPPPPRWPPPPPLP 46
            P PPP  PPPP  P   PPPP   PP PPP  PPPPP P
Sbjct: 382 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSP 421

 Score =  116 bits (290), Expect = 9e-25
 Identities = 57/91 (62%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309 PPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP 139
           PPP P PP PPP   PPP PPPPS  PPP  PPPPP    P PPP  PPPPS  PP PPP
Sbjct: 340 PPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPP 397

Query: 138 *LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPP  PPP P    PPPPP  PPP P P
Sbjct: 398 PSPPPPSPPPPSPPPPSPPPPPSPPPPSPPP 428

 Score =  115 bits (289), Expect = 1e-24
 Identities = 61/103 (59%), Positives = 62/103 (60%), Gaps = 6/103 (5%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPP-PYPPPPSRLPPP*LP---PPPPLEE*PPPPPLYPP 169
           P P   +  PP PP P  PPPSPP P PPPPS  PPP  P   PPPP    P PPP  PP
Sbjct: 281 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPP 340

Query: 168 PPSRLPP-PPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
           PPS  PP PPP  PPPP  PPP PP   PPPPPP  PP PP P
Sbjct: 341 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPP 383

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/99 (58%), Positives = 59/99 (59%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 172 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 229

Query: 156 LPP-PPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP  PPP PP   PPPP P  PPPPP P
Sbjct: 230 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSP 268

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/99 (58%), Positives = 59/99 (59%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 177 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 234

Query: 156 LPP-PPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP  PPP PP   PPPPPP   PPPP P
Sbjct: 235 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSP 273

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/99 (58%), Positives = 59/99 (59%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 187 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 244

Query: 156 LPP-PPP*LPPPPE*PPPPPLRYPPPP-PPRWPPPPPLP 46
            PP PPP  PPPP  PPPPP   PPPP PP   PPPP P
Sbjct: 245 PPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSP 283

 Score =  115 bits (287), Expect = 2e-24
 Identities = 56/93 (60%), Positives = 56/93 (60%), Gaps = 5/93 (5%)
 Frame = -3

Query: 309 PPPPPLPP*PPPS--PPPYPPPPSRLPPP*LPPP---PPLEE*PPPPPLYPPPPSRLPPP 145
           PPP P PP PPP   PPP PPPPS  PPP  PPP   PP    P PPP  PPPPS  PP 
Sbjct: 345 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 404

Query: 144 PP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP   PPP  PPPPP   PP PPP  PPPP  P
Sbjct: 405 PPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPP 437

 Score =  114 bits (285), Expect = 3e-24
 Identities = 58/101 (57%), Positives = 59/101 (58%), Gaps = 4/101 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPP P PP PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 142 PSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 199

Query: 156 LPP-PPP*LPPPPE*PPP---PPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP  PPP   PP   PP PPP  PPPP  P
Sbjct: 200 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 240

 Score =  114 bits (285), Expect = 3e-24
 Identities = 59/104 (56%), Positives = 60/104 (57%), Gaps = 7/104 (6%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LP---PPPPLEE*PPPPPLYPPP 166
           P P   +  PP PP P  PPPSPPP  PPP   PPP  P   PPPP    P PPP  PPP
Sbjct: 162 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 221

Query: 165 PSRLPP-PPP*LPPPPE*P---PPPPLRYPPPPPPRWPPPPPLP 46
           PS  PP PPP  PPPP  P   PPPP   PP PPP  PPPPP P
Sbjct: 222 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 265

 Score =  114 bits (285), Expect = 3e-24
 Identities = 58/107 (54%), Positives = 59/107 (55%), Gaps = 10/107 (9%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LP--------PPPPLEE*PPPPP 181
           P P   +  PP PP P  PPPSPPP  PPP   PPP  P        PPPP    P PPP
Sbjct: 192 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 251

Query: 180 LYPPPPSRLPPPPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
             PPPPS  PPPPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 252 PSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 298

 Score =  114 bits (285), Expect = 3e-24
 Identities = 56/99 (56%), Positives = 57/99 (57%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP  PPP P    PPPP   PPPPS 
Sbjct: 261 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSP 320

Query: 156 LPPPPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            P PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 321 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 359

 Score =  114 bits (285), Expect = 3e-24
 Identities = 58/100 (58%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPPP PP PP  PPP PPPPS   PP   PPPP    P PPP  PPPPS 
Sbjct: 406 PPPSPPPPSPPPPPSPP-PPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 464

Query: 156 LPP-PPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 465 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 504

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/94 (60%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPP---PPLEE*PPPPPLYPPPPSRLPP-PP 142
           PPPPP P  PPPSPPP  PPP   PPP  PPP   PP    P PPP  PPPPS  PP PP
Sbjct: 156 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 215

Query: 141 P*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
           P  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 216 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 249

 Score =  114 bits (284), Expect = 4e-24
 Identities = 58/92 (63%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = -3

Query: 309 PPPPPLPP*--PPPSPP-PYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PP 142
           PPPPP PP   PPPSPP P PPPPS  PPP  PPPP      PPPP  PPPPS  PP PP
Sbjct: 370 PPPPPSPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPP 427

Query: 141 P*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P  PPPP  P PPP   PPP PP   PPPP P
Sbjct: 428 PPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSP 459

 Score =  114 bits (284), Expect = 4e-24
 Identities = 55/90 (61%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*LP 130
           PPPP PP P P PPP PPPPS  PP   PP PP    P PPP  PPPPS  PP PPP  P
Sbjct: 405 PPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 464

Query: 129 PPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
           PPP  PP  PPP   PPP PP   PPPP P
Sbjct: 465 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 494

 Score =  113 bits (282), Expect = 7e-24
 Identities = 59/102 (57%), Positives = 60/102 (58%), Gaps = 5/102 (4%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPL--PP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
           P P+     PPPPP   PP PPPSPPP  PPP   PPP   PPPP    P PPP  PPPP
Sbjct: 140 PPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPP 197

Query: 162 SRLPP-PPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
           S  PP PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 198 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 239

 Score =  113 bits (282), Expect = 7e-24
 Identities = 59/107 (55%), Positives = 60/107 (56%), Gaps = 10/107 (9%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPP-------PPPLEE*PPPPPL 178
           P P   +  PP PP P  PPPSPPP  PPP   PPP  PP       PPP    PPPPP 
Sbjct: 207 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPP 266

Query: 177 YPPPPSRLPP-PPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PPPPS  PP PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 267 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 313

 Score =  113 bits (282), Expect = 7e-24
 Identities = 55/99 (55%), Positives = 56/99 (56%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP  PPP P    PPPPP  PPP   
Sbjct: 266 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPP 325

Query: 156 LPPPPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            P PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 326 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 364

 Score =  113 bits (282), Expect = 7e-24
 Identities = 54/90 (60%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPP P PP PPP  PP P PP   PPP  PPPPP    P PPP  PPPPS   PPPP  P
Sbjct: 386 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPP-SP 444

Query: 129 PPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
           PPP  PP  PPP   PPP PP   PPPP P
Sbjct: 445 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 474

 Score =  112 bits (281), Expect = 1e-23
 Identities = 57/101 (56%), Positives = 58/101 (57%), Gaps = 4/101 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPS--PPPYPPPPSRLP--PP*LPPPPPLEE*PPPPPLYPP 169
           P P+     PPPPP PP PPP   PPP PPPPS  P  PP   PPPP    P PPP  PP
Sbjct: 250 PPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 309

Query: 168 PPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPS  PPPP   P PP   PPPP   PP PPP  PPPP  P
Sbjct: 310 PPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 350

 Score =  112 bits (281), Expect = 1e-23
 Identities = 60/102 (58%), Positives = 61/102 (59%), Gaps = 5/102 (4%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPP-PYPPPPSRLPPP*LPPP-PPLEE*PPPPPLYPPPP 163
           P P   +  PP PP P  PPPSPP P PPPPS  PPP  PPP PP    PPP P  PPPP
Sbjct: 383 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPP 442

Query: 162 SRLPP-PPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
           S  PP PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 443 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 484

 Score =  112 bits (280), Expect = 1e-23
 Identities = 57/92 (61%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = -3

Query: 309 PPPPPLPP-*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP* 136
           PPPPP PP  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS  PP PPP 
Sbjct: 155 PPPPPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 212

Query: 135 LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 213 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 244

 Score =  112 bits (280), Expect = 1e-23
 Identities = 58/102 (56%), Positives = 59/102 (57%), Gaps = 5/102 (4%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPP--PLEE*PPPPPLYPPPP 163
           P P   +  PP PP P  PPPSPPP  PPP   PPP  PPPP  P    P PPP  PPPP
Sbjct: 388 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPP 447

Query: 162 SRLPP-PPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
           S  PP PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 448 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 489

 Score =  112 bits (279), Expect = 2e-23
 Identities = 55/92 (59%), Positives = 55/92 (59%), Gaps = 4/92 (4%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPP---PPLEE*PPPPPLYPPPPSRLPPPPP 139
           PPPPP P  PPPSPPP  PPP   PPP  PPP   PP    P PPP  PPPPS  PPPP 
Sbjct: 260 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPS 319

Query: 138 *LPPPPE*PPPPPLRYPP-PPPPRWPPPPPLP 46
             P PP   PPPP   PP PPPP  PPP P P
Sbjct: 320 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 351

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/90 (60%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = -3

Query: 309 PPPPPLPP*--PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP* 136
           PPPPP PP   PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS  PP PP 
Sbjct: 314 PPPPPSPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPP 371

Query: 135 LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP P   PPPP   PP PPP  PPPP  P
Sbjct: 372 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 401

 Score =  112 bits (279), Expect = 2e-23
 Identities = 57/99 (57%), Positives = 58/99 (58%), Gaps = 2/99 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 427 PPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 484

Query: 156 LPP-PPP*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP  PPP PP   PPPP P  P PPP P
Sbjct: 485 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSP 523

 Score =  111 bits (278), Expect = 2e-23
 Identities = 57/100 (57%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPP  PP  PPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 417 PPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 474

Query: 156 LPP-PPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 475 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 514

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/92 (59%), Positives = 55/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query: 315 YHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP* 136
           Y PP  P P  PP  PPP PPPPS  PPP  PPPP      PPPP  PPPPS  PPPPP 
Sbjct: 110 YIPPTTPPPSPPPSQPPPSPPPPS--PPPPSPPPP-----SPPPPSPPPPPSPPPPPPPP 162

Query: 135 LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 163 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 194

 Score =  111 bits (277), Expect = 3e-23
 Identities = 57/100 (57%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP P PP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 127 PSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPP--SPPPPSPPPPSPPPPSPPPPSP 184

Query: 156 LPP-PPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 185 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 224

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/91 (59%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
           PPP P PP PPP  PP P PP   PPP  PPPP     PP PP  PPPPS  PP PPP  
Sbjct: 279 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPS 338

Query: 132 PPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
           PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 339 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 369

 Score =  111 bits (277), Expect = 3e-23
 Identities = 56/98 (57%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+  +  PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 432 PPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 489

Query: 156 LPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP   PPPP   PP PPP  PPP P P
Sbjct: 490 PPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPSPPP 525

 Score =  110 bits (276), Expect = 4e-23
 Identities = 51/88 (57%), Positives = 51/88 (57%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PP PP P  PPPSPPP  PPP   PPP  PPP P    PPPPP  PPP    P PPP  P
Sbjct: 377 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSP 436

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P P  P PPP   PPP PP   PPPP P
Sbjct: 437 PSPPPPSPPPPSPPPPSPPPPSPPPPSP 464

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/88 (59%), Positives = 52/88 (59%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS  PPPP   P
Sbjct: 321 PPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPPPSPPP 378

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP   PPPP   PP PPP  PPPP  P
Sbjct: 379 SPPPPSPPPPSPPPPSPPPPSPPPPSPP 406

 Score =  109 bits (272), Expect = 1e-22
 Identities = 56/100 (56%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 447 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 504

Query: 156 LPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPP--PPPLP 46
            PP PPP  PPPP  PP PP  +PP  PP  PP  PP LP
Sbjct: 505 PPPSPPPPSPPPPSPPPSPPPSHPPSHPPMHPPMHPPFLP 544

 Score =  108 bits (270), Expect = 2e-22
 Identities = 55/100 (55%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPP  PP  PP PP  PPPP    PP   PPPP    P PPP  PPPPS 
Sbjct: 130 PPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 189

Query: 156 LPP-PPP*LPPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PP PPP  PPPP  PP  PPP   PPP PP   PPPP P
Sbjct: 190 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 229

 Score =  107 bits (267), Expect = 4e-22
 Identities = 56/98 (57%), Positives = 57/98 (58%), Gaps = 3/98 (3%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PP PP P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS 
Sbjct: 437 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSP 494

Query: 156 LPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPP--PP 52
            PP PPP  PPPP  PPP P   PPP PP  PPP  PP
Sbjct: 495 PPPSPPPPSPPPPSPPPPSP---PPPSPPPSPPPSHPP 529

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 27/59 (45%), Positives = 28/59 (47%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
           P P+     PPPP  PP  PP P P PP P   PPP  PP  P    P  PP  PP  S
Sbjct: 490 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSHPPSHPPMHPPMHPPFLPPTTS 548

[115][TOP]
>UniRef100_A2BTV1 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. MIT 9515
           RepID=A2BTV1_PROM5
          Length = 222

 Score =  118 bits (296), Expect = 2e-25
 Identities = 64/110 (58%), Positives = 71/110 (64%), Gaps = 6/110 (5%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGG----GGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG 169
           +L GR + +N+A+ RG GG    GGG RGGG GG  +GGG G  G GG YGGGG     G
Sbjct: 66  ELMGRPLRINKAEPRGGGGQRRGGGGGRGGGYGGGGNGGGYGGGGNGGGYGGGGN----G 121

Query: 170 GGYSGGG--GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGY GGG  GGY   GG GG YGGG   GG G GGG GGGYGG G GGG+
Sbjct: 122 GGYGGGGNGGGYGG-GGNGGGYGGGGNGGGYG-GGGNGGGYGGGGYGGGY 169

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 41/83 (49%), Positives = 42/83 (50%), Gaps = 2/83 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGG-GGGYRSGG-GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           G G GGG+ GGG GGGY  GG GGGY GGG            GGGY GGG G    G GG
Sbjct: 117 GGGNGGGYGGGGNGGGYGGGGNGGGYGGGG-----------NGGGYGGGGNG---GGYGG 162

Query: 221 GSYGGGRREGGGGYGGGEGGGYG 289
           G YGGG  E    Y     G  G
Sbjct: 163 GGYGGGYSEPASNYANKSSGAEG 185

[116][TOP]
>UniRef100_Q40427 RNA-binding glycine-rich protein-1b n=1 Tax=Nicotiana sylvestris
           RepID=Q40427_NICSY
          Length = 148

 Score =  118 bits (296), Expect = 2e-25
 Identities = 65/99 (65%), Positives = 67/99 (67%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGRSITVNEAQ+RGSGGGG   GG GGG R GGGGGY GGGG Y  GGGRREGG    
Sbjct: 71  ELDGRSITVNEAQARGSGGGG---GGYGGGRREGGGGGYGGGGGGY--GGGRREGG---- 121

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 298
                       GG YGGGRREGGG  GG  GGGYGG G
Sbjct: 122 ------------GGGYGGGRREGGG--GGYGGGGYGGGG 146

[117][TOP]
>UniRef100_Q39337 Glycine-rich_protein_(Aa1-291) n=1 Tax=Brassica napus
           RepID=Q39337_BRANA
          Length = 291

 Score =  118 bits (296), Expect = 2e-25
 Identities = 60/99 (60%), Positives = 63/99 (63%), Gaps = 8/99 (8%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGG--GGGGYRSGGGGGYSGGGGS-----YGGGGGRREGGGGYSGGGG 193
           A+  G GGGGGH GG  GGGG   GGG GY GG G      YGGGG    GGGG SGGGG
Sbjct: 73  AEGIGGGGGGGHGGGAGGGGGGGPGGGSGYGGGSGEGGGAGYGGGGAGGHGGGGGSGGGG 132

Query: 194 GYSSRGGGGGSYGGGRREG-GGGYGGGEGGGYGGSGGGG 307
           G  + G  GG YGGG   G GGGYGGG  GG+GG GGGG
Sbjct: 133 GGGAGGAHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGGG 171

 Score =  118 bits (295), Expect = 2e-25
 Identities = 58/95 (61%), Positives = 62/95 (65%), Gaps = 7/95 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG-GSYGGGGGRREGGGGYSGGG------GGYSS 205
           G GGGG H GG GGG  +G GGGY GGG G +GGGGG  +GGGG  G G      GGY +
Sbjct: 175 GGGGGGAHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGGGKGGGGGGGSGAGGAHGGGYGA 234

Query: 206 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG G  YGGG  EGG G GGG GGG GG GGGGG
Sbjct: 235 GGGAGEGYGGGGGEGGHGGGGGGGGGAGGGGGGGG 269

 Score =  114 bits (285), Expect = 3e-24
 Identities = 56/93 (60%), Positives = 57/93 (61%), Gaps = 6/93 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG-----GGSYGGGGGRREGGGGYSGGGGGYSSRG 211
           G GGGGG  GGGGGG     GGGY GG     GG YGGGG    GGGG  G GGG    G
Sbjct: 121 GHGGGGGSGGGGGGGAGGAHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGGGNGGGGGGGG 180

Query: 212 GGGGSYGGGRREG-GGGYGGGEGGGYGGSGGGG 307
             GG YGGG   G GGGYGGG  GG+GG GGGG
Sbjct: 181 AHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGGG 213

 Score =  112 bits (279), Expect = 2e-23
 Identities = 59/104 (56%), Positives = 61/104 (58%), Gaps = 16/104 (15%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREG--------------GGGYSG 184
           GSG GGG   GGG GY  GG GG+ GGGGS GGGGG   G              GGGY G
Sbjct: 99  GSGYGGGSGEGGGAGYGGGGAGGHGGGGGSGGGGGGGAGGAHGGGYGGGEGAGAGGGYGG 158

Query: 185 GGGGYSSRGGGGGSYGGGRREG--GGGYGGGEGGGYGGSGGGGG 310
           GG G    GGGGG+ GGG   G  GGGYGGGEG G GG  GGGG
Sbjct: 159 GGAGGHGGGGGGGNGGGGGGGGAHGGGYGGGEGAGAGGGYGGGG 202

 Score =  112 bits (279), Expect = 2e-23
 Identities = 57/95 (60%), Positives = 59/95 (62%), Gaps = 7/95 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG-------GYSGGGGGYSS 205
           G GG GGH GGGGGG   GGGGG + GGG YGGG G   GGG       G+ GGGGG   
Sbjct: 157 GGGGAGGHGGGGGGGNGGGGGGGGAHGGG-YGGGEGAGAGGGYGGGGAGGHGGGGGGGKG 215

Query: 206 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGGGGS  GG   GG G GGG G GYGG GG GG
Sbjct: 216 GGGGGGSGAGGAHGGGYGAGGGAGEGYGGGGGEGG 250

 Score =  109 bits (272), Expect = 1e-22
 Identities = 56/92 (60%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG-GSYGGGGGRREGGGGYSGG--GGGY--SSRG 211
           G G GG H GG GGG  +G GGGY GGG G +GGGGG   GGGG  GG  GGGY      
Sbjct: 133 GGGAGGAHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGGGNGGGGGGGGAHGGGYGGGEGA 192

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G GG YGGG   G GG+GGG GGG GG GGGG
Sbjct: 193 GAGGGYGGG---GAGGHGGGGGGGKGGGGGGG 221

 Score =  105 bits (263), Expect = 1e-21
 Identities = 57/95 (60%), Positives = 62/95 (65%), Gaps = 6/95 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG-GYSGGG--GGYSSRGGG 217
           G GG GGH GGGGGG + GGGGG SG GG++GGG G   G G GY GGG  GG+   GGG
Sbjct: 199 GGGGAGGHGGGGGGG-KGGGGGGGSGAGGAHGGGYGAGGGAGEGYGGGGGEGGHGGGGGG 257

Query: 218 GGSYGGGRREGGGGY---GGGEGGGYGGSGGGGGW 313
           GG  GGG   GGGGY   G G GGG G   GGGG+
Sbjct: 258 GGGAGGG-GGGGGGYAAAGSGHGGGAGRGEGGGGY 291

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/114 (50%), Positives = 60/114 (52%), Gaps = 14/114 (12%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG-- 184
           G  I V+     G GGG G   G GG    GGGGG   GGG+ GGGGG   GG GY G  
Sbjct: 47  GYGIGVDAGVGVGGGGGEGGGAGYGGAEGIGGGGGGGHGGGAGGGGGGGPGGGSGYGGGS 106

Query: 185 --------GGGGYSSRGGGGGSYGGGRREG----GGGYGGGEGGGYGGSGGGGG 310
                   GGGG    GGGGGS GGG        GGGYGGGEG G GG  GGGG
Sbjct: 107 GEGGGAGYGGGGAGGHGGGGGSGGGGGGGAGGAHGGGYGGGEGAGAGGGYGGGG 160

 Score =  100 bits (248), Expect = 7e-20
 Identities = 53/93 (56%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGG--GGGYSGGGGS---YGGGGGRREGGGGYSGGGGGY 199
           A   G GGGGG  GGGGGG  +GG  GGGY  GGG+   YGGGGG     GG+ GGGGG 
Sbjct: 203 AGGHGGGGGGGKGGGGGGGSGAGGAHGGGYGAGGGAGEGYGGGGGE----GGHGGGGGGG 258

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 298
              GGGGG  GGG    G G+GGG G G GG G
Sbjct: 259 GGAGGGGGG-GGGYAAAGSGHGGGAGRGEGGGG 290

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/73 (50%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query: 104 GGGGYSGGGGSYGGG--GGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG 277
           G G  S     YG G   G   GGGG  GGG GY    GG    GGG   GGGG+GGG G
Sbjct: 37  GYGEKSSLHAGYGIGVDAGVGVGGGGGEGGGAGY----GGAEGIGGG---GGGGHGGGAG 89

Query: 278 GGYGG-SGGGGGW 313
           GG GG  GGG G+
Sbjct: 90  GGGGGGPGGGSGY 102

[118][TOP]
>UniRef100_B9SNV6 Glycine-rich cell wall structural protein 1.8, putative n=1
           Tax=Ricinus communis RepID=B9SNV6_RICCO
          Length = 414

 Score =  118 bits (296), Expect = 2e-25
 Identities = 63/96 (65%), Positives = 64/96 (66%), Gaps = 8/96 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG--GGGYSGG-GGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G GGGGG  GGGGGGY SGG  GGGY GG GG YG G G   G GG  GGGGG  S GG 
Sbjct: 284 GGGGGGGSGGGGGGGYGSGGAHGGGYGGGSGGGYGAGVGYGGGAGGGHGGGGG--SGGGA 341

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGG-----SGGGGG 310
           GG YG G    GGGYGGGEGGG+GG     SGGGGG
Sbjct: 342 GGGYGDGGLAHGGGYGGGEGGGHGGAAGGYSGGGGG 377

 Score =  107 bits (267), Expect = 4e-22
 Identities = 58/100 (58%), Positives = 61/100 (61%), Gaps = 12/100 (12%)
 Frame = +2

Query: 47  GSGGGGG----HRGGGGGGYRSGGGGGYSGG-----GGSYGGGGGRREGGGGYSGGGGGY 199
           GSGGG G    + GG GGG  +G GGGY GG     GG YGGGGG    GG   GGGGGY
Sbjct: 244 GSGGGYGAGNEYGGGHGGGSGAGAGGGYGGGPIGGAGGEYGGGGG----GGSGGGGGGGY 299

Query: 200 SSRGGGGGSYGGGRREGGG---GYGGGEGGGYGGSGGGGG 310
            S G  GG YGGG   G G   GYGGG GGG+GG GG GG
Sbjct: 300 GSGGAHGGGYGGGSGGGYGAGVGYGGGAGGGHGGGGGSGG 339

 Score =  104 bits (260), Expect = 3e-21
 Identities = 56/92 (60%), Positives = 58/92 (63%), Gaps = 6/92 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG------GGYSGGGGGYSSR 208
           G G GGGH GGGG G   G GGGY  GG ++GGG G  EGG      GGYSGGGGG  S 
Sbjct: 324 GGGAGGGHGGGGGSG--GGAGGGYGDGGLAHGGGYGGGEGGGHGGAAGGYSGGGGGGGSG 381

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
           GG GG Y  G    GGGYGGGEG G GG GGG
Sbjct: 382 GGSGGGYAAGNVH-GGGYGGGEGEG-GGHGGG 411

 Score =  104 bits (259), Expect = 3e-21
 Identities = 61/116 (52%), Positives = 65/116 (56%), Gaps = 20/116 (17%)
 Frame = +2

Query: 23  TVNEAQSRGSGGGGGHRGGGG-----GGYRSGGGGGYSGGGG--SYGGGG--GRREGGGG 175
           T+ E  S G GGGGG  GG G     GG+  GGGGG SG GG  +YG GG  G   G G 
Sbjct: 28  TLPEIPSGGYGGGGGQGGGAGYGGATGGHGGGGGGGGSGSGGGVAYGAGGEHGVGYGSGA 87

Query: 176 YSGGGGGYSSRGGGGGSYGGGRREGGG-----------GYGGGEGGGYGGSGGGGG 310
             GGGGGYS+ GG GG  GGG   G G           G GGGEGGG GG GGGGG
Sbjct: 88  GQGGGGGYSAAGGYGGGGGGGSGSGAGYGVGGEHGVGYGSGGGEGGGAGGYGGGGG 143

 Score =  103 bits (257), Expect = 6e-21
 Identities = 56/92 (60%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG-GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G GGGGG  GG G G   GGG GG SG G   G GGG   G GG  GGGGG  S GGGGG
Sbjct: 238 GGGGGGGSGGGYGAGNEYGGGHGGGSGAGAGGGYGGGPIGGAGGEYGGGGGGGSGGGGGG 297

Query: 224 SYGGGRREGGGGYGGGEGGGYG---GSGGGGG 310
            YG G   GGG YGGG GGGYG   G GGG G
Sbjct: 298 GYGSGGAHGGG-YGGGSGGGYGAGVGYGGGAG 328

 Score =  102 bits (253), Expect = 2e-20
 Identities = 53/92 (57%), Positives = 53/92 (57%), Gaps = 5/92 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           G GGGGG   G G GY  GG  G GY  GGG  GG GG   GGGG SG G GYS  G  G
Sbjct: 100 GYGGGGGGGSGSGAGYGVGGEHGVGYGSGGGEGGGAGGYGGGGGGGSGSGAGYSVGGEHG 159

Query: 221 GSYGGGRREGGG---GYGGGEGGGYGGSGGGG 307
             YG G  EGGG   GY G  G GYGG GGGG
Sbjct: 160 AGYGSGGGEGGGHGAGYAGEHGAGYGGGGGGG 191

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 56/102 (54%), Positives = 57/102 (55%), Gaps = 11/102 (10%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGG-------GRREGGGGYSGGG 190
           Q  G G GGG   GGG GY SGG  G GY GGGG   GGG       G   GGG  +G G
Sbjct: 211 QGVGCGSGGGK--GGGEGYGSGGEHGVGYGGGGGGGSGGGYGAGNEYGGGHGGGSGAGAG 268

Query: 191 GGYSSR--GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGY     GG GG YGGG   GGGG GGG GGGYG  G  GG
Sbjct: 269 GGYGGGPIGGAGGEYGGG---GGGGSGGGGGGGYGSGGAHGG 307

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 57/120 (47%), Positives = 60/120 (50%), Gaps = 28/120 (23%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSG----------------GGGGYSGGGGSYGGGG--GRR 160
           A   G+G GGG  GG GGGY S                 G GG  GGG  YG GG  G  
Sbjct: 177 AGEHGAGYGGGGGGGSGGGYGSAIGGEGAGPGGDQGVGCGSGGGKGGGEGYGSGGEHGVG 236

Query: 161 EGGGGYSGGGGGYSSRGGGGGSYGGGRREG-GGGYGGGE---------GGGYGGSGGGGG 310
            GGGG  G GGGY +    GG +GGG   G GGGYGGG          GGG GGSGGGGG
Sbjct: 237 YGGGGGGGSGGGYGAGNEYGGGHGGGSGAGAGGGYGGGPIGGAGGEYGGGGGGGSGGGGG 296

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/96 (53%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG--GGGYS-----GGGGSYGGGGGRREGGGGYSGGGGGYSS 205
           G GGGGG   GGG  Y +GG  G GY      GGGG Y   GG   GGGG SG G GY  
Sbjct: 58  GGGGGGGSGSGGGVAYGAGGEHGVGYGSGAGQGGGGGYSAAGGYGGGGGGGSGSGAGYGV 117

Query: 206 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
            G  G  YG G  EGGG  GG  GGG GGSG G G+
Sbjct: 118 GGEHGVGYGSGGGEGGGA-GGYGGGGGGGSGSGAGY 152

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 52/114 (45%), Positives = 53/114 (46%), Gaps = 14/114 (12%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG------GRREGGG 172
           G   +V      G G GGG  GG G GY    G GY GGGG   GGG      G   G G
Sbjct: 149 GAGYSVGGEHGAGYGSGGGEGGGHGAGYAGEHGAGYGGGGGGGSGGGYGSAIGGEGAGPG 208

Query: 173 GYSGGGGGYSSRGGGGGSYGGGRREG---GGGYGGGEGGGYG-----GSGGGGG 310
           G  G G G     GGG  YG G   G   GGG GGG GGGYG     G G GGG
Sbjct: 209 GDQGVGCGSGGGKGGGEGYGSGGEHGVGYGGGGGGGSGGGYGAGNEYGGGHGGG 262

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 50/102 (49%), Positives = 51/102 (50%), Gaps = 15/102 (14%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG--------GGYSGGGGGYS 202
           G G G G+ G  G GY  GGGGG  GG GS  GG G   GG        GG  GGG GY 
Sbjct: 169 GGGHGAGYAGEHGAGYGGGGGGGSGGGYGSAIGGEGAGPGGDQGVGCGSGGGKGGGEGYG 228

Query: 203 SRGGGGGSYGGGRREGGGG-------YGGGEGGGYGGSGGGG 307
           S G  G  YGGG   G GG       YGGG GGG G   GGG
Sbjct: 229 SGGEHGVGYGGGGGGGSGGGYGAGNEYGGGHGGGSGAGAGGG 270

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/86 (54%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGY-SGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 232
           G GG  GGG GGY  GGGGG  SG G S GG  G   G GG  GGG G    G  G  YG
Sbjct: 126 GSGGGEGGGAGGYGGGGGGGSGSGAGYSVGGEHGAGYGSGGGEGGGHGAGYAGEHGAGYG 185

Query: 233 GGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG   GGGG GGG G   GG G G G
Sbjct: 186 GG---GGGGSGGGYGSAIGGEGAGPG 208

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 52/112 (46%), Positives = 56/112 (50%), Gaps = 27/112 (24%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGG--------GGGYSGGGGSYGGGG-------GRREGGGGYSGG 187
           GG GG+ GGGGGG  SG         G GY  GGG  GG G       G   GGGG  G 
Sbjct: 133 GGAGGYGGGGGGGSGSGAGYSVGGEHGAGYGSGGGEGGGHGAGYAGEHGAGYGGGGGGGS 192

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGGGEGG------------GYGGSGGGG 307
           GGGY S  GG G+  GG +  G G GGG+GG            GYGG GGGG
Sbjct: 193 GGGYGSAIGGEGAGPGGDQGVGCGSGGGKGGGEGYGSGGEHGVGYGGGGGGG 244

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/83 (53%), Positives = 48/83 (57%), Gaps = 3/83 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGG---GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G G GGG+  GG   GGGY  G GGG+ G  G Y GGGG   GGG   G GGGY++    
Sbjct: 338 GGGAGGGYGDGGLAHGGGYGGGEGGGHGGAAGGYSGGGG---GGGSGGGSGGGYAAGNVH 394

Query: 218 GGSYGGGRREGGGGYGGGEGGGY 286
           GG YGGG      G GGG GGGY
Sbjct: 395 GGGYGGGE-----GEGGGHGGGY 412

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 57/114 (50%), Positives = 58/114 (50%), Gaps = 26/114 (22%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGG-------GRREGGGGYSGGGGGY 199
           G GGGGG   G G GY  GG  G GY  GGG  GG G       G   GGGG  G GGGY
Sbjct: 137 GYGGGGGGGSGSGAGYSVGGEHGAGYGSGGGEGGGHGAGYAGEHGAGYGGGGGGGSGGGY 196

Query: 200 SSRGGG-----GGSYG-----GGRREGGGGYG-GGE------GGGYGGSGGGGG 310
            S  GG     GG  G     GG + GG GYG GGE      GGG GGSGGG G
Sbjct: 197 GSAIGGEGAGPGGDQGVGCGSGGGKGGGEGYGSGGEHGVGYGGGGGGGSGGGYG 250

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 49/97 (50%), Positives = 52/97 (53%), Gaps = 9/97 (9%)
 Frame = +2

Query: 47  GSGGGGGHRGGG--GGGYRSGGG-----GGYSGGGGS-YGGGGGRREGGGGYSGGGGGYS 202
           GSG G G+  GG  G GY SGGG     GGY GGGG   G G G   GG   +G G G  
Sbjct: 108 GSGSGAGYGVGGEHGVGYGSGGGEGGGAGGYGGGGGGGSGSGAGYSVGGEHGAGYGSGGG 167

Query: 203 SRGGGGGSYGGGRREG-GGGYGGGEGGGYGGSGGGGG 310
             GG G  Y G    G GGG GGG GGGYG + GG G
Sbjct: 168 EGGGHGAGYAGEHGAGYGGGGGGGSGGGYGSAIGGEG 204

[119][TOP]
>UniRef100_Q8I519 Erythrocyte membrane protein 1, PfEMP1 n=1 Tax=Plasmodium
           falciparum 3D7 RepID=Q8I519_PLAF7
          Length = 2359

 Score =  118 bits (296), Expect = 2e-25
 Identities = 62/91 (68%), Positives = 62/91 (68%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG--GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           GSGGGGG  GGGG  GG  SGGGGG  GGGGS GGGG    GG G  GG GG    GGGG
Sbjct: 595 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGG 654

Query: 221 GSYGGGRREGGGGYGGGEG-GGYGGSGGGGG 310
           GS GGG   GGGG GGG G GG GGSGGGGG
Sbjct: 655 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG 685

 Score =  118 bits (296), Expect = 2e-25
 Identities = 62/91 (68%), Positives = 62/91 (68%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG--GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           GSGGGGG  GGGG  GG  SGGGGG  GGGGS GGGG    GG G  GG GG    GGGG
Sbjct: 601 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGG 660

Query: 221 GSYGGGRREGGGGYGGGEG-GGYGGSGGGGG 310
           GS GGG   GGGG GGG G GG GGSGGGGG
Sbjct: 661 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG 691

 Score =  114 bits (285), Expect = 3e-24
 Identities = 62/104 (59%), Positives = 66/104 (63%), Gaps = 1/104 (0%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           D++ +     E Q+R  G    H GGG GG    GGGG SGGGG  GGGGG   GGGG S
Sbjct: 569 DIEKKLEAFCETQNRSDGSSSVHVGGGSGGGGGSGGGGGSGGGGGSGGGGG--SGGGGGS 626

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG-GGYGGSGGGGG 310
           GGGGG    GGGGGS GGG   GGGG GGG G GG GGSGGGGG
Sbjct: 627 GGGGG---SGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG 667

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/81 (69%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG--GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           GSGGGGG  GGGG  GG  SGGGGG  GGGGS GGGG    GGGG SGGGGG    GGGG
Sbjct: 619 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG---SGGGGGSGGGGG---SGGGG 672

Query: 221 GSYGGGRREGGGGYGGGEGGG 283
           GS GGG   GGGG GGG G G
Sbjct: 673 GSGGGGGSGGGGGSGGGGGSG 693

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 34/55 (61%), Positives = 35/55 (63%), Gaps = 1/55 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           GSGGGGG  GGGG G   G GGGG SGGGG  GGGGG        SGGGGG  S+
Sbjct: 649 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG--------SGGGGGSGSK 695

[120][TOP]
>UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2U1_EHV86
          Length = 2873

 Score =  118 bits (295), Expect = 2e-25
 Identities = 59/91 (64%), Positives = 59/91 (64%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*L 133
            PPP P PP PPPSPPP PPPPS  PPP  P PPP    PP PP  PPPPS  PP PPP  
Sbjct: 2676 PPPSPPPPSPPPSPPPSPPPPS--PPP--PSPPPPSPPPPSPPPSPPPPSPPPPSPPPPS 2731

Query: 132  PPPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PPPP  PP  PPP   PPP PP   PPPPLP
Sbjct: 2732 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPLP 2762

 Score =  114 bits (284), Expect = 4e-24
 Identities = 56/90 (62%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PP PP PP PPPSPPP  PPPS  PPP   PPPP    P PPP  PPPPS  P PPP  P
Sbjct: 2667 PPSPPPPPSPPPSPPPPSPPPS--PPP--SPPPPSPPPPSPPPPSPPPPSPPPSPPPPSP 2722

Query: 129  PPPE*PP--PPPLRYPPPPPPRWPPPPPLP 46
            PPP  PP  PPP   PPP PP   PPPP P
Sbjct: 2723 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2752

 Score =  112 bits (281), Expect = 1e-23
 Identities = 57/100 (57%), Positives = 58/100 (58%), Gaps = 1/100 (1%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
            P P   +  PP PP P  PPPSPPP PPPPS  PP    PPPP    P PPP  PPPPS 
Sbjct: 2691 PSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSP 2747

Query: 156  LPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLPRD 40
             PP PPP  PPPP  P P P   PPPP P   PPPP P D
Sbjct: 2748 PPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPPD 2787

 Score =  111 bits (277), Expect = 3e-23
 Identities = 58/104 (55%), Positives = 60/104 (57%), Gaps = 6/104 (5%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LP--PPPPLEE*PPPPPLYPPP 166
            +P P+     PPP P P  PPPSPPP  PPP   PPP  P  PPPP    P PPP  PPP
Sbjct: 2675 SPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPP 2734

Query: 165  PSRLPP-PPP*LPPPPE*P---PPPPLRYPPPPPPRWPPPPPLP 46
            PS  PP PPP  PPPP  P   PPPPL   P PPP  PPP P P
Sbjct: 2735 PSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPP 2778

 Score =  109 bits (273), Expect = 8e-23
 Identities = 57/101 (56%), Positives = 59/101 (58%), Gaps = 3/101 (2%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            +P P+     PPP P PP PPP  PP P PP   PPP   PPPP    P PPP  PPPPS
Sbjct: 2684 SPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPP--SPPPPSPPPPSPPPPSPPPPS 2741

Query: 159  RLPP-PPP*LPPPPE*PPP-PPLRYPPP-PPPRWPPPPPLP 46
              PP PPP  PPPP  PPP PP   PPP PPP  PPP P P
Sbjct: 2742 PPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPP 2782

 Score =  103 bits (257), Expect = 6e-21
 Identities = 52/89 (58%), Positives = 52/89 (58%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPP P P  PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS    PPP LP
Sbjct: 2709 PPPSPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPS----PPPPLP 2762

Query: 129  PPPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
            P P  PP PP   PP PPP  PPP P  R
Sbjct: 2763 PAPSPPPSPP---PPSPPPSPPPPSPPDR 2788

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 49/77 (63%), Positives = 49/77 (63%)
 Frame = -3

Query: 276 PSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPL 97
           PSPPP PPPP       LPPPPP     PPPP  PPPPS  PPPPP  PPPP  PPPPP 
Sbjct: 203 PSPPPPPPPPP------LPPPPP-----PPPPPSPPPPSPPPPPPP-SPPPPSPPPPPP- 249

Query: 96  RYPPPPPPRWPPPPPLP 46
             P PPP   PPPPPLP
Sbjct: 250 --PSPPP---PPPPPLP 261

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 40/61 (65%), Positives = 40/61 (65%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           P PP PP PPP PPP PPPP   PPP  PPPPP    PPP P  PPPPS  PPPPP LP 
Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPT 262

Query: 126 P 124
           P
Sbjct: 263 P 263

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 50/83 (60%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = -3

Query: 303  PPPLPP*PPPSP-PPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PPP PP  PPSP PP PPPPS  PPP  P PPP    P PPP  PPPP   PP PP  PP
Sbjct: 2253 PPPSPP--PPSPHPPSPPPPS--PPP--PSPPP----PTPPPSPPPPPPTPPPSPP--PP 2300

Query: 126  PPE*PPPPPLRYPPPPPPRWPPP 58
             P  P PPP   P PPPP  PPP
Sbjct: 2301 SPPPPSPPP---PSPPPPSQPPP 2320

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/69 (63%), Positives = 44/69 (63%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
            PP P PP PPPSPPP PPPP  LPPP  PPPP     PPPP    PPPS  PP PP  PP
Sbjct: 2529 PPSPPPPSPPPSPPPSPPPP--LPPPPSPPPPS----PPPP---SPPPSPPPPSPPPSPP 2579

Query: 126  PPE*PPPPP 100
            PP  PP PP
Sbjct: 2580 PPSPPPYPP 2588

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 45/76 (59%), Positives = 45/76 (59%)
 Frame = -3

Query: 273  SPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLR 94
            SPPP PPPPS  PP   PP PP    PP PP   PPPS  PPPPP  PPP   PP PP  
Sbjct: 2252 SPPPSPPPPSPHPPSPPPPSPP----PPSPPPPTPPPS--PPPPPPTPPPSPPPPSPP-- 2303

Query: 93   YPPPPPPRWPPPPPLP 46
             PP PPP  PPPP  P
Sbjct: 2304 -PPSPPPPSPPPPSQP 2318

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 44/77 (57%), Positives = 45/77 (58%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
            P P   + HPP PP P  PPPSPPP  PPPS       PPPPP    P PPP  PPPPS 
Sbjct: 2255 PSPPPPSPHPPSPPPPSPPPPSPPPPTPPPS-------PPPPPPTPPPSPPPPSPPPPS- 2306

Query: 156  LPPPPP*LPPPPE*PPP 106
             PPPP   PPPP  PPP
Sbjct: 2307 -PPPPS--PPPPSQPPP 2320

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/76 (59%), Positives = 46/76 (60%)
 Frame = -3

Query: 288  P*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PP 109
            P  PPSPPP  PPPS  PPP   PPPPL     PPP  PPPPS  PP PP  PPPP  PP
Sbjct: 2526 PCSPPSPPPPSPPPS--PPP--SPPPPL-----PPPPSPPPPSPPPPSPPPSPPPPSPPP 2576

Query: 108  PPPLRYPPPPPPRWPP 61
             P    PPP PP +PP
Sbjct: 2577 SP----PPPSPPPYPP 2588

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/55 (65%), Positives = 36/55 (65%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPP 145
           PPPPP PP PPP  PP PPPPS  PPP  PPPPP    PP PP  PPPP  LP P
Sbjct: 217 PPPPPPPPSPPPPSPPPPPPPS--PPPPSPPPPP----PPSPP--PPPPPPLPTP 263

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 39/77 (50%), Positives = 39/77 (50%)
 Frame = -3

Query: 276  PSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPL 97
            P  PP PPPPS                PP PP  PPPP  LPPPP   PPPP  PPP P 
Sbjct: 2526 PCSPPSPPPPSP---------------PPSPPPSPPPP--LPPPPS--PPPPSPPPPSPP 2566

Query: 96   RYPPPPPPRWPPPPPLP 46
              PPPP P   PPPP P
Sbjct: 2567 PSPPPPSPPPSPPPPSP 2583

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 33/56 (58%), Positives = 33/56 (58%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPP 142
            PPP P P  PPP PPP  PPP   PPP  PP PP    PP PP  PPPPS  P PP
Sbjct: 2537 PPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPP----PPSPPPSPPPPSPPPYPP 2588

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 33/49 (67%), Positives = 33/49 (67%)
 Frame = -3

Query: 192  PPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPPP  PPPPS   PPPP  PPPP   PPPPL    PPPP  PPPPPLP
Sbjct: 1175 PPPPPSPPPPS---PPPPPSPPPPS--PPPPL----PPPPSPPPPPPLP 1214

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 35/63 (55%), Positives = 36/63 (57%)
 Frame = -3

Query: 273  SPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLR 94
            +PP  PPPPS        PPPP     PPPP  PPPPS    PPP LPPPP  PPPPPL 
Sbjct: 1171 NPPSPPPPPS--------PPPP----SPPPPPSPPPPS----PPPPLPPPPSPPPPPPLP 1214

Query: 93   YPP 85
              P
Sbjct: 1215 LIP 1217

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 34/60 (56%), Positives = 34/60 (56%)
 Frame = -3

Query: 300  PPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPP 121
            PP PP PP  PPP PPPP        P PPP    P PPP  PPPPS  PPPPP LP  P
Sbjct: 1172 PPSPPPPPSPPPPSPPPP--------PSPPP----PSPPPPLPPPPS--PPPPPPLPLIP 1217

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 31/49 (63%), Positives = 31/49 (63%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
            PPPPP PP  PPSPPP P PP   PPP LPPPP     PPPPP  P  P
Sbjct: 1175 PPPPPSPP--PPSPPPPPSPPPPSPPPPLPPPPS----PPPPPPLPLIP 1217

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 28/42 (66%), Positives = 29/42 (69%)
 Frame = -3

Query: 177 YPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
           +P PP   PPPPP LPPPP  PPPPP   P PPPP  PPPPP
Sbjct: 202 FPSPPP--PPPPPPLPPPP--PPPPP---PSPPPPSPPPPPP 236

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 29/44 (65%), Positives = 30/44 (68%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPL 205
           P P+     PPPPP P  PPPSPPP PPPPS  PPP  PPPPPL
Sbjct: 222 PPPSPPPPSPPPPPPPSPPPPSPPP-PPPPS--PPP--PPPPPL 260

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 26/41 (63%), Positives = 26/41 (63%)
 Frame = -3

Query: 168  PPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PPS   PPPP  PPPP  PPPPP   PP PPP  PPPP  P
Sbjct: 1172 PPS---PPPPPSPPPPS-PPPPPSPPPPSPPPPLPPPPSPP 1208

[121][TOP]
>UniRef100_Q9FIQ2 Genomic DNA, chromosome 5, P1 clone:MZA15 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FIQ2_ARATH
          Length = 268

 Score =  118 bits (295), Expect = 2e-25
 Identities = 59/94 (62%), Positives = 61/94 (64%), Gaps = 8/94 (8%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSG--GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG---G 217
           GGGGGH GGGGGG   G  GG GY GG G   GGGG   G GGY GGGGG S  GG   G
Sbjct: 166 GGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGG 225

Query: 218 GGSYGGGRREGGG---GYGGGEGGGYGGSGGGGG 310
           GG++GGG   GGG   GYGGG  GGYGG  GGGG
Sbjct: 226 GGAHGGGYGSGGGEGGGYGGGAAGGYGGGHGGGG 259

 Score =  110 bits (275), Expect = 5e-23
 Identities = 57/100 (57%), Positives = 61/100 (61%), Gaps = 8/100 (8%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGG---GGSYGGGGGRREGGGGYSGGGGGYS 202
           E    G+ G GG   GGGGG+  GGGGG +GG   G  YGGG G   GGGG  GG GGY 
Sbjct: 151 EGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYG 210

Query: 203 SRG----GGGGSYGGGRREGGG-GYGGGEGGGYGGSGGGG 307
             G    GGGG+YGGG   GGG G GGGEGGGYGG   GG
Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGG 250

 Score =  109 bits (273), Expect = 8e-23
 Identities = 54/93 (58%), Positives = 60/93 (64%), Gaps = 1/93 (1%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGS-YGGGGGRREGGGGYSGGGGGYSSRG 211
           A   G GGGGG+ GG  GG+  GGGGG  GGGGS YG GG    G G  +G GGG  + G
Sbjct: 101 ASGAGEGGGGGY-GGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASG 159

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG+YGGG   GGGG GG  GG +GGSG GGG
Sbjct: 160 YGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGG 192

 Score =  108 bits (269), Expect = 2e-22
 Identities = 55/87 (63%), Positives = 56/87 (64%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GSG GGG  GG GGG   GG GGY GGGG   GGGG   GGG +   GGGY S GG GG 
Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAH---GGGYGSGGGEGGG 242

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGG 307
           YGGG     GGYGGG GGG GG GGGG
Sbjct: 243 YGGG---AAGGYGGGHGGG-GGHGGGG 265

 Score =  107 bits (267), Expect = 4e-22
 Identities = 57/101 (56%), Positives = 59/101 (58%), Gaps = 9/101 (8%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           A+   SGGG GH GGGGG   SGG   G   GGGG YGG  G   GGGG   GGGG S+ 
Sbjct: 76  AEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAY 135

Query: 209 GGGG---GSYGGGRREGGG----GYGGGEGGGYGGSGGGGG 310
           G GG     YG G  EGGG    GYGGG  GG GG GGGGG
Sbjct: 136 GAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGG 176

 Score =  103 bits (258), Expect = 5e-21
 Identities = 60/102 (58%), Positives = 62/102 (60%), Gaps = 14/102 (13%)
 Frame = +2

Query: 47  GSGGGGG--------HRGGGGGGYRSGGGGGYSG-GGGSYGGGGGRREGGGGYSGGG--G 193
           GSGGGGG        H  G G G   GGG G SG GGG+YGGGGG   GGGG S GG  G
Sbjct: 126 GSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHG 185

Query: 194 GYSSRGG-GGGSYGGGRREGGGGYGGGEGGGYGGSG--GGGG 310
           G    GG GGG+ GGG   G GGYGGG GGG GG G  GGGG
Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227

 Score =  103 bits (257), Expect = 6e-21
 Identities = 56/101 (55%), Positives = 60/101 (59%), Gaps = 9/101 (8%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGG--------GGGYSGGGGSYGGGGGRREGGGGYSGGG 190
           A     GGGGG  GGGG  Y +GG        G G  GG G+ G GGG   GGGG+ GGG
Sbjct: 116 AGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGG 175

Query: 191 GGYSSRGGGGGS-YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG S+ G  GGS YGGG  EGGG  GGG  GG GG GGGGG
Sbjct: 176 GGGSAGGAHGGSGYGGG--EGGGAGGGGSHGGAGGYGGGGG 214

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 59/102 (57%), Positives = 61/102 (59%), Gaps = 15/102 (14%)
 Frame = +2

Query: 50  SGGGGGHRGGGG-GGYRSGGGGGYSGGGGSYGGGGGRREGGG-----GYSGGGGGYSSRG 211
           + GGGGH GGGG GG  SGG GG SGGG  YGGG G   GGG     GY+ GGG     G
Sbjct: 33  ASGGGGHGGGGGSGGVSSGGYGGESGGG--YGGGSGEGAGGGYGGAEGYASGGGSGHGGG 90

Query: 212 GGG----GSYGGGRREGGGG-YGGG----EGGGYGGSGGGGG 310
           GGG    G Y  G  EGGGG YGG      GGG GGSGGGGG
Sbjct: 91  GGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGG 132

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 40/70 (57%), Positives = 42/70 (60%), Gaps = 4/70 (5%)
 Frame = +2

Query: 113 GYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREG-GGGYGGGEG---G 280
           G + GGG +GGGGG     GG S GG G    G  GG YGGG  EG GGGYGG EG   G
Sbjct: 31  GQASGGGGHGGGGG----SGGVSSGGYG----GESGGGYGGGSGEGAGGGYGGAEGYASG 82

Query: 281 GYGGSGGGGG 310
           G  G GGGGG
Sbjct: 83  GGSGHGGGGG 92

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 34/54 (62%), Positives = 38/54 (70%), Gaps = 2/54 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGG--GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYS 202
           GSGGGG + GGG  GGGY SGGG G   GGG+ GG GG   GGGG+  GGGGY+
Sbjct: 216 GSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGHGGGGGH--GGGGYA 267

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 30/55 (54%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +2

Query: 152 GRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGS-GGGGGW 313
           G+  GGGG+ GGGG   S G   G YGG   E GGGYGGG G G GG  GG  G+
Sbjct: 31  GQASGGGGHGGGGG---SGGVSSGGYGG---ESGGGYGGGSGEGAGGGYGGAEGY 79

[122][TOP]
>UniRef100_UPI0000DB7202 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera
           RepID=UPI0000DB7202
          Length = 344

 Score =  117 bits (293), Expect = 4e-25
 Identities = 62/100 (62%), Positives = 63/100 (63%), Gaps = 14/100 (14%)
 Frame = +2

Query: 50  SGGGGGHRGGGGGGYRSGGGGGYSGGG----------GSYGGGGG---RREGGGGYSGGG 190
           SGGG G+ GGGGGGY  G GGGYSGGG          G Y GGGG      GGGGYSGGG
Sbjct: 235 SGGGNGYSGGGGGGYSGGNGGGYSGGGNGGGYSGGNGGGYSGGGGGGYSGGGGGGYSGGG 294

Query: 191 GGYSSRGGGGGSYGGGRREGG-GGYGGGEGGGYGGSGGGG 307
            GYS  GGGG S G G   GG GGY GG GGGY G GGGG
Sbjct: 295 NGYSGGGGGGYSGGNGGYSGGNGGYSGG-GGGYSGGGGGG 333

 Score =  113 bits (282), Expect = 7e-24
 Identities = 65/121 (53%), Positives = 67/121 (55%), Gaps = 30/121 (24%)
 Frame = +2

Query: 35  AQSRGSGGGGGH--------RGGGGGGYRS------GGGGGYSG----------GGGSYG 142
           A SRG GGGGG          GGGGGG  +      GGG GYS           GGGS+G
Sbjct: 163 APSRGGGGGGGSISSSYGAPTGGGGGGPSTTYGAPNGGGNGYSRPSSTYGTPSTGGGSFG 222

Query: 143 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREG------GGGYGGGEGGGYGGSGGG 304
           G GG   GGGGYSGGG GYS  GGGGG Y GG   G      GGGY GG GGGY G GGG
Sbjct: 223 GSGGYSGGGGGYSGGGNGYS--GGGGGGYSGGNGGGYSGGGNGGGYSGGNGGGYSGGGGG 280

Query: 305 G 307
           G
Sbjct: 281 G 281

 Score =  113 bits (282), Expect = 7e-24
 Identities = 62/100 (62%), Positives = 63/100 (63%), Gaps = 9/100 (9%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGG-GGSYGGGGGRREGGGGYSGG-GGGYSSRGG 214
           S G  GGGG   GGG GY  GGGGGYSGG GG Y GGG     GGGYSGG GGGYS  GG
Sbjct: 224 SGGYSGGGGGYSGGGNGYSGGGGGGYSGGNGGGYSGGG----NGGGYSGGNGGGYSGGGG 279

Query: 215 GG--GSYGGGRREGGGGYGGGEGGGYGG-----SGGGGGW 313
           GG  G  GGG   GG GY GG GGGY G     SGG GG+
Sbjct: 280 GGYSGGGGGGYSGGGNGYSGGGGGGYSGGNGGYSGGNGGY 319

 Score =  108 bits (271), Expect = 1e-22
 Identities = 60/96 (62%), Positives = 61/96 (63%), Gaps = 8/96 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSY-GGGGGRREG--GGGYSGGGGGYSSRGGG 217
           G+   GG   GG GGY SGGGGGYSGGG  Y GGGGG   G  GGGYSGGG G    GG 
Sbjct: 212 GTPSTGGGSFGGSGGY-SGGGGGYSGGGNGYSGGGGGGYSGGNGGGYSGGGNGGGYSGGN 270

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGG-----SGGGGG 310
           GG Y GG   GGGGY GG GGGY G     SGGGGG
Sbjct: 271 GGGYSGG---GGGGYSGGGGGGYSGGGNGYSGGGGG 303

 Score =  105 bits (263), Expect = 1e-21
 Identities = 52/80 (65%), Positives = 53/80 (66%), Gaps = 2/80 (2%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSY--GGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG+ GGGGGGY  GGGGGYSGGG  Y  GGGGG   G GGYSGG GGYS   GGGG 
Sbjct: 269 GNGGGYSGGGGGGYSGGGGGGYSGGGNGYSGGGGGGYSGGNGGYSGGNGGYS---GGGGG 325

Query: 227 YGGGRREGGGGYGGGEGGGY 286
           Y GG   GGGG      GGY
Sbjct: 326 YSGG---GGGGQSYASNGGY 342

 Score =  102 bits (254), Expect = 1e-20
 Identities = 55/93 (59%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = +2

Query: 47  GSGGG--G----GHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           G+GGG  G    G+ GGGGGGY  GGGGGYSGGG  Y GG     GGGGYSGG GGYS  
Sbjct: 261 GNGGGYSGGNGGGYSGGGGGGYSGGGGGGYSGGGNGYSGG-----GGGGYSGGNGGYS-- 313

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
            GG G Y G    GGGGY GG GGG   +  GG
Sbjct: 314 -GGNGGYSG----GGGGYSGGGGGGQSYASNGG 341

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/71 (61%), Positives = 44/71 (61%)
 Frame = +2

Query: 50  SGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 229
           SGGGGG   GGG GY  GGGGGYSGG G Y G      G GGYSGGGGGYS  GGGG SY
Sbjct: 283 SGGGGGGYSGGGNGYSGGGGGGYSGGNGGYSG------GNGGYSGGGGGYSGGGGGGQSY 336

Query: 230 GGGRREGGGGY 262
                   GGY
Sbjct: 337 A-----SNGGY 342

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 47/99 (47%), Positives = 49/99 (49%), Gaps = 12/99 (12%)
 Frame = +2

Query: 53  GGGGGHRGGGG-----GGYRSGGGGGYSGGGGSYG-----GGGGRREGGGGYSGGGGGYS 202
           GGGGG  GG G     G    GGGGG      SYG     GGGG     G  +GGG GYS
Sbjct: 146 GGGGGFGGGNGLSTSYGAPSRGGGGGGGSISSSYGAPTGGGGGGPSTTYGAPNGGGNGYS 205

Query: 203 --SRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
             S   G  S GGG   G GGY GG GG    SGGG G+
Sbjct: 206 RPSSTYGTPSTGGGSFGGSGGYSGGGGG---YSGGGNGY 241

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 46/104 (44%), Positives = 48/104 (46%), Gaps = 20/104 (19%)
 Frame = +2

Query: 59  GGGHRGGGGGGYRSGGGGGYSGGGG---SYG----GGGGRREGGGGYSGGGGGYSSRGGG 217
           GGG      G    GGGGG+ GG G   SYG    GGGG   GGG  S   G  +  GGG
Sbjct: 132 GGGRPSSSYGAPSFGGGGGFGGGNGLSTSYGAPSRGGGG---GGGSISSSYGAPTGGGGG 188

Query: 218 GGSYGGGRREGGG-GY------------GGGEGGGYGGSGGGGG 310
           G S   G   GGG GY            GGG  GG GG  GGGG
Sbjct: 189 GPSTTYGAPNGGGNGYSRPSSTYGTPSTGGGSFGGSGGYSGGGG 232

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 56/175 (32%), Positives = 59/175 (33%), Gaps = 74/175 (42%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYR---------SGGGGGYSG--GGGSYGGGGG- 154
           GR  +   A S G G      G     Y          S GGG  S   G  S+GGGGG 
Sbjct: 92  GRPSSTYGAPSNGGGRPSSSYGAPSSSYGAPSSTYGAPSNGGGRPSSSYGAPSFGGGGGF 151

Query: 155 --------------RREGGGGYS------------------------GGGGGYSS----- 205
                         R  GGGG S                        GGG GYS      
Sbjct: 152 GGGNGLSTSYGAPSRGGGGGGGSISSSYGAPTGGGGGGPSTTYGAPNGGGNGYSRPSSTY 211

Query: 206 ----------------RGGGGGSYGGGR---REGGGGYGGGEGGGYGGSGGGGGW 313
                            GGGGG  GGG      GGGGY GG GGGY G G GGG+
Sbjct: 212 GTPSTGGGSFGGSGGYSGGGGGYSGGGNGYSGGGGGGYSGGNGGGYSGGGNGGGY 266

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 43/115 (37%), Positives = 46/115 (40%), Gaps = 28/115 (24%)
 Frame = +2

Query: 50  SGGGGGHRGGGGG-------------GYRSGGGGGYSGGGGSYGGGGGRREGGGG----- 175
           SGGGGG      G             G  S GGG  S   G+   GGGR     G     
Sbjct: 59  SGGGGGRPSSSYGAPSSTYGAPSSTYGAPSNGGGRPSSTYGAPSNGGGRPSSSYGAPSSS 118

Query: 176 YSGGGGGYSSRGGGGG----SYGGGRREGGGGYGGGEG--GGYG----GSGGGGG 310
           Y      Y +   GGG    SYG     GGGG+GGG G    YG    G GGGGG
Sbjct: 119 YGAPSSTYGAPSNGGGRPSSSYGAPSFGGGGGFGGGNGLSTSYGAPSRGGGGGGG 173

[123][TOP]
>UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1
            Tax=Ostreococcus tauri RepID=Q010M7_OSTTA
          Length = 1449

 Score =  117 bits (293), Expect = 4e-25
 Identities = 58/92 (63%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = -3

Query: 306  PPPPLPP*PPP--SPPPYPPPPSRLPPP*--LPPPPPLEE*PPPPPLYPPPPSRLPPP-P 142
            PPPPLPP PPP  SPPP PPPPS  PPP    PP PP    PPPPP  PPPPS  PPP P
Sbjct: 791  PPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSP 850

Query: 141  P*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            P  P PP  P PPP   PPPPP   P PPP P
Sbjct: 851  PPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSP 882

 Score =  114 bits (286), Expect = 3e-24
 Identities = 54/90 (60%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = -3

Query: 309  PPPPPLPP*PP--PSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP* 136
            PPPPP PP PP  P+PP  PPPPS  PPP  PPPP     P PPP   PPP   PPP P 
Sbjct: 808  PPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPT 867

Query: 135  LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
             PPPP  PP PP   P PPPP  PPPPP P
Sbjct: 868  PPPPPSPPPSPP---PSPPPPPSPPPPPSP 894

 Score =  110 bits (276), Expect = 4e-23
 Identities = 58/108 (53%), Positives = 58/108 (53%), Gaps = 20/108 (18%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PPPP  PP P PSPPP PPP    PPP  PPP P    PPPPP  PP P   PPPPP  P
Sbjct: 833  PPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPT---PPPPPSPPPSPPPSPPPPPSPP 889

Query: 129  PPPE*PP--------------PPPLRYPP----PPPPRWPPP--PPLP 46
            PPP  PP              PPPL  PP    PPPP  PPP  PPLP
Sbjct: 890  PPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLP 937

 Score =  110 bits (276), Expect = 4e-23
 Identities = 66/131 (50%), Positives = 66/131 (50%), Gaps = 35/131 (26%)
 Frame = -3

Query: 336  PKPN*RNYHPPP---PPLPP*PPPSPPPYPPPPSRLPPP*LPPP---------PPLEE*P 193
            P PN     PPP   PP PP PPPSPPP PPPP   PPP  PPP         PPL   P
Sbjct: 858  PPPN-----PPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPP 912

Query: 192  P---PPPL-YPPPPSRLPPPPP*LPP----PPE*PPPP---------------PLRYPPP 82
            P   PPPL  PPPPS  PPP P LPP    PP  PPPP               P   PPP
Sbjct: 913  PLSSPPPLSSPPPPSSPPPPSPPLPPSPPLPPNPPPPPSPSPXXXXXXXPPRLPTPSPPP 972

Query: 81   PPPRWPPPPPL 49
            P P  PPPPPL
Sbjct: 973  PSPPLPPPPPL 983

 Score =  108 bits (270), Expect = 2e-22
 Identities = 55/92 (59%), Positives = 55/92 (59%), Gaps = 6/92 (6%)
 Frame = -3

Query: 303  PPPLPP*P-PPSPPPYPPPPSRLPPP*LPPP--PPLEE*PPPPPLYPPPPSRLPPP---P 142
            PPP PP P PPSPPP P PP   PPP  PPP  PP    PPPPP  PPPPS  PPP   P
Sbjct: 787  PPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSP 846

Query: 141  P*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            P  PPP   PPPPP   P P PP  P PPP P
Sbjct: 847  PPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSP 878

 Score =  108 bits (269), Expect = 2e-22
 Identities = 52/87 (59%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
            PP PP PP PPP P P PPPPS  PPP   PPP     P PPP   PPP+  PPPPP  P
Sbjct: 817  PPNPPTPPSPPPPPSP-PPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPP 875

Query: 129  P-PPE*PPPPPLRYPPPPPPRWPPPPP 52
            P PP  PPPPP   PPP PP  P PPP
Sbjct: 876  PSPPPSPPPPPSPPPPPSPPPSPSPPP 902

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/96 (58%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = -3

Query: 309  PPPPPLPP*PPPSPPPYP-PPPSRLPPP*LPPPPPLEE*PPPPPLYP----PPPSRLPP- 148
            PPP P PP PPP+PPP P PPP   PPP  PP PP    PPPPP  P    PPPS  PP 
Sbjct: 850  PPPAPSPP-PPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPL 908

Query: 147  --PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
              PPP   PPP   PPPP   PPPP P  PP PPLP
Sbjct: 909  SSPPPLSSPPPLSSPPPP-SSPPPPSPPLPPSPPLP 943

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/78 (61%), Positives = 48/78 (61%), Gaps = 2/78 (2%)
 Frame = -3

Query: 273 SPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLR 94
           SPPP PPPP  LPP   PPPPP     PPPP  PPPP   PPPPP  P PP  PPPPP  
Sbjct: 786 SPPPSPPPP--LPPS--PPPPP----SPPPP--PPPP--SPPPPPNPPTPPS-PPPPPSP 832

Query: 93  YPPP--PPPRWPPPPPLP 46
            PPP  PPP  P PPP P
Sbjct: 833 PPPPSSPPPPSPSPPPSP 850

[124][TOP]
>UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4IYP5_MAIZE
          Length = 441

 Score =  117 bits (293), Expect = 4e-25
 Identities = 60/104 (57%), Positives = 62/104 (59%), Gaps = 7/104 (6%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LP--PPPPLEE*PPPPPL----Y 175
           P P+     PPPP + P PP  PPP PPPP  LPPP  P  PPPPL   PPPPPL     
Sbjct: 260 PPPSPPPPSPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPHS 319

Query: 174 PPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPP-RWPPPPPLP 46
           PPPP   PPPPP LP P    PPPPL  PPPPPP    PPPP P
Sbjct: 320 PPPPLSSPPPPPPLPQPHS--PPPPLSSPPPPPPLPHSPPPPSP 361

 Score =  112 bits (280), Expect = 1e-23
 Identities = 64/127 (50%), Positives = 65/127 (51%), Gaps = 26/127 (20%)
 Frame = -3

Query: 348 FIGNPKPN*RNYH------PPPPPLPP*PPPSPP-PYPPPPSRLPPP*LPPPP-PLEE*P 193
           F   P  N   +H      P PPP  P PPPSPP P PPPPS  PP   PPPP P    P
Sbjct: 227 FYARPPVNCAAFHCKPFVPPMPPPRLPSPPPSPPPPSPPPPSPPPPLMSPPPPSPPPPSP 286

Query: 192 PPPPLYPPPPSRLPPPPP*LPPPPE*P------PPPPLRYPPPPPP------------RW 67
           PPPPL PPPP    PPPP   PPP  P      PPPPL  PPPPPP              
Sbjct: 287 PPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSP 346

Query: 66  PPPPPLP 46
           PPPPPLP
Sbjct: 347 PPPPPLP 353

 Score =  109 bits (272), Expect = 1e-22
 Identities = 63/121 (52%), Positives = 65/121 (53%), Gaps = 24/121 (19%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPP----------SRLPPP*LP----PPPPLEE 199
           P P      PPPP  PP  PP PP  PPPP          S  PPP LP    PPPPL  
Sbjct: 267 PSPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSS 326

Query: 198 *PPPPPL----YPPPPSRLPPPPP*LP--PPPE*PPPPPLRYPPPPPPRWPP----PPPL 49
            PPPPPL     PPPP   PPPPP LP  PPP  P P P+ Y PPPPP+ PP    PPPL
Sbjct: 327 PPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPPPSPAPAPV-YHPPPPPQCPPCPVLPPPL 385

Query: 48  P 46
           P
Sbjct: 386 P 386

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/102 (56%), Positives = 60/102 (58%), Gaps = 15/102 (14%)
 Frame = -3

Query: 312 HPPPPPL--PP*PPPSPPPYPPPP---SRLPPP*LP----PPPPLEE*PPPPPL--YPPP 166
           H PPPPL  PP PPP P P+ PPP   S  PPP LP    PPPPL   PPPPPL   PPP
Sbjct: 299 HSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPP 358

Query: 165 PSRLPPPPP*LPPPPE*PP----PPPLRYPPPPPPRWPPPPP 52
           PS  P P    PPPP+ PP    PPPL   P  P  WPPPPP
Sbjct: 359 PSPAPAPVYHPPPPPQCPPCPVLPPPLPCTPTHP--WPPPPP 398

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 60/133 (45%), Positives = 64/133 (48%), Gaps = 36/133 (27%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPL--PP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPP-----PL 178
           P P     H PPPPL  PP PPP P P+ PPP    P   PPPPPL   PPPP     P+
Sbjct: 310 PPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSP---PPPPPLPHSPPPPSPAPAPV 366

Query: 177 YPPPPSRLPPPPP*LPPP-------PE*PPPP----------PLRYPPPPPPR----WPP 61
           Y PPP    PP P LPPP       P  PPPP          P+RY  PPPP+    WPP
Sbjct: 367 YHPPPPPQCPPCPVLPPPLPCTPTHPWPPPPPYYPGPFPPTDPVRYASPPPPQQHHPWPP 426

Query: 60  --------PPPLP 46
                   PPP P
Sbjct: 427 VYPVQYGSPPPPP 439

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/81 (44%), Positives = 39/81 (48%), Gaps = 8/81 (9%)
 Frame = -3

Query: 315 YHPPPPP-LPP*PPPSPP-------PYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
           YHPPPPP  PP P   PP       P+PPPP   P P  PP  P+          PPPP 
Sbjct: 367 YHPPPPPQCPPCPVLPPPLPCTPTHPWPPPPPYYPGP-FPPTDPVRY------ASPPPPQ 419

Query: 159 RLPPPPP*LPPPPE*PPPPPL 97
           +  P PP  P     PPPPPL
Sbjct: 420 QHHPWPPVYPVQYGSPPPPPL 440

[125][TOP]
>UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii
           RepID=A8HQ72_CHLRE
          Length = 338

 Score =  117 bits (293), Expect = 4e-25
 Identities = 62/95 (65%), Positives = 67/95 (70%)
 Frame = +2

Query: 20  ITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 199
           + V+  +  G+GGGGG  GGGGGG+  GGGGGY GGGG YGGG     GGGGY GGGGGY
Sbjct: 74  VEVSHGRRGGAGGGGGGFGGGGGGF-GGGGGGYGGGGG-YGGG-----GGGGYGGGGGGY 126

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
              GGGGG YGG    GGGGYGGG GGG GG GGG
Sbjct: 127 ---GGGGGGYGG----GGGGYGGG-GGGSGGGGGG 153

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/82 (67%), Positives = 57/82 (69%)
 Frame = +2

Query: 65  GHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRR 244
           G RGG GGG     GGG+ GGGG +GGGGG   GGGGY GGGGG    GGGGG YGG   
Sbjct: 79  GRRGGAGGG-----GGGFGGGGGGFGGGGGGYGGGGGYGGGGGG--GYGGGGGGYGG--- 128

Query: 245 EGGGGYGGGEGGGYGGSGGGGG 310
            GGGGYGGG GGGYGG GGG G
Sbjct: 129 -GGGGYGGG-GGGYGGGGGGSG 148

 Score =  100 bits (248), Expect = 7e-20
 Identities = 47/73 (64%), Positives = 48/73 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGGY  GGG G  GGGG  GGGGG   GGGGY GGGGGY   GGG G 
Sbjct: 90  GFGGGGGGFGGGGGGYGGGGGYGGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGSGG 149

Query: 227 YGGGRREGGGGYG 265
            GGGR  G   +G
Sbjct: 150 GGGGRSLGPNPFG 162

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 38/59 (64%), Positives = 41/59 (69%)
 Frame = +2

Query: 134 SYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           S+G  GG   GGGG+ GGGGG+   GGGGG YG     GGGGYGGG GGGYGG GGG G
Sbjct: 77  SHGRRGGAGGGGGGFGGGGGGF---GGGGGGYG-----GGGGYGGGGGGGYGGGGGGYG 127

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 42/68 (61%), Positives = 44/68 (64%), Gaps = 2/68 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYS--GGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           G GGGGG+ GGGGGGY  GGGG     GGGG YGGGGG   GGGG SGGGGG   R  G 
Sbjct: 104 GYGGGGGYGGGGGGGYGGGGGG---YGGGGGGYGGGGGGYGGGGGGSGGGGG--GRSLGP 158

Query: 221 GSYGGGRR 244
             +G  RR
Sbjct: 159 NPFGPSRR 166

[126][TOP]
>UniRef100_Q2QQ97 Os12g0502200 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q2QQ97_ORYSJ
          Length = 258

 Score =  117 bits (292), Expect = 5e-25
 Identities = 66/127 (51%), Positives = 72/127 (56%), Gaps = 24/127 (18%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSR-------GSGGGGGHRGGGGGGYRSGG---GGGYSGGG--GSYGG 145
           DLDGR+I VN A  R       G G GGG  GGGGGGY  GG   GGGY GGG  G  GG
Sbjct: 96  DLDGRNIRVNTANERTGGFRSGGGGYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSGGGGG 155

Query: 146 GGGRREGGGGYSGGGGGYSSRGGGGGSYG----------GGRREGGGGYGGGEGGGYGGS 295
           GGG + GGGGY G  GGY +RGGGGG YG          G    G G +GG   G +G +
Sbjct: 156 GGGYQGGGGGYGGNNGGYGNRGGGGGGYGVAEGSADAFSGINLGGDGSFGGNPAGSFGDA 215

Query: 296 GG--GGG 310
           GG  GGG
Sbjct: 216 GGSTGGG 222

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 40/89 (44%), Positives = 47/89 (52%), Gaps = 1/89 (1%)
 Frame = +2

Query: 41  SRGSGGGGGH-RGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           S G GGGGG+  GGGG G  +GG G   GGGG YG   G  +   G + GG G S  G  
Sbjct: 150 SGGGGGGGGYQGGGGGYGGNNGGYGNRGGGGGGYGVAEGSADAFSGINLGGDG-SFGGNP 208

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
            GS+G    + GG  GGG+  G GG   G
Sbjct: 209 AGSFG----DAGGSTGGGDFSGAGGDSFG 233

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 31/73 (42%), Positives = 39/73 (53%), Gaps = 6/73 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGG--YRSGGGGGYS----GGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           G+ GG G+RGGGGGG     G    +S    GG GS+GG      G  G S GGG +S  
Sbjct: 168 GNNGGYGNRGGGGGGYGVAEGSADAFSGINLGGDGSFGGNPAGSFGDAGGSTGGGDFS-- 225

Query: 209 GGGGGSYGGGRRE 247
           G GG S+G  + +
Sbjct: 226 GAGGDSFGSRKND 238

[127][TOP]
>UniRef100_B7P0W1 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7P0W1_IXOSC
          Length = 144

 Score =  117 bits (292), Expect = 5e-25
 Identities = 61/90 (67%), Positives = 61/90 (67%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           Q RG GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGG
Sbjct: 65  QKRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGG----GGG 117

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GG  GGG   GGGG GGG GGG GG GGGG
Sbjct: 118 GGGGGGG---GGGGGGGGGGGGGGGGGGGG 144

 Score =  112 bits (279), Expect = 2e-23
 Identities = 55/80 (68%), Positives = 55/80 (68%)
 Frame = +2

Query: 71  RGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREG 250
           RGGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG  GGG   G
Sbjct: 67  RGGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123

Query: 251 GGGYGGGEGGGYGGSGGGGG 310
           GGG GGG GGG GG GGGGG
Sbjct: 124 GGGGGGGGGGGGGGGGGGGG 143

 Score =  101 bits (252), Expect = 2e-20
 Identities = 48/72 (66%), Positives = 49/72 (68%)
 Frame = +2

Query: 95  RSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGE 274
           + GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG  GGG   GGGG GGG 
Sbjct: 66  KRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 125

Query: 275 GGGYGGSGGGGG 310
           GGG GG GGGGG
Sbjct: 126 GGGGGGGGGGGG 137

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 47/73 (64%), Positives = 49/73 (67%)
 Frame = +2

Query: 92  YRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG 271
           ++  GGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG  GGG   GGGG GGG
Sbjct: 64  FQKRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123

Query: 272 EGGGYGGSGGGGG 310
            GGG GG GGGGG
Sbjct: 124 GGGGGGGGGGGGG 136

[128][TOP]
>UniRef100_P27484 Glycine-rich protein 2 n=1 Tax=Nicotiana sylvestris
           RepID=GRP2_NICSY
          Length = 214

 Score =  117 bits (292), Expect = 5e-25
 Identities = 61/101 (60%), Positives = 64/101 (63%)
 Frame = +2

Query: 8   DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
           DGR+  V+     G+   GG  GGGGGG R  GGGGY GG G YGGGG  R G  GY GG
Sbjct: 64  DGRTKAVDVTGPDGAAVQGGRGGGGGGGGR--GGGGYGGGSGGYGGGG--RGGSRGYGGG 119

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGY    GGGG YGGG R GGGG G G GGGYGG G GGG
Sbjct: 120 DGGY----GGGGGYGGGSRYGGGGGGYGGGGGYGGGGSGGG 156

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 52/91 (57%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSS---RGGG 217
           G GG GG RG GGG    GGGGGY GGG  YGGGGG   GGGGY GGG G  S   + G 
Sbjct: 106 GGGGRGGSRGYGGGDGGYGGGGGY-GGGSRYGGGGGGYGGGGGYGGGGSGGGSGCFKCGE 164

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            G +     + GGG GGG  GG GG GGGGG
Sbjct: 165 SGHFARDCSQSGGGGGGGRFGGGGGGGGGGG 195

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 45/91 (49%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG-GGGGRREGGGGYSGGGGGYSSRGGG 217
           SR  GGGGG+  GGGGGY   GGGG  GG G +  G  G        SGGGGG    GGG
Sbjct: 133 SRYGGGGGGY--GGGGGY---GGGGSGGGSGCFKCGESGHFARDCSQSGGGGGGGRFGGG 187

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  GGG   GGG Y  GE G +      GG
Sbjct: 188 GG--GGG---GGGCYKCGEDGHFARECTSGG 213

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/90 (44%), Positives = 42/90 (46%), Gaps = 21/90 (23%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGG---------------------SYGGGGGRRE 163
           G  GGG   GGGGGGY  GGGGGY GGG                      S GGGGG R 
Sbjct: 127 GGYGGGSRYGGGGGGY--GGGGGYGGGGSGGGSGCFKCGESGHFARDCSQSGGGGGGGRF 184

Query: 164 GGGGYSGGGGGYSSRGGGGGSYGGGRREGG 253
           GGGG  GGGGG   + G  G +      GG
Sbjct: 185 GGGG-GGGGGGGCYKCGEDGHFARECTSGG 213

[129][TOP]
>UniRef100_O70133-2 Isoform 2 of ATP-dependent RNA helicase A n=1 Tax=Mus musculus
            RepID=O70133-2
          Length = 1381

 Score =  117 bits (292), Expect = 5e-25
 Identities = 60/100 (60%), Positives = 63/100 (63%), Gaps = 14/100 (14%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGG----GGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
            G G GGG  GGGGGG+  GGGGG+ GG    GG +GG GG   GGGGY  GGGGY   GG
Sbjct: 1225 GFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGGGGFGGSGGFGNGGGGYGVGGGGYG--GG 1282

Query: 215  GGGSYGGGRRE-GGGGYGGGEG---------GGYGGSGGG 304
            GGG YGGG    GGGGYGGGEG         G YGG GGG
Sbjct: 1283 GGGGYGGGSGGYGGGGYGGGEGYSISPNSYRGNYGGGGGG 1322

 Score =  116 bits (290), Expect = 9e-25
 Identities = 61/101 (60%), Positives = 64/101 (63%), Gaps = 11/101 (10%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG--YSSRGG 214
            S G GGG G  GG GGG+ SGGGG  SGGGG   GGGG   GGGG+SGGGGG     RGG
Sbjct: 1195 SGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGG 1254

Query: 215  GGGSY---------GGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG +         GGG   GGGGYGGG GGGYGG  GG G
Sbjct: 1255 GGGGFGGSGGFGNGGGGYGVGGGGYGGGGGGGYGGGSGGYG 1295

 Score =  114 bits (286), Expect = 3e-24
 Identities = 61/112 (54%), Positives = 68/112 (60%), Gaps = 24/112 (21%)
 Frame = +2

Query: 44   RGSGGGGGHRGGGGGGYRSGG-----------GGGYSGGGGSYG-GGGGRREGGGGYSGG 187
            RG GGGG   GG GGGY SGG           GGG++ GGG +G GGGG   GGGG+ GG
Sbjct: 1177 RGYGGGGYGGGGYGGGYGSGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGG 1236

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGGG------------EGGGYGGSGGGG 307
            GGG+S  GGGGG +GGGR  GGGG+GG              GGGYGG GGGG
Sbjct: 1237 GGGFS--GGGGGGFGGGRGGGGGGFGGSGGFGNGGGGYGVGGGGYGGGGGGG 1286

 Score =  110 bits (274), Expect = 6e-23
 Identities = 59/92 (64%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG--- 217
            G G GGG  G GGGG+  GGGGG+SGGGG  GG GG R GGGG  GG GG+ + GGG   
Sbjct: 1218 GFGSGGGGFGSGGGGF-GGGGGGFSGGGG--GGFGGGRGGGGGGFGGSGGFGNGGGGYGV 1274

Query: 218  -GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GG YGGG   GGGGYGGG  GGYGG G GGG
Sbjct: 1275 GGGGYGGG---GGGGYGGG-SGGYGGGGYGGG 1302

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/93 (59%), Positives = 61/93 (65%), Gaps = 3/93 (3%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG---GYSGGGGGYSSRG 211
            +R   G G  RG GGGGY   GGGGY GG GS G GGG   GGG   G++ GGGG+ S G
Sbjct: 1167 ARYDNGSGYRRGYGGGGY---GGGGYGGGYGSGGFGGGFGSGGGFGGGFNSGGGGFGSGG 1223

Query: 212  GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG GS GGG   GGGG+ GG GGG+GG  GGGG
Sbjct: 1224 GGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGG 1256

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 53/96 (55%), Positives = 56/96 (58%), Gaps = 10/96 (10%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSY--GGGGGRREGGGGYSGGGGGYSSRGGGG 220
            G GG GG RGGGGGG+  GG GG+  GGG Y  GGGG    GGGGY GG GGY   G GG
Sbjct: 1244 GGGGFGGGRGGGGGGF--GGSGGFGNGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGYGG 1301

Query: 221  G--------SYGGGRREGGGGYGGGEGGGYGGSGGG 304
            G        SY G    GGGGY GG  GGY  + GG
Sbjct: 1302 GEGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGG 1337

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 59/112 (52%), Positives = 60/112 (53%), Gaps = 21/112 (18%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG-GRREG--------GGGYSGGGG 193
            S G G GGG  G GGGGY  GGGGGY GG G YGGGG G  EG         G Y GGGG
Sbjct: 1262 SGGFGNGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGYGGGEGYSISPNSYRGNYGGGGG 1321

Query: 194  GYSSRGGGGGSYGGGRREGGGGYGG------GEGGGYGGSGG------GGGW 313
            GY      GGS GG R   GG Y G      G GGGY GSGG      GGG+
Sbjct: 1322 GYR-----GGSQGGYRNNFGGDYRGSSGDYRGSGGGYRGSGGFQRRGYGGGY 1368

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/93 (48%), Positives = 52/93 (55%)
 Frame = +2

Query: 8    DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
            +G SI+ N  +    GGGGG+RGG  GGYR+  GG Y G  G Y G       GGGY  G
Sbjct: 1303 EGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRG------SGGGYR-G 1355

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
             GG+  RG GGG +G GR       GGG GGGY
Sbjct: 1356 SGGFQRRGYGGGYFGQGR-------GGGGGGGY 1381

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/95 (48%), Positives = 49/95 (51%), Gaps = 6/95 (6%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYR---SGGGGGYSGGGGSYGG---GGGRREGGGGYSGGGGGYSSR 208
            GSGG GG   GGG GY    +   G Y GGGG Y G   GG R   GG Y G  G Y   
Sbjct: 1290 GSGGYGGGGYGGGEGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRGS 1349

Query: 209  GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
            GGG    GG +R    GYGGG  G   G GGGGG+
Sbjct: 1350 GGGYRGSGGFQRR---GYGGGYFGQGRGGGGGGGY 1381

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 44/82 (53%), Positives = 50/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query: 71   RGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRRE 247
            R   G GYR G GGGGY GGG  YGGG     G GG+   GGG+    G GG +GGG   
Sbjct: 1168 RYDNGSGYRRGYGGGGYGGGG--YGGG----YGSGGF---GGGF----GSGGGFGGGFNS 1214

Query: 248  GGGGYGGGEGGGYGGSGGGGGW 313
            GGGG+G G GGG+G   GGGG+
Sbjct: 1215 GGGGFGSG-GGGFG--SGGGGF 1233

[130][TOP]
>UniRef100_O70133 ATP-dependent RNA helicase A n=2 Tax=Mus musculus RepID=DHX9_MOUSE
          Length = 1380

 Score =  117 bits (292), Expect = 5e-25
 Identities = 60/100 (60%), Positives = 63/100 (63%), Gaps = 14/100 (14%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGG----GGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
            G G GGG  GGGGGG+  GGGGG+ GG    GG +GG GG   GGGGY  GGGGY   GG
Sbjct: 1224 GFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGGGGFGGSGGFGNGGGGYGVGGGGYG--GG 1281

Query: 215  GGGSYGGGRRE-GGGGYGGGEG---------GGYGGSGGG 304
            GGG YGGG    GGGGYGGGEG         G YGG GGG
Sbjct: 1282 GGGGYGGGSGGYGGGGYGGGEGYSISPNSYRGNYGGGGGG 1321

 Score =  116 bits (290), Expect = 9e-25
 Identities = 61/101 (60%), Positives = 64/101 (63%), Gaps = 11/101 (10%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG--YSSRGG 214
            S G GGG G  GG GGG+ SGGGG  SGGGG   GGGG   GGGG+SGGGGG     RGG
Sbjct: 1194 SGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGG 1253

Query: 215  GGGSY---------GGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG +         GGG   GGGGYGGG GGGYGG  GG G
Sbjct: 1254 GGGGFGGSGGFGNGGGGYGVGGGGYGGGGGGGYGGGSGGYG 1294

 Score =  114 bits (286), Expect = 3e-24
 Identities = 61/112 (54%), Positives = 68/112 (60%), Gaps = 24/112 (21%)
 Frame = +2

Query: 44   RGSGGGGGHRGGGGGGYRSGG-----------GGGYSGGGGSYG-GGGGRREGGGGYSGG 187
            RG GGGG   GG GGGY SGG           GGG++ GGG +G GGGG   GGGG+ GG
Sbjct: 1176 RGYGGGGYGGGGYGGGYGSGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGG 1235

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGGG------------EGGGYGGSGGGG 307
            GGG+S  GGGGG +GGGR  GGGG+GG              GGGYGG GGGG
Sbjct: 1236 GGGFS--GGGGGGFGGGRGGGGGGFGGSGGFGNGGGGYGVGGGGYGGGGGGG 1285

 Score =  110 bits (274), Expect = 6e-23
 Identities = 59/92 (64%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG--- 217
            G G GGG  G GGGG+  GGGGG+SGGGG  GG GG R GGGG  GG GG+ + GGG   
Sbjct: 1217 GFGSGGGGFGSGGGGF-GGGGGGFSGGGG--GGFGGGRGGGGGGFGGSGGFGNGGGGYGV 1273

Query: 218  -GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GG YGGG   GGGGYGGG  GGYGG G GGG
Sbjct: 1274 GGGGYGGG---GGGGYGGG-SGGYGGGGYGGG 1301

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/93 (59%), Positives = 61/93 (65%), Gaps = 3/93 (3%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG---GYSGGGGGYSSRG 211
            +R   G G  RG GGGGY   GGGGY GG GS G GGG   GGG   G++ GGGG+ S G
Sbjct: 1166 ARYDNGSGYRRGYGGGGY---GGGGYGGGYGSGGFGGGFGSGGGFGGGFNSGGGGFGSGG 1222

Query: 212  GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG GS GGG   GGGG+ GG GGG+GG  GGGG
Sbjct: 1223 GGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGG 1255

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 53/96 (55%), Positives = 56/96 (58%), Gaps = 10/96 (10%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSY--GGGGGRREGGGGYSGGGGGYSSRGGGG 220
            G GG GG RGGGGGG+  GG GG+  GGG Y  GGGG    GGGGY GG GGY   G GG
Sbjct: 1243 GGGGFGGGRGGGGGGF--GGSGGFGNGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGYGG 1300

Query: 221  G--------SYGGGRREGGGGYGGGEGGGYGGSGGG 304
            G        SY G    GGGGY GG  GGY  + GG
Sbjct: 1301 GEGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGG 1336

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 59/112 (52%), Positives = 60/112 (53%), Gaps = 21/112 (18%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG-GRREG--------GGGYSGGGG 193
            S G G GGG  G GGGGY  GGGGGY GG G YGGGG G  EG         G Y GGGG
Sbjct: 1261 SGGFGNGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGYGGGEGYSISPNSYRGNYGGGGG 1320

Query: 194  GYSSRGGGGGSYGGGRREGGGGYGG------GEGGGYGGSGG------GGGW 313
            GY      GGS GG R   GG Y G      G GGGY GSGG      GGG+
Sbjct: 1321 GYR-----GGSQGGYRNNFGGDYRGSSGDYRGSGGGYRGSGGFQRRGYGGGY 1367

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/93 (48%), Positives = 52/93 (55%)
 Frame = +2

Query: 8    DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
            +G SI+ N  +    GGGGG+RGG  GGYR+  GG Y G  G Y G       GGGY  G
Sbjct: 1302 EGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRG------SGGGYR-G 1354

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
             GG+  RG GGG +G GR       GGG GGGY
Sbjct: 1355 SGGFQRRGYGGGYFGQGR-------GGGGGGGY 1380

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/95 (48%), Positives = 49/95 (51%), Gaps = 6/95 (6%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYR---SGGGGGYSGGGGSYGG---GGGRREGGGGYSGGGGGYSSR 208
            GSGG GG   GGG GY    +   G Y GGGG Y G   GG R   GG Y G  G Y   
Sbjct: 1289 GSGGYGGGGYGGGEGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRGS 1348

Query: 209  GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
            GGG    GG +R    GYGGG  G   G GGGGG+
Sbjct: 1349 GGGYRGSGGFQRR---GYGGGYFGQGRGGGGGGGY 1380

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 44/82 (53%), Positives = 50/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query: 71   RGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRRE 247
            R   G GYR G GGGGY GGG  YGGG     G GG+   GGG+    G GG +GGG   
Sbjct: 1167 RYDNGSGYRRGYGGGGYGGGG--YGGG----YGSGGF---GGGF----GSGGGFGGGFNS 1213

Query: 248  GGGGYGGGEGGGYGGSGGGGGW 313
            GGGG+G G GGG+G   GGGG+
Sbjct: 1214 GGGGFGSG-GGGFG--SGGGGF 1232

[131][TOP]
>UniRef100_UPI00015539BB PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI00015539BB
          Length = 123

 Score =  116 bits (291), Expect = 7e-25
 Identities = 60/95 (63%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGG---GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           R  GGGGG  GGGG   GG  SGGGGG  GGGG   GGGG   GGGG  GGGGG    G 
Sbjct: 10  REGGGGGGSGGGGGDSGGGGCSGGGGGGGGGGGGGSGGGGGGGGGGGSGGGGGGGGGGGS 69

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGG--GGW 313
           GGG  GGG   GGGG GGG GGG GG+GGG  GGW
Sbjct: 70  GGGGVGGGGDGGGGGGGGGGGGGGGGAGGGSSGGW 104

 Score =  103 bits (257), Expect = 6e-21
 Identities = 57/93 (61%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS-----GGGGGYSSRG 211
           G G      GGGGGG  SGGGGG SGGGG  GGGGG   GGGG       GGGGG    G
Sbjct: 3   GKGKRPVREGGGGGG--SGGGGGDSGGGGCSGGGGGG--GGGGGGGSGGGGGGGGGGGSG 58

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGG  GGG   GGG  GGG+GGG GG GGGGG
Sbjct: 59  GGGGGGGGGGSGGGGVGGGGDGGGGGGGGGGGG 91

 Score =  100 bits (249), Expect = 5e-20
 Identities = 53/83 (63%), Positives = 54/83 (65%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           S G GGGGG  GGG GG   GGGGG SGGGG  GGGGG   GGGG  GGG G    GGGG
Sbjct: 31  SGGGGGGGGGGGGGSGGGGGGGGGGGSGGGGGGGGGGG--SGGGGVGGGGDG----GGGG 84

Query: 221 GSYGGGRREGGGGYGGGEGGGYG 289
           G  GGG   GGGG GGG  GG+G
Sbjct: 85  GGGGGG--GGGGGAGGGSSGGWG 105

[132][TOP]
>UniRef100_UPI0000025476 DEAH (Asp-Glu-Ala-His) box polypeptide 9 n=1 Tax=Mus musculus
            RepID=UPI0000025476
          Length = 1383

 Score =  116 bits (291), Expect = 7e-25
 Identities = 63/107 (58%), Positives = 67/107 (62%), Gaps = 16/107 (14%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG--YSSRGG 214
            S G GGG G  GG GGG+ SGGGG  SGGGG   GGGG   GGGG+SGGGGG     RGG
Sbjct: 1195 SGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGG 1254

Query: 215  GGGSY---------GGGRREGGGGYGGGEGGGYGG-----SGGGGGW 313
            GGG +         GGG   GGGGYGGG GGGYGG      GGGGG+
Sbjct: 1255 GGGGFGGSGGFGSGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGGGY 1301

 Score =  116 bits (290), Expect = 9e-25
 Identities = 60/102 (58%), Positives = 63/102 (61%), Gaps = 16/102 (15%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGG----GGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
            G G GGG  GGGGGG+  GGGGG+ GG    GG +GG GG   GGGGY  GGGGY   GG
Sbjct: 1225 GFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGGGGFGGSGGFGSGGGGYGVGGGGYG--GG 1282

Query: 215  GGGSYGGGR---REGGGGYGGGEG---------GGYGGSGGG 304
            GGG YGGG      GGGGYGGGEG         G YGG GGG
Sbjct: 1283 GGGGYGGGSGGYGGGGGGYGGGEGYSISPNSYRGNYGGGGGG 1324

 Score =  114 bits (286), Expect = 3e-24
 Identities = 61/112 (54%), Positives = 68/112 (60%), Gaps = 24/112 (21%)
 Frame = +2

Query: 44   RGSGGGGGHRGGGGGGYRSGG-----------GGGYSGGGGSYG-GGGGRREGGGGYSGG 187
            RG GGGG   GG GGGY SGG           GGG++ GGG +G GGGG   GGGG+ GG
Sbjct: 1177 RGYGGGGYGGGGYGGGYGSGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGG 1236

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGGG------------EGGGYGGSGGGG 307
            GGG+S  GGGGG +GGGR  GGGG+GG              GGGYGG GGGG
Sbjct: 1237 GGGFS--GGGGGGFGGGRGGGGGGFGGSGGFGSGGGGYGVGGGGYGGGGGGG 1286

 Score =  111 bits (277), Expect = 3e-23
 Identities = 60/92 (65%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG--- 217
            G G GGG  G GGGG+  GGGGG+SGGGG  GG GG R GGGG  GG GG+ S GGG   
Sbjct: 1218 GFGSGGGGFGSGGGGF-GGGGGGFSGGGG--GGFGGGRGGGGGGFGGSGGFGSGGGGYGV 1274

Query: 218  -GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GG YGGG   GGGGYGGG  GGYGG GGG G
Sbjct: 1275 GGGGYGGG---GGGGYGGG-SGGYGGGGGGYG 1302

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/93 (59%), Positives = 61/93 (65%), Gaps = 3/93 (3%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG---GYSGGGGGYSSRG 211
            +R   G G  RG GGGGY   GGGGY GG GS G GGG   GGG   G++ GGGG+ S G
Sbjct: 1167 ARYDNGSGYRRGYGGGGY---GGGGYGGGYGSGGFGGGFGSGGGFGGGFNSGGGGFGSGG 1223

Query: 212  GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG GS GGG   GGGG+ GG GGG+GG  GGGG
Sbjct: 1224 GGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGG 1256

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/114 (52%), Positives = 61/114 (53%), Gaps = 23/114 (20%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS-----------GG 187
            S G G GGG  G GGGGY  GGGGGY GG G YGGGGG   GG GYS           GG
Sbjct: 1262 SGGFGSGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGGGYGGGEGYSISPNSYRGNYGGG 1321

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGG------GEGGGYGGSGG------GGGW 313
            GGGY      GGS GG R   GG Y G      G GGGY GSGG      GGG+
Sbjct: 1322 GGGYR-----GGSQGGYRNNFGGDYRGSSGDYRGSGGGYRGSGGFQRRGYGGGY 1370

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/94 (58%), Positives = 57/94 (60%), Gaps = 8/94 (8%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG--YSGGGGGYSSRGGGG 220
            G GG GG RGGGGGG+  GG GG+  GGG YG GGG   GGGG  Y GG GGY   GGGG
Sbjct: 1244 GGGGFGGGRGGGGGGF--GGSGGFGSGGGGYGVGGGGYGGGGGGGYGGGSGGY---GGGG 1298

Query: 221  GSYGGGR------REGGGGYGGGEGGGYGGSGGG 304
            G YGGG           G YGGG GG  GGS GG
Sbjct: 1299 GGYGGGEGYSISPNSYRGNYGGGGGGYRGGSQGG 1332

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/93 (48%), Positives = 52/93 (55%)
 Frame = +2

Query: 8    DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
            +G SI+ N  +    GGGGG+RGG  GGYR+  GG Y G  G Y G       GGGY  G
Sbjct: 1305 EGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRG------SGGGYR-G 1357

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
             GG+  RG GGG +G GR       GGG GGGY
Sbjct: 1358 SGGFQRRGYGGGYFGQGR-------GGGGGGGY 1383

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/95 (47%), Positives = 48/95 (50%), Gaps = 6/95 (6%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYR---SGGGGGYSGGGGSYGG---GGGRREGGGGYSGGGGGYSSR 208
            G  GGGG   GGG GY    +   G Y GGGG Y G   GG R   GG Y G  G Y   
Sbjct: 1292 GGYGGGGGGYGGGEGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRGS 1351

Query: 209  GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
            GGG    GG +R    GYGGG  G   G GGGGG+
Sbjct: 1352 GGGYRGSGGFQRR---GYGGGYFGQGRGGGGGGGY 1383

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 44/82 (53%), Positives = 50/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query: 71   RGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRRE 247
            R   G GYR G GGGGY GGG  YGGG     G GG+   GGG+    G GG +GGG   
Sbjct: 1168 RYDNGSGYRRGYGGGGYGGGG--YGGG----YGSGGF---GGGF----GSGGGFGGGFNS 1214

Query: 248  GGGGYGGGEGGGYGGSGGGGGW 313
            GGGG+G G GGG+G   GGGG+
Sbjct: 1215 GGGGFGSG-GGGFG--SGGGGF 1233

[133][TOP]
>UniRef100_UPI00001EDBAC DEAH (Asp-Glu-Ala-His) box polypeptide 9 n=1 Tax=Mus musculus
            RepID=UPI00001EDBAC
          Length = 1384

 Score =  116 bits (291), Expect = 7e-25
 Identities = 63/107 (58%), Positives = 67/107 (62%), Gaps = 16/107 (14%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG--YSSRGG 214
            S G GGG G  GG GGG+ SGGGG  SGGGG   GGGG   GGGG+SGGGGG     RGG
Sbjct: 1196 SGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGG 1255

Query: 215  GGGSY---------GGGRREGGGGYGGGEGGGYGG-----SGGGGGW 313
            GGG +         GGG   GGGGYGGG GGGYGG      GGGGG+
Sbjct: 1256 GGGGFGGSGGFGSGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGGGY 1302

 Score =  116 bits (290), Expect = 9e-25
 Identities = 60/102 (58%), Positives = 63/102 (61%), Gaps = 16/102 (15%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGG----GGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
            G G GGG  GGGGGG+  GGGGG+ GG    GG +GG GG   GGGGY  GGGGY   GG
Sbjct: 1226 GFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGGGGFGGSGGFGSGGGGYGVGGGGYG--GG 1283

Query: 215  GGGSYGGGR---REGGGGYGGGEG---------GGYGGSGGG 304
            GGG YGGG      GGGGYGGGEG         G YGG GGG
Sbjct: 1284 GGGGYGGGSGGYGGGGGGYGGGEGYSISPNSYRGNYGGGGGG 1325

 Score =  114 bits (286), Expect = 3e-24
 Identities = 61/112 (54%), Positives = 68/112 (60%), Gaps = 24/112 (21%)
 Frame = +2

Query: 44   RGSGGGGGHRGGGGGGYRSGG-----------GGGYSGGGGSYG-GGGGRREGGGGYSGG 187
            RG GGGG   GG GGGY SGG           GGG++ GGG +G GGGG   GGGG+ GG
Sbjct: 1178 RGYGGGGYGGGGYGGGYGSGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGG 1237

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGGG------------EGGGYGGSGGGG 307
            GGG+S  GGGGG +GGGR  GGGG+GG              GGGYGG GGGG
Sbjct: 1238 GGGFS--GGGGGGFGGGRGGGGGGFGGSGGFGSGGGGYGVGGGGYGGGGGGG 1287

 Score =  111 bits (277), Expect = 3e-23
 Identities = 60/92 (65%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG--- 217
            G G GGG  G GGGG+  GGGGG+SGGGG  GG GG R GGGG  GG GG+ S GGG   
Sbjct: 1219 GFGSGGGGFGSGGGGF-GGGGGGFSGGGG--GGFGGGRGGGGGGFGGSGGFGSGGGGYGV 1275

Query: 218  -GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GG YGGG   GGGGYGGG  GGYGG GGG G
Sbjct: 1276 GGGGYGGG---GGGGYGGG-SGGYGGGGGGYG 1303

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/93 (59%), Positives = 61/93 (65%), Gaps = 3/93 (3%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG---GYSGGGGGYSSRG 211
            +R   G G  RG GGGGY   GGGGY GG GS G GGG   GGG   G++ GGGG+ S G
Sbjct: 1168 ARYDNGSGYRRGYGGGGY---GGGGYGGGYGSGGFGGGFGSGGGFGGGFNSGGGGFGSGG 1224

Query: 212  GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG GS GGG   GGGG+ GG GGG+GG  GGGG
Sbjct: 1225 GGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGG 1257

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/114 (52%), Positives = 61/114 (53%), Gaps = 23/114 (20%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS-----------GG 187
            S G G GGG  G GGGGY  GGGGGY GG G YGGGGG   GG GYS           GG
Sbjct: 1263 SGGFGSGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGGGYGGGEGYSISPNSYRGNYGGG 1322

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGG------GEGGGYGGSGG------GGGW 313
            GGGY      GGS GG R   GG Y G      G GGGY GSGG      GGG+
Sbjct: 1323 GGGYR-----GGSQGGYRNNFGGDYRGSSGDYRGSGGGYRGSGGFQRRGYGGGY 1371

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/94 (58%), Positives = 57/94 (60%), Gaps = 8/94 (8%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG--YSGGGGGYSSRGGGG 220
            G GG GG RGGGGGG+  GG GG+  GGG YG GGG   GGGG  Y GG GGY   GGGG
Sbjct: 1245 GGGGFGGGRGGGGGGF--GGSGGFGSGGGGYGVGGGGYGGGGGGGYGGGSGGY---GGGG 1299

Query: 221  GSYGGGR------REGGGGYGGGEGGGYGGSGGG 304
            G YGGG           G YGGG GG  GGS GG
Sbjct: 1300 GGYGGGEGYSISPNSYRGNYGGGGGGYRGGSQGG 1333

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/93 (48%), Positives = 52/93 (55%)
 Frame = +2

Query: 8    DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
            +G SI+ N  +    GGGGG+RGG  GGYR+  GG Y G  G Y G       GGGY  G
Sbjct: 1306 EGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRG------SGGGYR-G 1358

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
             GG+  RG GGG +G GR       GGG GGGY
Sbjct: 1359 SGGFQRRGYGGGYFGQGR-------GGGGGGGY 1384

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/95 (47%), Positives = 48/95 (50%), Gaps = 6/95 (6%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYR---SGGGGGYSGGGGSYGG---GGGRREGGGGYSGGGGGYSSR 208
            G  GGGG   GGG GY    +   G Y GGGG Y G   GG R   GG Y G  G Y   
Sbjct: 1293 GGYGGGGGGYGGGEGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRGS 1352

Query: 209  GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
            GGG    GG +R    GYGGG  G   G GGGGG+
Sbjct: 1353 GGGYRGSGGFQRR---GYGGGYFGQGRGGGGGGGY 1384

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 44/82 (53%), Positives = 50/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query: 71   RGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRRE 247
            R   G GYR G GGGGY GGG  YGGG     G GG+   GGG+    G GG +GGG   
Sbjct: 1169 RYDNGSGYRRGYGGGGYGGGG--YGGG----YGSGGF---GGGF----GSGGGFGGGFNS 1215

Query: 248  GGGGYGGGEGGGYGGSGGGGGW 313
            GGGG+G G GGG+G   GGGG+
Sbjct: 1216 GGGGFGSG-GGGFG--SGGGGF 1234

[134][TOP]
>UniRef100_B6ID90 DEAH (Asp-Glu-Ala-His) box polypeptide 9 (Fragment) n=2 Tax=root
           RepID=B6ID90_9ZZZZ
          Length = 448

 Score =  116 bits (291), Expect = 7e-25
 Identities = 63/107 (58%), Positives = 67/107 (62%), Gaps = 16/107 (14%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG--YSSRGG 214
           S G GGG G  GG GGG+ SGGGG  SGGGG   GGGG   GGGG+SGGGGG     RGG
Sbjct: 260 SGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGG 319

Query: 215 GGGSY---------GGGRREGGGGYGGGEGGGYGG-----SGGGGGW 313
           GGG +         GGG   GGGGYGGG GGGYGG      GGGGG+
Sbjct: 320 GGGGFGGSGGFGSGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGGGY 366

 Score =  116 bits (290), Expect = 9e-25
 Identities = 60/102 (58%), Positives = 63/102 (61%), Gaps = 16/102 (15%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG----GGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           G G GGG  GGGGGG+  GGGGG+ GG    GG +GG GG   GGGGY  GGGGY   GG
Sbjct: 290 GFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGGGGFGGSGGFGSGGGGYGVGGGGYG--GG 347

Query: 215 GGGSYGGGR---REGGGGYGGGEG---------GGYGGSGGG 304
           GGG YGGG      GGGGYGGGEG         G YGG GGG
Sbjct: 348 GGGGYGGGSGGYGGGGGGYGGGEGYSISPNSYRGNYGGGGGG 389

 Score =  114 bits (286), Expect = 3e-24
 Identities = 61/112 (54%), Positives = 68/112 (60%), Gaps = 24/112 (21%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGG-----------GGGYSGGGGSYG-GGGGRREGGGGYSGG 187
           RG GGGG   GG GGGY SGG           GGG++ GGG +G GGGG   GGGG+ GG
Sbjct: 242 RGYGGGGYGGGGYGGGYGSGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGG 301

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGGG------------EGGGYGGSGGGG 307
           GGG+S  GGGGG +GGGR  GGGG+GG              GGGYGG GGGG
Sbjct: 302 GGGFS--GGGGGGFGGGRGGGGGGFGGSGGFGSGGGGYGVGGGGYGGGGGGG 351

 Score =  111 bits (277), Expect = 3e-23
 Identities = 60/92 (65%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG--- 217
           G G GGG  G GGGG+  GGGGG+SGGGG  GG GG R GGGG  GG GG+ S GGG   
Sbjct: 283 GFGSGGGGFGSGGGGF-GGGGGGFSGGGG--GGFGGGRGGGGGGFGGSGGFGSGGGGYGV 339

Query: 218 -GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG YGGG   GGGGYGGG  GGYGG GGG G
Sbjct: 340 GGGGYGGG---GGGGYGGG-SGGYGGGGGGYG 367

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/93 (59%), Positives = 61/93 (65%), Gaps = 3/93 (3%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG---GYSGGGGGYSSRG 211
           +R   G G  RG GGGGY   GGGGY GG GS G GGG   GGG   G++ GGGG+ S G
Sbjct: 232 ARYDNGSGYRRGYGGGGY---GGGGYGGGYGSGGFGGGFGSGGGFGGGFNSGGGGFGSGG 288

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG GS GGG   GGGG+ GG GGG+GG  GGGG
Sbjct: 289 GGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGG 321

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/114 (52%), Positives = 61/114 (53%), Gaps = 23/114 (20%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS-----------GG 187
           S G G GGG  G GGGGY  GGGGGY GG G YGGGGG   GG GYS           GG
Sbjct: 327 SGGFGSGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGGGYGGGEGYSISPNSYRGNYGGG 386

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGG------GEGGGYGGSGG------GGGW 313
           GGGY      GGS GG R   GG Y G      G GGGY GSGG      GGG+
Sbjct: 387 GGGYR-----GGSQGGYRNNFGGDYRGSSGDYRGSGGGYRGSGGFQRRGYGGGY 435

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/94 (58%), Positives = 57/94 (60%), Gaps = 8/94 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG--YSGGGGGYSSRGGGG 220
           G GG GG RGGGGGG+  GG GG+  GGG YG GGG   GGGG  Y GG GGY   GGGG
Sbjct: 309 GGGGFGGGRGGGGGGF--GGSGGFGSGGGGYGVGGGGYGGGGGGGYGGGSGGY---GGGG 363

Query: 221 GSYGGGR------REGGGGYGGGEGGGYGGSGGG 304
           G YGGG           G YGGG GG  GGS GG
Sbjct: 364 GGYGGGEGYSISPNSYRGNYGGGGGGYRGGSQGG 397

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/93 (48%), Positives = 52/93 (55%)
 Frame = +2

Query: 8   DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
           +G SI+ N  +    GGGGG+RGG  GGYR+  GG Y G  G Y G       GGGY  G
Sbjct: 370 EGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRG------SGGGYR-G 422

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
            GG+  RG GGG +G GR       GGG GGGY
Sbjct: 423 SGGFQRRGYGGGYFGQGR-------GGGGGGGY 448

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/95 (47%), Positives = 48/95 (50%), Gaps = 6/95 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYR---SGGGGGYSGGGGSYGG---GGGRREGGGGYSGGGGGYSSR 208
           G  GGGG   GGG GY    +   G Y GGGG Y G   GG R   GG Y G  G Y   
Sbjct: 357 GGYGGGGGGYGGGEGYSISPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRGS 416

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGG    GG +R    GYGGG  G   G GGGGG+
Sbjct: 417 GGGYRGSGGFQRR---GYGGGYFGQGRGGGGGGGY 448

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 44/82 (53%), Positives = 50/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query: 71  RGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRRE 247
           R   G GYR G GGGGY GGG  YGGG     G GG+   GGG+    G GG +GGG   
Sbjct: 233 RYDNGSGYRRGYGGGGYGGGG--YGGG----YGSGGF---GGGF----GSGGGFGGGFNS 279

Query: 248 GGGGYGGGEGGGYGGSGGGGGW 313
           GGGG+G G GGG+G   GGGG+
Sbjct: 280 GGGGFGSG-GGGFG--SGGGGF 298

[135][TOP]
>UniRef100_Q3MC83 Putative uncharacterized protein n=1 Tax=Anabaena variabilis ATCC
           29413 RepID=Q3MC83_ANAVT
          Length = 387

 Score =  116 bits (291), Expect = 7e-25
 Identities = 54/85 (63%), Positives = 56/85 (65%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           P PPLP  P P PPP  PPP   PPP  PPPPP  + PPPPP  PPPP   PPP P  PP
Sbjct: 308 PDPPLPDNPDPPPPPPDPPP---PPPPDPPPPPPPDPPPPPPPDPPPP---PPPDPPPPP 361

Query: 126 PPE*PPPPPLRYPPPPPPRWPPPPP 52
           PP+ PPPPP   PPPPPP  PPPPP
Sbjct: 362 PPDPPPPPPPDPPPPPPPDPPPPPP 386

 Score =  112 bits (281), Expect = 1e-23
 Identities = 52/80 (65%), Positives = 55/80 (68%)
 Frame = -3

Query: 312 HPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           +P PPP PP PPP PPP PPPP   PPP  PPPPP +  PPPPP  PPPP   P PPP  
Sbjct: 315 NPDPPPPPPDPPPPPPPDPPPP---PPPDPPPPPPPDPPPPPPPDPPPPPP--PDPPP-- 367

Query: 132 PPPPE*PPPPPLRYPPPPPP 73
           PPPP+ PPPPP   PPPPPP
Sbjct: 368 PPPPDPPPPPPPDPPPPPPP 387

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/72 (61%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = -3

Query: 258 PPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*-LPPPPE*PPPPPLRYPPP 82
           P PP  LP    PPPPP    P PPP  PPPP   PPPPP   PPPP  PPPPP   PPP
Sbjct: 308 PDPP--LPDNPDPPPPP----PDPPP--PPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 359

Query: 81  PPPRWPPPPPLP 46
           PPP  PPPPP P
Sbjct: 360 PPPPDPPPPPPP 371

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 37/61 (60%), Positives = 39/61 (63%), Gaps = 1/61 (1%)
 Frame = -3

Query: 225 LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*-LPPPPE*PPPPPLRYPPPPPPRWPPPPPL 49
           + P PPL + P PPP   PPP   PPPPP   PPPP  PPPPP   PPPPPP  PPPPP 
Sbjct: 306 IQPDPPLPDNPDPPP---PPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPP 362

Query: 48  P 46
           P
Sbjct: 363 P 363

[136][TOP]
>UniRef100_Q1IRT5 Putative uncharacterized protein n=1 Tax=Candidatus Koribacter
           versatilis Ellin345 RepID=Q1IRT5_ACIBL
          Length = 315

 Score =  116 bits (291), Expect = 7e-25
 Identities = 58/104 (55%), Positives = 67/104 (64%), Gaps = 5/104 (4%)
 Frame = +2

Query: 17  SITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGS---YGGGGGRREGGGGYSGG 187
           S++V+ A + G  GGG H GGGGGG+  GGGGG+ GGGG    +GGGGG   GGGGY GG
Sbjct: 31  SLSVSTALAYGQHGGG-HGGGGGGGFHGGGGGGFHGGGGGGGFHGGGGGFHGGGGGYHGG 89

Query: 188 GGGYSSRGGGGGSYGGGRREG--GGGYGGGEGGGYGGSGGGGGW 313
           GG Y   G GGG +G G   G  GGGY GG GG YGG    GG+
Sbjct: 90  GGAYHGGGYGGGYHGAGAYHGGYGGGYHGGHGGWYGGGHSHGGY 133

 Score =  107 bits (266), Expect = 5e-22
 Identities = 58/103 (56%), Positives = 62/103 (60%), Gaps = 6/103 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGG-YSGGGGSY-GGGGGRREGGGGYSGG--GGGYSSRGG 214
           G GGGGG  GGGGGG+  GGGGG + GGGG + GGGGG   GGG Y GG  GGGY   G 
Sbjct: 48  GGGGGGGFHGGGGGGFHGGGGGGGFHGGGGGFHGGGGGYHGGGGAYHGGGYGGGYHGAGA 107

Query: 215 GGGSYGGGRREG-GGGYGGGEG-GGYGGSGGGGGW*FL*LGLG 337
             G YGGG   G GG YGGG   GGY G   GG W +   G G
Sbjct: 108 YHGGYGGGYHGGHGGWYGGGHSHGGYYGHSHGGYWGYPYYGWG 150

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 41/88 (46%), Positives = 45/88 (51%), Gaps = 7/88 (7%)
 Frame = +2

Query: 47  GSGG---GGGHRGG--GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG-GGYSSR 208
           G GG   GGG+ GG  G G Y  G GGGY GG G + GGG    G  G+S GG  GY   
Sbjct: 88  GGGGAYHGGGYGGGYHGAGAYHGGYGGGYHGGHGGWYGGGHSHGGYYGHSHGGYWGYPYY 147

Query: 209 GGGGG-SYGGGRREGGGGYGGGEGGGYG 289
           G G G  +G G    G GY  G G  YG
Sbjct: 148 GWGFGIGFGWGYPYYGYGYPYGYGYPYG 175

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 40/94 (42%), Positives = 44/94 (46%), Gaps = 9/94 (9%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG-GGYSGGGGGYSSRGGGGG 223
           G  G G + GG GGGY  GG GG+ GGG S+GG  G   GG  GY   G G+    G G 
Sbjct: 101 GYHGAGAYHGGYGGGYH-GGHGGWYGGGHSHGGYYGHSHGGYWGYPYYGWGFGIGFGWGY 159

Query: 224 SYGGGRREGGGGYGGGEG--------GGYGGSGG 301
            Y G     G GY  G G         GY GS G
Sbjct: 160 PYYGYGYPYGYGYPYGYGYSSYPYQPYGYYGSAG 193

[137][TOP]
>UniRef100_A2C5L0 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. MIT 9303
           RepID=A2C5L0_PROM3
          Length = 202

 Score =  116 bits (291), Expect = 7e-25
 Identities = 62/105 (59%), Positives = 68/105 (64%), Gaps = 1/105 (0%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           ++ GR + +N+A+ RGS      R GGGGGY  GGGGGY GGGG YGGGGG      GY 
Sbjct: 66  EMMGRPLRINKAEPRGSAP----RRGGGGGY-GGGGGGYGGGGGGYGGGGG------GYG 114

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG-GW 313
           GGGGGY   GGGGG  GGG   GGGGYGGG GGG G  G G  GW
Sbjct: 115 GGGGGYG--GGGGGYGGGGGGGGGGGYGGGGGGGGGDRGSGARGW 157

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/97 (54%), Positives = 55/97 (56%), Gaps = 12/97 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGG-GYSSRGGGG- 220
           G GGGGG  GGGGGGY  GGGG   GGGG YGGGGG   GGGG  G G  G+  R  GG 
Sbjct: 112 GYGGGGGGYGGGGGGYGGGGGG---GGGGGYGGGGG---GGGGDRGSGARGWEDRSYGGA 165

Query: 221 ----GSYGGG--RREGGGGYGGGEGG----GYGGSGG 301
                SY  G  RR  GG    GEGG    GYGG+ G
Sbjct: 166 APETSSYDDGRTRRRRGGAAPEGEGGDSYSGYGGAEG 202

[138][TOP]
>UniRef100_A2BZB6 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. NATL1A
           RepID=A2BZB6_PROM1
          Length = 250

 Score =  116 bits (291), Expect = 7e-25
 Identities = 66/125 (52%), Positives = 73/125 (58%), Gaps = 22/125 (17%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSG--------------GGGGHRGGGGGGYRSGGGGGYSGGG-GS 136
           +L GR + +N+A+ RGS               GGGG+ GGG GGY  GG GGY GGG G 
Sbjct: 66  ELMGRPLRINKAEPRGSAPRRGGYGGGGGGGYGGGGYGGGGQGGYGGGGQGGYGGGGQGG 125

Query: 137 YGGGGGRREGGGGYSG-GGGGYSSRGGGG-GSYGGGRREG-----GGGYGGGEGGGYGGS 295
           YGGGG    GGGG  G GGGG    GGGG G YGGG + G      GGYGGG  GGYGG 
Sbjct: 126 YGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGG 185

Query: 296 GGGGG 310
           G GGG
Sbjct: 186 GYGGG 190

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/86 (62%), Positives = 55/86 (63%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG-GSYGGGGGRREGGGGYSGGG-GGYSSRGGGG 220
           G GG GG+ GGG GGY  GG GGY GGG G YGGG     G GGY GGG GGY   GGG 
Sbjct: 119 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGG-----GQGGYGGGGQGGYG--GGGQ 171

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSG 298
           G YGGG   G GGYG   GGGYGG G
Sbjct: 172 GGYGGG---GQGGYG---GGGYGGGG 191

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/91 (53%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG-GSYGGGGGRREGGGGYSGGG-GGYSSRGGGG 220
           G GG GG+ GGG GGY  GG GGY GGG G YGGG     G GGY GGG GGY   GGG 
Sbjct: 127 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGG-----GQGGYGGGGQGGYG--GGGQ 179

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           G YGGG   G GG G  +        G  GW
Sbjct: 180 GGYGGG---GYGGGGQADQSAQDRPSGAKGW 207

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 43/85 (50%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG-GSYGGGGGRREGGGGYSG-GGGGYSSRGGGG 220
           G GG GG+ GGG GGY  GG GGY GGG G YGGGG    GGGG  G GGGGY    GGG
Sbjct: 135 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGY----GGG 190

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGS 295
           G      ++   G  G E   +G +
Sbjct: 191 GQADQSAQDRPSGAKGWEDRSHGNA 215

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 39/98 (39%), Positives = 43/98 (43%), Gaps = 15/98 (15%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG------GSYGGGGGRREGGGGYSGGGGGYSSR 208
           G GG GG+ GGG GGY  GG GGY GGG      G YGGGG   +       G  G+  R
Sbjct: 151 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGYGGGGQADQSAQDRPSGAKGWEDR 210

Query: 209 GGGGGS-------YGGGRREGGGGYGGG--EGGGYGGS 295
             G  S        G  RR  G    GG      YGG+
Sbjct: 211 SHGNASQDVNDFDQGRSRRRRGASPEGGADSTADYGGA 248

[139][TOP]
>UniRef100_B9H173 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H173_POPTR
          Length = 207

 Score =  116 bits (291), Expect = 7e-25
 Identities = 61/105 (58%), Positives = 61/105 (58%), Gaps = 19/105 (18%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGG---GGGRREGGGGYSGGGGGYSSRGGG 217
           G GGG G RGGG GG   GGGGGY GGGG YGG   GGGRR GGGG  GGGGGY   GGG
Sbjct: 84  GFGGGSGGRGGGRGGGGYGGGGGYGGGGGGYGGGGYGGGRRGGGGGGYGGGGGYGGGGGG 143

Query: 218 GGSY----------------GGGRREGGGGYGGGEGGGYGGSGGG 304
           GG                  G G   GGG YGGG GGG GG GGG
Sbjct: 144 GGGCYSCGESGHMARDCPQGGSGGGGGGGRYGGGNGGGGGGGGGG 188

 Score =  103 bits (257), Expect = 6e-21
 Identities = 62/118 (52%), Positives = 65/118 (55%), Gaps = 17/118 (14%)
 Frame = +2

Query: 8   DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
           DGR+  V +  + G     G R GGG G  SGG GG  GGGG YGGGGG   GGGGY GG
Sbjct: 60  DGRTKAV-DVTAPGGNPVQGIRSGGGFGGGSGGRGGGRGGGG-YGGGGGYGGGGGGYGGG 117

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG-----------------YGGSGGGGG 310
           G G   RGGGGG YG     GGGGYGGG GGG                  GGSGGGGG
Sbjct: 118 GYGGGRRGGGGGGYG-----GGGGYGGGGGGGGGCYSCGESGHMARDCPQGGSGGGGG 170

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/88 (56%), Positives = 50/88 (56%), Gaps = 4/88 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG--GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           G G GGG RGGGGGGY  GGG  GG  GGGG Y  G           GG GG    GGGG
Sbjct: 116 GGGYGGGRRGGGGGGYGGGGGYGGGGGGGGGCYSCGESGHMARDCPQGGSGG----GGGG 171

Query: 221 GSYGGGRREGGGGYGGGEGGGY--GGSG 298
           G YGGG    GGG GGG GG Y  GGSG
Sbjct: 172 GRYGGG---NGGGGGGGGGGCYNCGGSG 196

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 50/76 (65%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query: 89  GYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGG 268
           G RSGGG G    GGS G GGGR  GGGGY GGGGGY   GGGGG YGGG      GYGG
Sbjct: 78  GIRSGGGFG----GGSGGRGGGR--GGGGY-GGGGGY---GGGGGGYGGG------GYGG 121

Query: 269 GE-GGGYGGSGGGGGW 313
           G  GGG GG GGGGG+
Sbjct: 122 GRRGGGGGGYGGGGGY 137

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/71 (49%), Positives = 39/71 (54%), Gaps = 17/71 (23%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGG---YRSG-----------GGGGYSGGGGSYGGGGGRREGGGG--- 175
           G GGGGG+ GGGGGG   Y  G           GG G  GGGG YGGG G   GGGG   
Sbjct: 130 GYGGGGGYGGGGGGGGGCYSCGESGHMARDCPQGGSGGGGGGGRYGGGNGGGGGGGGGGC 189

Query: 176 YSGGGGGYSSR 208
           Y+ GG G+ +R
Sbjct: 190 YNCGGSGHFAR 200

[140][TOP]
>UniRef100_Q99069 Glycine-rich RNA-binding protein 1 (Fragment) n=1 Tax=Sorghum
           bicolor RepID=GRP1_SORBI
          Length = 142

 Score =  116 bits (291), Expect = 7e-25
 Identities = 67/96 (69%), Positives = 70/96 (72%), Gaps = 4/96 (4%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYS---GGGGSYGGGGGRREGG- 169
           +LDGR+ITVNEAQSRG  GGGG  GGG GG R GGGGGY    GGGG YGGGGG   GG 
Sbjct: 52  ELDGRNITVNEAQSRGGRGGGG--GGGYGGGR-GGGGGYGRRDGGGGGYGGGGGGYGGGR 108

Query: 170 GGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG 277
           GGY  GGGGY   GGGGG YGGG R GGGGYG  +G
Sbjct: 109 GGY--GGGGY---GGGGGGYGGGSR-GGGGYGNSDG 138

[141][TOP]
>UniRef100_Q9SIH2 Putative uncharacterized protein At2g36120 n=1 Tax=Arabidopsis
           thaliana RepID=Q9SIH2_ARATH
          Length = 255

 Score =  116 bits (290), Expect = 9e-25
 Identities = 57/95 (60%), Positives = 60/95 (63%), Gaps = 7/95 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG-GSYGGGGGRREGGGGYSGGG------GGYSS 205
           G GGGG H GG GGG  +G GGGY GGG G +GGGGG   GGGG  G G      GGY +
Sbjct: 136 GGGGGGAHGGGYGGGQGAGAGGGYGGGGAGGHGGGGGGGNGGGGGGGSGEGGAHGGGYGA 195

Query: 206 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG G  YGGG   GG G GGG GGG GG GGGGG
Sbjct: 196 GGGAGEGYGGGAGAGGHGGGGGGGGGSGGGGGGGG 230

 Score =  112 bits (279), Expect = 2e-23
 Identities = 57/94 (60%), Positives = 59/94 (62%), Gaps = 7/94 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG-GRREGGGGYSGGGGGYSSRGGG-- 217
           G GGGGGH GG GGG   G GGGY GG G  GG G G  E GG   GGGGG    GGG  
Sbjct: 81  GGGGGGGHGGGAGGGGGGGPGGGYGGGSGEGGGAGYGGGEAGGHGGGGGGGAGGGGGGGG 140

Query: 218 ---GGSYGGGRREG-GGGYGGGEGGGYGGSGGGG 307
              GG YGGG+  G GGGYGGG  GG+GG GGGG
Sbjct: 141 GAHGGGYGGGQGAGAGGGYGGGGAGGHGGGGGGG 174

 Score =  110 bits (275), Expect = 5e-23
 Identities = 59/102 (57%), Positives = 62/102 (60%), Gaps = 9/102 (8%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGG-----GGSYGGGGGRREGGGGYSGGGGG 196
           EA   G GGGGG  GGGGGG     GGGY GG     GG YGGGG    GGGG  G GGG
Sbjct: 120 EAGGHGGGGGGG-AGGGGGGGGGAHGGGYGGGQGAGAGGGYGGGGAGGHGGGGGGGNGGG 178

Query: 197 YSSRGGGGGSYGGGRREGGG---GYGGGEG-GGYGGSGGGGG 310
                G GG++GGG   GGG   GYGGG G GG+GG GGGGG
Sbjct: 179 GGGGSGEGGAHGGGYGAGGGAGEGYGGGAGAGGHGGGGGGGG 220

 Score =  105 bits (261), Expect = 2e-21
 Identities = 53/90 (58%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG---GGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G GG GGH GGGGGG   GGGGG   G   GG YG GGG  EG GG +G GG     GGG
Sbjct: 160 GGGGAGGHGGGGGGGNGGGGGGGSGEGGAHGGGYGAGGGAGEGYGGGAGAGGHGGGGGGG 219

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GGS GGG   GGGGY    G G+GG  GGG
Sbjct: 220 GGSGGGG--GGGGGYAAASGYGHGGGAGGG 247

 Score =  104 bits (260), Expect = 3e-21
 Identities = 52/90 (57%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREG---GGGYSGGGGGYSSRGGG 217
           G+G GGG  GG GGG   G GGG  GGGG++GGG G  +G   GGGY GGG G    GGG
Sbjct: 113 GAGYGGGEAGGHGGGGGGGAGGGGGGGGGAHGGGYGGGQGAGAGGGYGGGGAGGHGGGGG 172

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GG+ GGG   GG G GG  GGGYG  GG G
Sbjct: 173 GGNGGGG--GGGSGEGGAHGGGYGAGGGAG 200

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/95 (60%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG--GGSYGGGGGRREGGGGYSGG--GGGYSSR-- 208
           G GGGGG  GG GGG   GGG GY GG  GG  GGGGG   GGGG  GG  GGGY     
Sbjct: 93  GGGGGGGPGGGYGGGSGEGGGAGYGGGEAGGHGGGGGGGAGGGGGGGGGAHGGGYGGGQG 152

Query: 209 GGGGGSYGGGRREG-GGGYGGGEGGGYGGSGGGGG 310
            G GG YGGG   G GGG GGG GGG GG  G GG
Sbjct: 153 AGAGGGYGGGGAGGHGGGGGGGNGGGGGGGSGEGG 187

 Score =  102 bits (255), Expect = 1e-20
 Identities = 55/95 (57%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +2

Query: 26  VNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSS 205
           VN   S G G G G   GGG GY  GGG G  GG G +G G     GGGG+ GG GG   
Sbjct: 40  VNSGLSAGLGVGIGGGPGGGSGY--GGGSGEGGGAGGHGEGHIGGGGGGGHGGGAGG-GG 96

Query: 206 RGGGGGSYGGGRREGGG-GYGGGEGGGYGGSGGGG 307
            GG GG YGGG  EGGG GYGGGE GG+GG GGGG
Sbjct: 97  GGGPGGGYGGGSGEGGGAGYGGGEAGGHGGGGGGG 131

 Score =  100 bits (250), Expect = 4e-20
 Identities = 52/89 (58%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGG-GYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G GGG G+ GG G G  +GG G G+ GGGG  G GGG   GGGG  GGG G  S  GGG 
Sbjct: 55  GPGGGSGYGGGSGEGGGAGGHGEGHIGGGGGGGHGGGAGGGGGGGPGGGYGGGSGEGGGA 114

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            YGGG     GG+GGG GGG GG GGGGG
Sbjct: 115 GYGGGE---AGGHGGGGGGGAGGGGGGGG 140

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 50/90 (55%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           A   G GGGGG+ GGGGGG   GG  GGGY  GGG+ G G G   G GG+ GGGGG    
Sbjct: 164 AGGHGGGGGGGNGGGGGGGSGEGGAHGGGYGAGGGA-GEGYGGGAGAGGHGGGGGGGGGS 222

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSG 298
           GGGGG  GG     G G+GGG GGG G  G
Sbjct: 223 GGGGGGGGGYAAASGYGHGGGAGGGEGSGG 252

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 7/51 (13%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGG-------SYGGGGGRREGGGGY 178
           G  G GGH GGGGGG  SGGGG   GGGG        +GGG G  EG GGY
Sbjct: 205 GGAGAGGHGGGGGGGGGSGGGG--GGGGGYAAASGYGHGGGAGGGEGSGGY 253

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 30/60 (50%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = +2

Query: 134 SYGGGGGRREG-GGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           +YG   G   G G G  GG GG S  GGG G  GG    G G  GGG GGG+G  G GGG
Sbjct: 37  AYGVNSGLSAGLGVGIGGGPGGGSGYGGGSGEGGGAGGHGEGHIGGGGGGGHG-GGAGGG 95

[142][TOP]
>UniRef100_UPI00015539C6 PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI00015539C6
          Length = 123

 Score =  115 bits (289), Expect = 1e-24
 Identities = 60/98 (61%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = +2

Query: 26  VNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSS 205
           V E    G  GGGG   GGGG    GGGGG  GGGGS GGGGG   GGGG  GGGGG   
Sbjct: 9   VREGGGGGGSGGGGGDSGGGGCSGGGGGGGGGGGGGSGGGGGG--GGGGGSGGGGGGGGG 66

Query: 206 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG--GGW 313
            G GGG  GGG   GGGG GGG GGG GG GGG  GGW
Sbjct: 67  GGSGGGGVGGGGDGGGGGGGGGGGGGGGGGGGGSSGGW 104

 Score =  103 bits (257), Expect = 6e-21
 Identities = 57/93 (61%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS-----GGGGGYSSRG 211
           G G      GGGGGG  SGGGGG SGGGG  GGGGG   GGGG       GGGGG    G
Sbjct: 3   GKGKRPVREGGGGGG--SGGGGGDSGGGGCSGGGGGG--GGGGGGGSGGGGGGGGGGGSG 58

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGG  GGG   GGG  GGG+GGG GG GGGGG
Sbjct: 59  GGGGGGGGGGSGGGGVGGGGDGGGGGGGGGGGG 91

 Score =  100 bits (248), Expect = 7e-20
 Identities = 53/83 (63%), Positives = 54/83 (65%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           S G GGGGG  GGG GG   GGGGG SGGGG  GGGGG   GGGG  GGG G    GGGG
Sbjct: 31  SGGGGGGGGGGGGGSGGGGGGGGGGGSGGGGGGGGGGG--SGGGGVGGGGDG----GGGG 84

Query: 221 GSYGGGRREGGGGYGGGEGGGYG 289
           G  GGG   GGGG GGG  GG+G
Sbjct: 85  GGGGGG--GGGGGGGGGSSGGWG 105

[143][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score =  115 bits (289), Expect = 1e-24
 Identities = 55/97 (56%), Positives = 56/97 (57%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPPP  PP PPP PPP PPPPS  P P  P PPP    P PPP  PPPPS 
Sbjct: 23  PPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSP 82

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP PP  PP P  P PPP   PPP PP   PPPP P
Sbjct: 83  PPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 119

 Score =  114 bits (284), Expect = 4e-24
 Identities = 56/98 (57%), Positives = 58/98 (59%), Gaps = 2/98 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P+     PPP P PP PPPSP P  PPP   PPP  PPP P    P PPP  PPPPS 
Sbjct: 45  PPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSP 104

Query: 156 LPP-PPP*LPPPPE*PP-PPPLRYPPPPPPRWPPPPPL 49
            PP PPP  PPPP  PP PPP   PP PPP  PPPP +
Sbjct: 105 PPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSI 142

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/88 (59%), Positives = 52/88 (59%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPP P PP PPPSPPP  PPPS  PP   PP PP    PPP P  PPP    P PPP  P
Sbjct: 45  PPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSP 104

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPP P   PPP PP  PPP P P
Sbjct: 105 PPPSPPPPSP---PPPSPPPSPPPSPSP 129

 Score =  107 bits (268), Expect = 3e-22
 Identities = 59/117 (50%), Positives = 61/117 (52%), Gaps = 19/117 (16%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPPS--PPPYPPPPSRLPPP*LP----PPPPLEE*PPPPPL 178
           +P P+     PPP P PP PPP   PPP PPPPS   PP  P    PPPP    P PPP 
Sbjct: 53  SPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPP 112

Query: 177 YPPPPSRLPPPP----P*LPPPPE*PPPPPLRYPPPPPPRW---------PPPPPLP 46
            PPPPS  P PP    P  PPPP  PPP     PPPPPP W         PPPPP P
Sbjct: 113 SPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPP 169

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/108 (52%), Positives = 57/108 (52%), Gaps = 13/108 (12%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPP-PPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PP PP P  PPPSPPP  PPP   PPP  PP PPP    P PPP  PPPPS  P PPP  
Sbjct: 91  PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPP-- 148

Query: 132 PPPPE*PPPPPLRYPPPPPPRW---------PPPP---PLPRD*ASLT 25
           PPPP    P     PPPPPP W         PPPP   P P   AS T
Sbjct: 149 PPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPT 196

 Score =  102 bits (255), Expect = 1e-20
 Identities = 57/132 (43%), Positives = 58/132 (43%), Gaps = 44/132 (33%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPL---------------- 178
           PPP P PP PPPSPPP P PPS  PPP  PPPP +   PPPPP                 
Sbjct: 110 PPPSPPPPSPPPSPPPSPSPPS--PPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPP 167

Query: 177 ----------------------------YPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPP 82
                                        PPPPS  P PPP  PPPP  PPPPP   PPP
Sbjct: 168 PPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPP--PPP 225

Query: 81  PPPRWPPPPPLP 46
           PPP  P P P P
Sbjct: 226 PPPSPPSPNPPP 237

 Score =  102 bits (253), Expect = 2e-20
 Identities = 60/129 (46%), Positives = 63/129 (48%), Gaps = 33/129 (25%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLP--------P*PPPSPPPY---------PPPPSRLPPP*L---P 220
           +P P   +  PPPPP P        P PPP PPP+         PPPPS  P P     P
Sbjct: 136 SPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASP 195

Query: 219 PPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPP-------------LRYPPPP 79
            PPP    P PPP  PPPPS  PPPPP  PPPP  P P P             LR PPPP
Sbjct: 196 TPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPP 255

Query: 78  PPRWPPPPP 52
           PP  PPPPP
Sbjct: 256 PP--PPPPP 262

 Score =  102 bits (253), Expect = 2e-20
 Identities = 53/94 (56%), Positives = 55/94 (58%), Gaps = 4/94 (4%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPP + P PP S  P PPPPS  P P  PPP P    PPPPP  PPPP   PP PP   
Sbjct: 180 PPPPSISPSPPSSASPTPPPPSASPSP--PPPSPPPPSPPPPPPPPPPP---PPSPPSPN 234

Query: 129 PPPE*PPPPP----LRYPPPPPPRWPPPPPLPRD 40
           PPP   P PP    LR PPPPPP  PPPP LP +
Sbjct: 235 PPPSASPSPPFGRSLRSPPPPPPP-PPPPGLPSE 267

 Score =  100 bits (249), Expect = 5e-20
 Identities = 58/140 (41%), Positives = 60/140 (42%), Gaps = 45/140 (32%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPL-PP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPP------- 181
           P P+     PPPP   PP PPPSPPP P PPS  PPP  PPPP +   PPPPP       
Sbjct: 100 PPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPS--PPPPSPPPPSISPSPPPPPPPWWQAP 157

Query: 180 -------------------------------------LYPPPPSRLPPPPP*LPPPPE*P 112
                                                  PPPPS  P PPP  PPPP  P
Sbjct: 158 SASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPP 217

Query: 111 PPPPLRYPPPPPPRWPPPPP 52
           PPPP   PPPP P  P PPP
Sbjct: 218 PPPPPPPPPPPSPPSPNPPP 237

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/86 (55%), Positives = 48/86 (55%), Gaps = 7/86 (8%)
 Frame = -3

Query: 282 PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLY----PPPPSRLPPPPP*LPPPPE* 115
           PP  PPP PPPPS  PPP  P PPPL      PP      PPPPS  P PPP LPPP   
Sbjct: 19  PPSPPPPSPPPPS--PPP--PSPPPL------PPPLPPPSPPPPSPPPSPPPPLPPPSPS 68

Query: 114 PPPPPLRYPP---PPPPRWPPPPPLP 46
           PP PP   PP   PPPP  P PPP P
Sbjct: 69  PPSPPPPSPPPPSPPPPSPPSPPPSP 94

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/91 (43%), Positives = 41/91 (45%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPPP  PP  PP PPP PPPP                 PP PP   PPPS 
Sbjct: 197 PPPPSASPSPPPPSPPPPSPPPPPPPPPPP-----------------PPSPPSPNPPPSA 239

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWP 64
            P PP         PPPPP   PPPPPP  P
Sbjct: 240 SPSPP--FGRSLRSPPPPP---PPPPPPGLP 265

[144][TOP]
>UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia
           MC0-3 RepID=B1JXE0_BURCC
          Length = 505

 Score =  115 bits (289), Expect = 1e-24
 Identities = 56/88 (63%), Positives = 57/88 (64%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGGH G GGGG  +GGG G  GGGG  GGGGG   GGGG  GGGGG    GGG G 
Sbjct: 306 GHGNGGGH-GNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGG 364

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG    GGGG GGG GGG GG GGGGG
Sbjct: 365 NGGNGGGGGGGGGGGGGGGGGGGGGGGG 392

 Score =  115 bits (287), Expect = 2e-24
 Identities = 54/88 (61%), Positives = 56/88 (63%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G+GGGGG  GGGGG    GGGGG  GGGG  GGGG    GG G  GGGGG    GGGGG 
Sbjct: 327 GNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGG 386

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   G GG GGG GGG+G  GGG G
Sbjct: 387 GGGGGGGGNGGNGGGGGGGHGNGGGGHG 414

 Score =  113 bits (282), Expect = 7e-24
 Identities = 56/92 (60%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR----GG 214
           G G GGG  G GGG    GGGGG  GGGG+  GGGG   GGGG  GGGGG        GG
Sbjct: 312 GHGNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGG 371

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG  GGG   GGGG GGG GGG GG+GGGGG
Sbjct: 372 GGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGG 403

 Score =  113 bits (282), Expect = 7e-24
 Identities = 57/97 (58%), Positives = 60/97 (61%), Gaps = 3/97 (3%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGG---GGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 199
           N     G+GGG G+ GGGGGG   GG   GGG  GGGG  GGGGG   GG G +GGGGG 
Sbjct: 315 NGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGG 374

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
              GGGGG  GGG   GGGG GG  GGG GG G GGG
Sbjct: 375 GGGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGGG 411

 Score =  112 bits (280), Expect = 1e-23
 Identities = 52/88 (59%), Positives = 54/88 (61%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G+GGGGG  GGGGGG   GG GG  G GG  GGGGG   GGGG  GGGGG    GG GG 
Sbjct: 342 GNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGG 401

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG+G G G G G   GG G
Sbjct: 402 GGGGHGNGGGGHGNGGGNGNGNGSGGAG 429

 Score =  111 bits (278), Expect = 2e-23
 Identities = 57/101 (56%), Positives = 60/101 (59%), Gaps = 11/101 (10%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGG-----------GGYSGGGGSYGGGGGRREGGGGYSGG 187
           S G G GGGH G GGGG+ SGGG           GG+  GGG  G GGG   GGGG  GG
Sbjct: 278 SGGHGSGGGH-GDGGGGHGSGGGHGDGGGGHGNGGGHGNGGGGNGNGGGPGNGGGGGGGG 336

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG +  GGGGG  GGG   GGGG  GG GG  GG GGGGG
Sbjct: 337 GGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGG 377

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/88 (61%), Positives = 55/88 (62%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG+  GGGGG   GGGGG  GGGG   GG G   GGGG  GGGGG    GGGGG 
Sbjct: 334 GGGGGGGNGNGGGGG---GGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGG 390

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG    GGG GGG G G GG G GGG
Sbjct: 391 GGGGNGGNGGGGGGGHGNGGGGHGNGGG 418

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/91 (60%), Positives = 58/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGG---GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           GSGGG G  GGG   GGG+ +GGGG  +GGG   GGGGG   GGGG   GGGG    GGG
Sbjct: 295 GSGGGHGDGGGGHGNGGGHGNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGG 354

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  GGG    GG  GGG GGG GG GGGGG
Sbjct: 355 GGGGGGGAGGNGGNGGGGGGGGGGGGGGGGG 385

 Score =  108 bits (271), Expect = 1e-22
 Identities = 56/90 (62%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGGH G GGGG+ +GGG G  GGG   GGG G   GGGG  GGGGG  + GGGGG 
Sbjct: 293 GHGSGGGH-GDGGGGHGNGGGHGNGGGGNGNGGGPGNGGGGGG-GGGGGGNGNGGGGGGG 350

Query: 227 YGGGRREGGGGYGG--GEGGGYGGSGGGGG 310
            GGG   GGGG GG  G GGG GG GGGGG
Sbjct: 351 GGGGGGGGGGGAGGNGGNGGGGGGGGGGGG 380

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/96 (56%), Positives = 59/96 (61%), Gaps = 8/96 (8%)
 Frame = +2

Query: 47  GSGGG-----GGHRGGGGGGYRSGG---GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYS 202
           G+GGG     GGH  GGG G  SGG   GGG+  GGG +G GGG  +GGGG+  GGG   
Sbjct: 256 GNGGGHGDGSGGHGNGGGHGDGSGGHGSGGGHGDGGGGHGSGGGHGDGGGGHGNGGG--H 313

Query: 203 SRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGGG   GGG   GGGG GGG GGG G  GGGGG
Sbjct: 314 GNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGG 349

 Score =  104 bits (259), Expect = 3e-21
 Identities = 53/94 (56%), Positives = 57/94 (60%), Gaps = 4/94 (4%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGG----GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           S G G GGGH G G GG+ SGGG    GG  G GG +G GGG    GGG+  GGGG  + 
Sbjct: 265 SGGHGNGGGH-GDGSGGHGSGGGHGDGGGGHGSGGGHGDGGGGHGNGGGHGNGGGGNGNG 323

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG G   GGG   GGGG G G GGG GG GGGGG
Sbjct: 324 GGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGG 357

 Score =  103 bits (256), Expect = 8e-21
 Identities = 50/87 (57%), Positives = 53/87 (60%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGG G   G GGG  GGGG  GGGGG   GGGG  GGGG   + GGGGG 
Sbjct: 349 GGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGG---GGGGGGGGGGNGGNGGGGGGG 405

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGG 307
           +G G    G G G G G G GG+G GG
Sbjct: 406 HGNGGGGHGNGGGNGNGNGSGGAGNGG 432

 Score =  102 bits (253), Expect = 2e-20
 Identities = 50/88 (56%), Positives = 52/88 (59%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GG GG   +GGGGG  GGGG  GGGGG   GGGG  GG GG    GGGG  
Sbjct: 351 GGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGG---GGGGGGGGNGGNGGGGGGGHG 407

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG    GGG G G G G  G+GG  G
Sbjct: 408 NGGGGHGNGGGNGNGNGSGGAGNGGANG 435

 Score =  100 bits (250), Expect = 4e-20
 Identities = 47/88 (53%), Positives = 49/88 (55%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG   GG   GGGGG   GGGG+  GGG  +  G GG  
Sbjct: 370 GGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGGGGHGNGGGNGNGNGSGGAG 429

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG    G G   GG  G  GGS G GG
Sbjct: 430 NGGANGVGNGRGNGGNSGNAGGSNGNGG 457

 Score =  100 bits (249), Expect = 5e-20
 Identities = 50/89 (56%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  G GG G   GGGGG  GGGG  GGGGG   G GG  GGGGG    GGGG  
Sbjct: 355 GGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGGGGHG 414

Query: 227 YGGGRREGGGGYGGGEGGGYG-GSGGGGG 310
            GGG   G G  G G GG  G G+G G G
Sbjct: 415 NGGGNGNGNGSGGAGNGGANGVGNGRGNG 443

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 48/92 (52%), Positives = 53/92 (57%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           A   G  GGGG  GGGGGG   GGGGG  GGGG+ G GGG   GGGG+  GGGG+ + GG
Sbjct: 362 AGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGG---GGGGHGNGGGGHGNGGG 418

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            G   G G    GG  G G G G GG+ G  G
Sbjct: 419 NGNGNGSGGAGNGGANGVGNGRGNGGNSGNAG 450

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 47/92 (51%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY----SSRGG 214
           G GGGGG  GGG GG   GGGGG+  GGG +G GGG   G G    G GG     + RG 
Sbjct: 383 GGGGGGGGGGGGNGGNGGGGGGGHGNGGGGHGNGGGNGNGNGSGGAGNGGANGVGNGRGN 442

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG S   G   G GG G G GGG GG+ G GG
Sbjct: 443 GGNSGNAGGSNGNGGGGAGNGGGSGGANGTGG 474

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 50/96 (52%), Positives = 59/96 (61%), Gaps = 8/96 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG------GSYGGGGGRREGGGGYSGGGGGYSSR 208
           G+ GGG   GGG GG   G GGG+  GG      G +G GGG  +G GG+ G GGG+   
Sbjct: 232 GTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGSGGHGNGGGHGDGSGGH-GSGGGHGDG 290

Query: 209 GGGGGSYGGGRREGGGGY--GGGEGGGYGGSGGGGG 310
           GGG GS GGG  +GGGG+  GGG G G GG+G GGG
Sbjct: 291 GGGHGS-GGGHGDGGGGHGNGGGHGNGGGGNGNGGG 325

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 46/90 (51%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   G GG   GGGG +G GGG    GGG   G G   +  GG   
Sbjct: 376 GGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGGGGHGNGGGNGNGNGSGGAGNGGANG 435

Query: 227 YGGGRREGG--GGYGGGEGGGYGGSGGGGG 310
            G GR  GG  G  GG  G G GG+G GGG
Sbjct: 436 VGNGRGNGGNSGNAGGSNGNGGGGAGNGGG 465

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/96 (52%), Positives = 58/96 (60%), Gaps = 6/96 (6%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGG----GGSYGGGGGRREGGGGYSGGGGGYSSR 208
           S G   GGG  GGG  G  + GGGG+ GG    GG +G GGG  +G GG+ G GGG+   
Sbjct: 219 SGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGSGGH-GNGGGHGDG 277

Query: 209 GGGGGSYGGGRREGGGGY--GGGEGGGYGGSGGGGG 310
            GG GS GGG  +GGGG+  GGG G G GG G GGG
Sbjct: 278 SGGHGS-GGGHGDGGGGHGSGGGHGDGGGGHGNGGG 312

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/92 (55%), Positives = 53/92 (57%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG---GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G+ GGG   GG  GG  SGGG   GG SGGG S GG  G    GGG SGGG       GG
Sbjct: 182 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 241

Query: 218 GGSYGGGRREGGG-GYGGGEGGGYGGSGGGGG 310
           GG  GGG  +GGG G GGG G G GG G GGG
Sbjct: 242 GGHGGGGDGDGGGHGNGGGHGDGSGGHGNGGG 273

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/104 (49%), Positives = 58/104 (55%), Gaps = 16/104 (15%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGG-GYSGGGGSYGGGGGRREGG----------GGYSGGGG 193
           G GG GG+ GGGGGG+ +GGGG G  GG G+  G GG   GG          GG SG  G
Sbjct: 391 GGGGNGGNGGGGGGGHGNGGGGHGNGGGNGNGNGSGGAGNGGANGVGNGRGNGGNSGNAG 450

Query: 194 GYSSRGGG----GGSYGGGRREGGGGYGGGEGGGYG-GSGGGGG 310
           G +  GGG    GG  GG    GG G GGG G G+G G+G GGG
Sbjct: 451 GSNGNGGGGAGNGGGSGGANGTGGHGNGGGNGNGHGTGNGNGGG 494

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/97 (54%), Positives = 54/97 (55%), Gaps = 7/97 (7%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGG--GGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGG---GGY 199
           S G   GGG  GGG  GGG   GG  GGG SGGG S GG  G    GGG SGGG   GG 
Sbjct: 164 SGGGTSGGGTSGGGTTGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 223

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           S  G  GG   GG   GGGG+GGG  G  GG G GGG
Sbjct: 224 SGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGG 260

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 49/92 (53%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG--GGYSGGGGSYGGG--GGRREGGGGYSGGGGGYSSRGG 214
           G+ GGG   GG  GG  SGGG  GG + GGG+ GGG  GG   GGGG+ GGG G     G
Sbjct: 197 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHG 256

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG +G G   GG G GGG G G GG G GGG
Sbjct: 257 NGGGHGDG--SGGHGNGGGHGDGSGGHGSGGG 286

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/98 (56%), Positives = 57/98 (58%), Gaps = 8/98 (8%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGG--GGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGG--GGYS 202
           S G   GGG  GGG  GGG   GG  GGG SGGG S GG  G    GGG SGGG  GG +
Sbjct: 159 SGGGTSGGGTSGGGTSGGGTTGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 218

Query: 203 SRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           S GG  GGG+ GGG   GG   GGG GGG  G GGG G
Sbjct: 219 SGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHG 256

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/93 (54%), Positives = 55/93 (59%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG---GGYSGGGGSYGGG-GGRREGGGGYSGGGGGYSSRGG 214
           G+ GGG   GG  GG  SGGG   GG SGGG S GGG GG  +G GG  G GGG+    G
Sbjct: 207 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGSG 266

Query: 215 GGGSYGG-GRREGGGGYGGGEGGGYGGSGGGGG 310
           G G+ GG G   GG G GGG G G GG G GGG
Sbjct: 267 GHGNGGGHGDGSGGHGSGGGHGDGGGGHGSGGG 299

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 53/107 (49%), Positives = 59/107 (55%), Gaps = 7/107 (6%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGG---GGGYSGGGGSYGGGGGRREGGGGYS 181
           G + + N     G+ GGG   GG  GG  SGG   GGG +GGG S GG  G    GGG S
Sbjct: 140 GGNASGNGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGGGTSGGGTSGGGTSGGGTS 199

Query: 182 GGG--GGYSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG  GG +S GG  GGG+ GGG   GG   GG  GGG  G GG GG
Sbjct: 200 GGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGG 246

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 51/107 (47%), Positives = 53/107 (49%), Gaps = 11/107 (10%)
 Frame = +2

Query: 23  TVNEAQSRGSGGGGGHRGGGGGGYRSGG-------GGGYSGGGGSYGGGGGRREGGGGYS 181
           T       G GG     GG GGG   GG       GGG SGGG S GG  G    GGG S
Sbjct: 130 TSGSTSGTGRGGNASGNGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGGGTSGGGTS 189

Query: 182 GGG--GGYSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG  GG +S GG  GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 190 GGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 236

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/99 (48%), Positives = 50/99 (50%), Gaps = 4/99 (4%)
 Frame = +2

Query: 26  VNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG--GGY 199
           V  A    SG   G   GG      G GGG SGGG S GG  G    GGG SGGG  GG 
Sbjct: 123 VGGATGGTSGSTSGTGRGGNASGNGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGGG 182

Query: 200 SSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           +S GG  GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 183 TSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 221

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 47/93 (50%), Positives = 50/93 (53%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYR-SGGGGGYSGGGGSYGGGGGRREGGGGYSGGG--GGYSSRGG- 214
           G  G GG  GG  G    +G GG  SG GGS GG  G    GGG SGGG  GG +S GG 
Sbjct: 119 GPAGVGGATGGTSGSTSGTGRGGNASGNGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 178

Query: 215 -GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 179 TGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 211

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/116 (43%), Positives = 57/116 (49%), Gaps = 24/116 (20%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGG-------GYSGGGGSYGGGGGRREG--------- 166
           A   G+G G G+ GG GGG  +G GG       G +G GG+ GG  G   G         
Sbjct: 86  AGGSGNGNGNGNGGGTGGGNGNGSGGNNGNGAVGPAGVGGATGGTSGSTSGTGRGGNASG 145

Query: 167 ----GGGYSGGG--GGYSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
               GGG SGGG  GG +S GG  GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 146 NGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGGGTSGGGTSGGGTSGGGTSGG 201

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 50/101 (49%), Positives = 54/101 (53%), Gaps = 6/101 (5%)
 Frame = +2

Query: 26  VNEAQSRGSGGG--GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG--G 193
           V  A   G+ GG  G   G G GG  SG GG  SGGG S GG  G    GGG SGGG  G
Sbjct: 118 VGPAGVGGATGGTSGSTSGTGRGGNASGNGG--SGGGTSGGGTSGGGTSGGGTSGGGTSG 175

Query: 194 GYSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G ++ GG  GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 176 GGTTGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 216

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 46/106 (43%), Positives = 54/106 (50%), Gaps = 6/106 (5%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG--GGGGRREGGGGYSG 184
           GR +    A + GSG G G+  GGG G  +G G G + G G+ G  G GG   G  G + 
Sbjct: 76  GRGVGNGGAGAGGSGNGNGNGNGGGTGGGNGNGSGGNNGNGAVGPAGVGGATGGTSGSTS 135

Query: 185 G---GGGYSSRGG-GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G   GG  S  GG GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 136 GTGRGGNASGNGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGG 181

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/109 (40%), Positives = 52/109 (47%), Gaps = 13/109 (11%)
 Frame = +2

Query: 17  SITVNEAQSRGSGGGGGHRGGGGGGYRSG---GGGGYSGGGGSYGGGGGRREGGGGYSGG 187
           ++ V   +  G+GG G    G G G  +G   GGG  +G GG+ G G     G GG +GG
Sbjct: 70  AVHVYAGRGVGNGGAGAGGSGNGNGNGNGGGTGGGNGNGSGGNNGNGAVGPAGVGGATGG 129

Query: 188 ----------GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
                     GG  S  GG GG   GG   GGG  GGG  GG G SGGG
Sbjct: 130 TSGSTSGTGRGGNASGNGGSGGGTSGGGTSGGGTSGGGTSGG-GTSGGG 177

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 35/85 (41%), Positives = 42/85 (49%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           N +   G+GG  G   G G G  SG  GG +G GG   G G    GG G + G GG+ + 
Sbjct: 423 NGSGGAGNGGANGVGNGRGNGGNSGNAGGSNGNGGGGAGNG----GGSGGANGTGGHGNG 478

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGG 283
           GG G  +G G   GGG   GG  GG
Sbjct: 479 GGNGNGHGTGNGNGGGHGNGGSSGG 503

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = +2

Query: 50  SGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 229
           SG  GG  G GGGG  +GGG G + G G +G GGG   G G  +G GGG+ + G  GG++
Sbjct: 446 SGNAGGSNGNGGGGAGNGGGSGGANGTGGHGNGGGNGNGHGTGNGNGGGHGNGGSSGGNH 505

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/95 (41%), Positives = 41/95 (43%), Gaps = 14/95 (14%)
 Frame = +2

Query: 68  HRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG--GGGGSYG--- 232
           H   G G    G G G SG G   G GGG   G G  SGG  G  + G  G GG+ G   
Sbjct: 72  HVYAGRGVGNGGAGAGGSGNGNGNGNGGGTGGGNGNGSGGNNGNGAVGPAGVGGATGGTS 131

Query: 233 --------GGRREGGGGYGGG-EGGGYGGSGGGGG 310
                   GG   G GG GGG  GGG  G G  GG
Sbjct: 132 GSTSGTGRGGNASGNGGSGGGTSGGGTSGGGTSGG 166

[145][TOP]
>UniRef100_Q41810 Glycine-rich protein n=1 Tax=Zea mays RepID=Q41810_MAIZE
          Length = 155

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/102 (65%), Positives = 70/102 (68%), Gaps = 2/102 (1%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGY 178
           +LDGR+ITVNEAQSRG       RGGGGGGY  G GGGGY        GGGGRR+GGGGY
Sbjct: 73  ELDGRNITVNEAQSRGG------RGGGGGGYGGGRGGGGY--------GGGGRRDGGGGY 118

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGG-EGGGYGGSGG 301
            GGGGGY    GGGG YGG    GGGGYGGG  GGGYG S G
Sbjct: 119 -GGGGGY----GGGGGYGG----GGGGYGGGNRGGGYGNSDG 151

[146][TOP]
>UniRef100_Q10FE5 Retrotransposon protein, putative, Ty1-copia subclass, expressed
           n=1 Tax=Oryza sativa Japonica Group RepID=Q10FE5_ORYSJ
          Length = 153

 Score =  115 bits (289), Expect = 1e-24
 Identities = 61/101 (60%), Positives = 63/101 (62%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQSR SGGGGG               GY GGGG YGGGGG     GGY 
Sbjct: 73  ELDGRNITVNEAQSRRSGGGGG---------------GYGGGGGGYGGGGG-----GGYG 112

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
              GGY    GGGG YGGGR  GGGGYGG  GGGYGG  GG
Sbjct: 113 RREGGY----GGGGGYGGGRGGGGGGYGGSRGGGYGGDSGG 149

[147][TOP]
>UniRef100_O24187 OsGRP1 n=1 Tax=Oryza sativa RepID=O24187_ORYSA
          Length = 160

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/100 (67%), Positives = 70/100 (70%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQSR SGGGGG    GG G R GGGGGY GGGG YGGG     GGGGY+
Sbjct: 73  ELDGRNITVNEAQSRRSGGGGG----GGYGQR-GGGGGY-GGGGGYGGG-----GGGGYA 121

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG 301
              GGY    GGGG YGGG R GGGGYGGG G G G S G
Sbjct: 122 SREGGY----GGGGGYGGG-RGGGGGYGGGYGRGGGNSDG 156

[148][TOP]
>UniRef100_O24184 Glycine-rich RNA-binding protein n=1 Tax=Oryza sativa
           RepID=O24184_ORYSA
          Length = 165

 Score =  115 bits (289), Expect = 1e-24
 Identities = 70/108 (64%), Positives = 72/108 (66%), Gaps = 4/108 (3%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQSR SGGGGG    GG G R GGGGGY G G  YGGGGG    GGGY 
Sbjct: 73  ELDGRNITVNEAQSRRSGGGGG----GGYGQR-GGGGGYGGRG--YGGGGG----GGGYG 121

Query: 182 GGG-GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG---GGW 313
               GGY    GGGG YGGG   GGGGYGGG GGGYG  GGG   G W
Sbjct: 122 QRREGGY----GGGGGYGGGG--GGGGYGGGYGGGYGSRGGGNSDGNW 163

[149][TOP]
>UniRef100_O24106 RNA-binding protein n=1 Tax=Nicotiana glutinosa RepID=O24106_NICGU
          Length = 156

 Score =  115 bits (289), Expect = 1e-24
 Identities = 66/98 (67%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGS-GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGY 178
           DLDGR+ITVNEAQSRGS GGGGG+RGG     R GGGGGY GGG   GG GG   GGGGY
Sbjct: 71  DLDGRNITVNEAQSRGSGGGGGGYRGG-----RGGGGGGYGGGGRREGGYGG---GGGGY 122

Query: 179 SGG--GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
            GG   GGY    GGGG YGGGRRE  GGYGGG  G +
Sbjct: 123 GGGRREGGY----GGGGGYGGGRRE--GGYGGGSEGNW 154

[150][TOP]
>UniRef100_C0PNT1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PNT1_MAIZE
          Length = 94

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/102 (65%), Positives = 70/102 (68%), Gaps = 2/102 (1%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGY 178
           +LDGR+ITVNEAQSRG       RGGGGGGY  G GGGGY        GGGGRR+GGGGY
Sbjct: 12  ELDGRNITVNEAQSRGG------RGGGGGGYGGGRGGGGY--------GGGGRRDGGGGY 57

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGG-EGGGYGGSGG 301
            GGGGGY    GGGG YGG    GGGGYGGG  GGGYG S G
Sbjct: 58  -GGGGGY----GGGGGYGG----GGGGYGGGNRGGGYGNSDG 90

[151][TOP]
>UniRef100_B6U1V8 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays
           RepID=B6U1V8_MAIZE
          Length = 156

 Score =  115 bits (289), Expect = 1e-24
 Identities = 64/95 (67%), Positives = 67/95 (70%), Gaps = 2/95 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGG-GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGY 178
           +LDGR+ITVN+AQSRG GGGGG RGG GGGGY   GGG   GG G  GG GGRREGGGG 
Sbjct: 73  ELDGRNITVNQAQSRGGGGGGGGRGGRGGGGY---GGGRRDGGYGGGGGYGGRREGGGGG 129

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGG-YGGGEGG 280
            GGGGGY           GGRREGGGG YGGG GG
Sbjct: 130 YGGGGGY-----------GGRREGGGGGYGGGGGG 153

[152][TOP]
>UniRef100_B6STA5 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays
           RepID=B6STA5_MAIZE
          Length = 155

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/102 (65%), Positives = 70/102 (68%), Gaps = 2/102 (1%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGY 178
           +LDGR+ITVNEAQSRG       RGGGGGGY  G GGGGY        GGGGRR+GGGGY
Sbjct: 73  ELDGRNITVNEAQSRGG------RGGGGGGYGGGRGGGGY--------GGGGRRDGGGGY 118

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGG-EGGGYGGSGG 301
            GGGGGY    GGGG YGG    GGGGYGGG  GGGYG S G
Sbjct: 119 -GGGGGY----GGGGGYGG----GGGGYGGGNRGGGYGNSDG 151

[153][TOP]
>UniRef100_B3LBB3 Putative uncharacterized protein n=1 Tax=Plasmodium knowlesi strain
           H RepID=B3LBB3_PLAKH
          Length = 935

 Score =  115 bits (289), Expect = 1e-24
 Identities = 60/107 (56%), Positives = 68/107 (63%), Gaps = 4/107 (3%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGG---GGGRREGGG 172
           +L+   ++  +   +G GG GG  GG GGG   GGGGG  GGGG  GG   GGG  +GGG
Sbjct: 437 NLEFLDVSPEQGNKKGGGGQGGGGGGQGGGGGQGGGGGQGGGGGQGGGGGQGGGGGQGGG 496

Query: 173 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG-GGYGGSGGGGG 310
           G  GGGGG   RGGGGG  GGG + GGGG GGG G GG GG GGGGG
Sbjct: 497 GGQGGGGG-QGRGGGGGQGGGGGQGGGGGQGGGGGQGGGGGQGGGGG 542

 Score =  115 bits (287), Expect = 2e-24
 Identities = 60/95 (63%), Positives = 62/95 (65%), Gaps = 7/95 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG--GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG--GGYSSRGG 214
           G GGGGG  GGGG  GG   GGGGG  GGGG  GGGG  R GGGG  GGG  GG   +GG
Sbjct: 468 GQGGGGGQGGGGGQGGGGGQGGGGGQGGGGGQGGGGGQGRGGGGGQGGGGGQGGGGGQGG 527

Query: 215 GGGSYGGGRREGGGGYGGGEG---GGYGGSGGGGG 310
           GGG  GGG + GGGG GGG G   GG GG GGGGG
Sbjct: 528 GGGQGGGGGQGGGGGQGGGGGQGRGGGGGQGGGGG 562

 Score =  108 bits (270), Expect = 2e-22
 Identities = 56/90 (62%), Positives = 60/90 (66%), Gaps = 3/90 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG---GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G GGGGG  GGGG   GG + GGGG   GGGG  GGGGG  +GGGG  GGGGG   +GGG
Sbjct: 480 GQGGGGGQGGGGGQGGGGGQGGGGGQGRGGGGGQGGGGG--QGGGGGQGGGGG---QGGG 534

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GG  GGG + GGGG G G GGG GG GG G
Sbjct: 535 GGQGGGGGQGGGGGQGRGGGGGQGGGGGQG 564

 Score =  107 bits (267), Expect = 4e-22
 Identities = 58/93 (62%), Positives = 61/93 (65%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG---GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G GGGGG  GGGG   GG +  GGGG  GGGG  GGGGG  +GGGG  GGGGG   +GGG
Sbjct: 486 GQGGGGGQGGGGGQGGGGGQGRGGGGGQGGGGGQGGGGG--QGGGGGQGGGGG---QGGG 540

Query: 218 GGSYGGG--RREGGGGYGGGEGGGYGGSGGGGG 310
           GG  GGG   R GGGG GGG G G GG GG GG
Sbjct: 541 GGQGGGGGQGRGGGGGQGGGGGQGRGGGGGQGG 573

 Score =  105 bits (263), Expect = 1e-21
 Identities = 57/91 (62%), Positives = 60/91 (65%), Gaps = 5/91 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG---GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G GGGGG   GGGGG   GGG   GG  GGGG  GGGGG  +GGGG  GGGGG   RGGG
Sbjct: 498 GQGGGGGQGRGGGGGQGGGGGQGGGGGQGGGGGQGGGGG--QGGGGGQGGGGG-QGRGGG 554

Query: 218 GGSYGGG--RREGGGGYGGGEGGGYGGSGGG 304
           GG  GGG   R GGGG GGG+ GG  G+GGG
Sbjct: 555 GGQGGGGGQGRGGGGGQGGGKEGGGQGAGGG 585

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 49/84 (58%), Positives = 52/84 (61%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           Q RG GGG G  GG GGG   GGGGG  GGGG  GGGG   +GGGG  G GGG    GGG
Sbjct: 505 QGRGGGGGQGGGGGQGGGGGQGGGGGQGGGGGQGGGGG---QGGGGGQGRGGGGGQGGGG 561

Query: 218 GGSYGGGRREGGGGYGGGEGGGYG 289
           G   GGG  +GGG  GGG+G G G
Sbjct: 562 GQGRGGGGGQGGGKEGGGQGAGGG 585

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/74 (51%), Positives = 42/74 (56%), Gaps = 3/74 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG---GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G GGGGG  GGGG   GG + GGGG   GGGG  GGGGG+  GGGG  GGG     +G G
Sbjct: 524 GQGGGGGQGGGGGQGGGGGQGGGGGQGRGGGGGQGGGGGQGRGGGGGQGGGKEGGGQGAG 583

Query: 218 GGSYGGGRREGGGG 259
           GG +      G  G
Sbjct: 584 GGVFIATYERGSKG 597

[154][TOP]
>UniRef100_C5MJK0 Predicted protein n=1 Tax=Candida tropicalis MYA-3404
           RepID=C5MJK0_CANTT
          Length = 681

 Score =  115 bits (289), Expect = 1e-24
 Identities = 60/91 (65%), Positives = 62/91 (68%), Gaps = 4/91 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG-GGSYGGG--GGRREGGGGYSGGGGGYSSRGGG 217
           G G GGG+ GG GGGY  G GGGY GG GG YGGG  GG  +G GG SGGG G    GG 
Sbjct: 368 GGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGSGGGYCDGYGGGSGGGSGGGYGGGY 427

Query: 218 GGSYGGGRREG-GGGYGGGEGGGYGGSGGGG 307
           GG YGGG   G GGGYGGG GGGYGG GGGG
Sbjct: 428 GGGYGGGYGGGYGGGYGGGYGGGYGGGGGGG 458

 Score =  115 bits (287), Expect = 2e-24
 Identities = 61/93 (65%), Positives = 62/93 (66%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG-GGSYGGGGGRREGGG---GYSGGGGGYSSRGG 214
           G G GGG+ GG GGGY  G GGGY GG GG YGGG G   GGG   GY GG GG  S GG
Sbjct: 364 GGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGSGGGYCDGYGGGSGG-GSGGG 422

Query: 215 GGGSYGGGRREG-GGGYGGGEGGGYGGSGGGGG 310
            GG YGGG   G GGGYGGG GGGYGG  GGGG
Sbjct: 423 YGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGG 455

 Score =  110 bits (275), Expect = 5e-23
 Identities = 60/95 (63%), Positives = 60/95 (63%), Gaps = 8/95 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG-GGSYGGGGGRREGGG---GYSGG-GGGYSSRG 211
           G G GGG  GG GGGY  G GGGY GG GG YGGG G   GGG   GY GG GGGY    
Sbjct: 344 GGGSGGGSGGGSGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGS 403

Query: 212 GGG--GSYGGGRREG-GGGYGGGEGGGYGGSGGGG 307
           GGG    YGGG   G GGGYGGG GGGYGG  GGG
Sbjct: 404 GGGYCDGYGGGSGGGSGGGYGGGYGGGYGGGYGGG 438

 Score =  108 bits (271), Expect = 1e-22
 Identities = 60/97 (61%), Positives = 61/97 (62%), Gaps = 10/97 (10%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG-GGSYGGGGGRREGGG---GYSGG-GGGYSSRG 211
           G+GGGGG  GG GGG   G GGGY GG GG YGGG G   GGG   GY GG GGGY   G
Sbjct: 336 GTGGGGGSGGGSGGGSGGGSGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYG--G 393

Query: 212 GGGGSYGGGRREG-----GGGYGGGEGGGYGGSGGGG 307
           G GG YGGG   G     GGG GGG GGGYGG  GGG
Sbjct: 394 GYGGGYGGGSGGGYCDGYGGGSGGGSGGGYGGGYGGG 430

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 58/102 (56%), Positives = 59/102 (57%), Gaps = 6/102 (5%)
 Frame = +2

Query: 23  TVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYS 202
           T+    S   G  GG  GGGG G  SGGG G  G GG YGGG G   GGG   G GGGY 
Sbjct: 322 TICPYDSCRKGPVGGTGGGGGSGGGSGGGSG-GGSGGGYGGGYGGGYGGGYGGGYGGGYG 380

Query: 203 SRGGGGGSYGGGRREG-GGGYGGGEGGGY-----GGSGGGGG 310
             GG GG YGGG   G GGGYGGG GGGY     GGSGGG G
Sbjct: 381 --GGYGGGYGGGYGGGYGGGYGGGSGGGYCDGYGGGSGGGSG 420

[155][TOP]
>UniRef100_UPI0000E4714A PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E4714A
          Length = 202

 Score =  115 bits (288), Expect = 2e-24
 Identities = 58/88 (65%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG     GGG  
Sbjct: 74  GGGGGGGGIGGGGGGAIGGGGGGGGGGGGIGGGGGG---GGGGIGGGGGGGGGGIGGGIG 130

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGGGG
Sbjct: 131 GGGGGGIGGGGIGGGGGGGIGGGGGGGG 158

 Score =  113 bits (283), Expect = 6e-24
 Identities = 56/88 (63%), Positives = 56/88 (63%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  G GG   G GG   GGGG  GGGGG    GGGGG 
Sbjct: 39  GGGGGGGGGGGGGGGGGGGGGGGVCGSGGEKNGIGGGGGGGGGIGGGGGGAIGGGGGGGG 98

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GG GGG G
Sbjct: 99  GGGGIGGGGGGGGGGIGGGGGGGGGGIG 126

 Score =  111 bits (278), Expect = 2e-23
 Identities = 58/92 (63%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG-----GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG 211
           G GGGGG  GGGGGG    GG     GG  GGGG  GGGGG   GGGG  GGGGG    G
Sbjct: 47  GGGGGGGGGGGGGGGVCGSGGEKNGIGGGGGGGGGIGGGGGGAIGGGG--GGGGGGGGIG 104

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GGGG  GGG   GGGG GGG GGG GG GGGG
Sbjct: 105 GGGGGGGGGIGGGGGGGGGGIGGGIGGGGGGG 136

 Score =  110 bits (276), Expect = 4e-23
 Identities = 58/93 (62%), Positives = 60/93 (64%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG----GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           G GGGGG  GGGG    GG ++G GGG  GGGG  GGGGG   GGGG  GGGGG    GG
Sbjct: 49  GGGGGGGGGGGGGVCGSGGEKNGIGGGGGGGGGIGGGGGGAIGGGGGGGGGGGGIGGGGG 108

Query: 215 GGGS-YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG   GGG   GGGG GGG GGG GG  GGGG
Sbjct: 109 GGGGGIGGGGGGGGGGIGGGIGGGGGGGIGGGG 141

 Score =  104 bits (260), Expect = 3e-21
 Identities = 57/100 (57%), Positives = 59/100 (59%), Gaps = 4/100 (4%)
 Frame = +2

Query: 23  TVNEAQSRGSGG--GGGHRGGGGGGYRSGGGGGYSGGGGSYG--GGGGRREGGGGYSGGG 190
           TVN A    + G   GG  GGGGGG   GGGGG  GGGG  G  G GG + G GG  GGG
Sbjct: 20  TVNTASRMQTTGLRNGGIGGGGGGGGGGGGGGGGGGGGGGGGVCGSGGEKNGIGGGGGGG 79

Query: 191 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG    GGG    GGG   GGGG GGG GGG GG GGGGG
Sbjct: 80  GGIGGGGGGAIGGGGGGGGGGGGIGGGGGGGGGGIGGGGG 119

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 48/85 (56%), Positives = 48/85 (56%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GG GG  GGGGGG   GGGGG  G GG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 99  GGGGIGGGGGGGGGGIGGGGGGGGGGIGGGIGGGGGGGIGGGGIGGGGGGGIGGGGGGGG 158

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGG 301
            G     G    G G G G GG GG
Sbjct: 159 RGVAPDGGSSDIGSGSGRGVGGGGG 183

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 49/93 (52%), Positives = 51/93 (54%), Gaps = 7/93 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG G  GGGGGG   GG GG  GGGG  GGGG    GGGG  GGGGG    GG G +
Sbjct: 109 GGGGGIGGGGGGGGGGIGGGIGG--GGGGGIGGGGIGGGGGGGIGGGGGG----GGRGVA 162

Query: 227 YGGGRREGGGGYGGGEGGGYG-------GSGGG 304
             GG  + G G G G GGG G       G GGG
Sbjct: 163 PDGGSSDIGSGSGRGVGGGGGDLVSICDGVGGG 195

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 11/65 (16%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGG-----YSGGGGSYGGGGGRREGGGG------YSGGGG 193
           G  GGGG  GGGGGG   GGGGG       GG    G G GR  GGGG        G GG
Sbjct: 135 GGIGGGGIGGGGGGGIGGGGGGGGRGVAPDGGSSDIGSGSGRGVGGGGGDLVSICDGVGG 194

Query: 194 GYSSR 208
           G S+R
Sbjct: 195 GASNR 199

[156][TOP]
>UniRef100_B3XYC5 Chitin-binding lectin n=1 Tax=Solanum lycopersicum var. cerasiforme
           RepID=B3XYC5_SOLLC
          Length = 365

 Score =  115 bits (288), Expect = 2e-24
 Identities = 56/94 (59%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPP---YPPPPSRLPPP*LPPPPPLEE*PP---PPPLYPPPPSRLPPP 145
           PPPP P  PPPSPPP    PPPP+  PPP  P PPP    PP   PPP  PPPPS  PPP
Sbjct: 103 PPPPSPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPPSPPPPSPSPPP 162

Query: 144 PP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLPR 43
           P   PPPP   PPPP   PPPP P   PPPP PR
Sbjct: 163 PTPSPPPPSPSPPPPTPSPPPPAP--SPPPPYPR 194

 Score =  114 bits (285), Expect = 3e-24
 Identities = 55/88 (62%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPP-YPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPP PP P PSPPP  PPPPS  PPP  P PPP    P PPP  PPPPS  PPPP   P
Sbjct: 98  PPPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPA--PSPPPPSPPPPSPSPPPPS--P 153

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP   PPPP   PPPP P  PPP P P
Sbjct: 154 PPPSPSPPPPTPSPPPPSPSPPPPTPSP 181

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/75 (62%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPP-YPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPP P PP P PSPPP  PPPPS  PPP  P PPP    PPPP   PPPPS  PPPP   
Sbjct: 123 PPPTPSPPPPAPSPPPPSPPPPSPSPPP--PSPPPPSPSPPPPTPSPPPPSPSPPPPTPS 180

Query: 132 PPPPE*PPPPPLRYP 88
           PPPP   PPPP  YP
Sbjct: 181 PPPPAPSPPPP--YP 193

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 40/73 (54%), Positives = 40/73 (54%)
 Frame = -3

Query: 264 PYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPP 85
           P PPPPS       PPPP     P PPP  PPPPS   PPPP   PPP  P PPP   P 
Sbjct: 96  PSPPPPS-------PPPPS----PSPPPPSPPPPSP-SPPPPTPSPPPPAPSPPP---PS 140

Query: 84  PPPPRWPPPPPLP 46
           PPPP   PPPP P
Sbjct: 141 PPPPSPSPPPPSP 153

[157][TOP]
>UniRef100_B4NCX9 GK10119 n=1 Tax=Drosophila willistoni RepID=B4NCX9_DROWI
          Length = 201

 Score =  115 bits (288), Expect = 2e-24
 Identities = 59/106 (55%), Positives = 64/106 (60%), Gaps = 20/106 (18%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGG---SYGGGGGRREGGGG---------------- 175
           GGGGG  GGGGGG+  GGGGG+ GGGG    +GGGGG    GGG                
Sbjct: 36  GGGGGWGGGGGGGWGGGGGGGWGGGGGGNYGHGGGGGNYGHGGGGGGRGGTTIDVYVVKP 95

Query: 176 -YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            Y GGGGG+   GGGGG +GGG   GGGGY GG GGGY G GGGGG
Sbjct: 96  VYQGGGGGHHGGGGGGGYHGGG---GGGGYPGGGGGGYHGGGGGGG 138

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/119 (48%), Positives = 64/119 (53%), Gaps = 30/119 (25%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGG--GYSGGGGSYGGGGGRREGGGG----------YSGGG 190
           G GGGGG  GGGGGG+  GGGG  G+ GGGG+YG GGG    GG           Y GGG
Sbjct: 42  GGGGGGGWGGGGGGGWGGGGGGNYGHGGGGGNYGHGGGGGGRGGTTIDVYVVKPVYQGGG 101

Query: 191 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY------------------GGSGGGGGW 313
           GG+   GGGGG +GGG   GGGGY GG GGGY                   G GGGG +
Sbjct: 102 GGHHGGGGGGGYHGGG---GGGGYPGGGGGGYHGGGGGGGGYPQWGGGGGSGGGGGGSY 157

 Score =  102 bits (253), Expect = 2e-20
 Identities = 58/103 (56%), Positives = 61/103 (59%), Gaps = 3/103 (2%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGG--YRSGGGGGY-SGGGGSYGGGGGRREGGGGYS 181
           G +I V   +    GGGGGH GGGGGG  +  GGGGGY  GGGG Y GGGG   GGGGY 
Sbjct: 85  GTTIDVYVVKPVYQGGGGGHHGGGGGGGYHGGGGGGGYPGGGGGGYHGGGG---GGGGYP 141

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG  S GGGGGSY          YGGG GGG    GGGGG
Sbjct: 142 QWGGGGGSGGGGGGSYASS-SANSYSYGGG-GGGCNSCGGGGG 182

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/97 (55%), Positives = 55/97 (56%), Gaps = 11/97 (11%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG---------- 196
           G GGGG H GGGGGGY  GGGGGY GGGG  GGGG  + GGGG SGGGGG          
Sbjct: 107 GGGGGGYHGGGGGGGYPGGGGGGYHGGGG--GGGGYPQWGGGGGSGGGGGGSYASSSANS 164

Query: 197 YSSRGGGGGSYG-GGRREGGGGYGGGEGGGYGGSGGG 304
           YS  GGGGG    GG   G G Y       Y GS GG
Sbjct: 165 YSYGGGGGGCNSCGGGGGGNGAYAKASANAYAGSWGG 201

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 48/94 (51%), Positives = 55/94 (58%), Gaps = 20/94 (21%)
 Frame = +2

Query: 92  YRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY-----GGGR----- 241
           +  GGGGG+ GGGG   GGG    GGGG+ GGGGG    GGGGG+Y     GGGR     
Sbjct: 33  FHGGGGGGWGGGGGGGWGGG----GGGGWGGGGGGNYGHGGGGGNYGHGGGGGGRGGTTI 88

Query: 242 --------REGGGG--YGGGEGGGYGGSGGGGGW 313
                    +GGGG  +GGG GGGY G GGGGG+
Sbjct: 89  DVYVVKPVYQGGGGGHHGGGGGGGYHGGGGGGGY 122

[158][TOP]
>UniRef100_B4IZJ4 GH14508 n=1 Tax=Drosophila grimshawi RepID=B4IZJ4_DROGR
          Length = 272

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/134 (47%), Positives = 68/134 (50%), Gaps = 41/134 (30%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG---------- 184
           A ++G GGGG   GGGGGGY  GGG G  GGGG YGGGGG   GGGG SG          
Sbjct: 51  APAQGGGGGGWAAGGGGGGYGGGGGYGGGGGGGGYGGGGGGGYGGGGDSGYGGGGGGGYG 110

Query: 185 -------------------------------GGGGYSSRGGGGGSYGGGRREGGGGYGGG 271
                                          GGGG++S GGGGG YGGG   GGGGYGG 
Sbjct: 111 GGDSSGGHGGSQGQDDKIIKIISQQPSDGGYGGGGWASGGGGGGGYGGG--GGGGGYGG- 167

Query: 272 EGGGYGGSGGGGGW 313
            GGGYGG GG  GW
Sbjct: 168 -GGGYGGGGGSAGW 180

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/116 (50%), Positives = 63/116 (54%), Gaps = 19/116 (16%)
 Frame = +2

Query: 20  ITVNEAQSRGSGGGGGHRGGGGGGYRSGGGG----------------GYSGGGGSYGGGG 151
           + +    + G  GGGG  GGGG G+   GGG                G  GGG + GGGG
Sbjct: 8   LALGAVANAGYIGGGGGGGGGGHGHGDSGGGHDIKVIKVIHETAPAQGGGGGGWAAGGGG 67

Query: 152 GRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGG---SGGGGG 310
           G   GGGGY GGGGG    GGGGG YGGG   G  GYGGG GGGYGG   SGG GG
Sbjct: 68  GGYGGGGGYGGGGGGGGYGGGGGGGYGGG---GDSGYGGGGGGGYGGGDSSGGHGG 120

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/109 (53%), Positives = 63/109 (57%), Gaps = 24/109 (22%)
 Frame = +2

Query: 47  GSGGGGGH-----------------------RGGGGGGYRSGGGGGYSGGGGSYGGGGGR 157
           G GGGGGH                       +GGGGGG+ +GGGGG  GGGG YGGGGG 
Sbjct: 23  GGGGGGGHGHGDSGGGHDIKVIKVIHETAPAQGGGGGGWAAGGGGGGYGGGGGYGGGGG- 81

Query: 158 REGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGE-GGGYGGSGG 301
              GGGY GGGGG    GGG   YGGG   GGGGYGGG+  GG+GGS G
Sbjct: 82  ---GGGY-GGGGGGGYGGGGDSGYGGG---GGGGYGGGDSSGGHGGSQG 123

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/125 (42%), Positives = 57/125 (45%), Gaps = 29/125 (23%)
 Frame = +2

Query: 26  VNEAQSRGSGGGGGHR--GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 199
           +++  S G  GGGG    GGGGGGY  GGGGG  GGGG YGGGG    G  G+S GG G 
Sbjct: 132 ISQQPSDGGYGGGGWASGGGGGGGYGGGGGGGGYGGGGGYGGGG----GSAGWSAGGSGS 187

Query: 200 SSRGGGGG-------------------------SYGGGRREGGGGYGGGEGGGYGGSGG- 301
           S    GGG                         S GGG   GGG   GG   G   SGG 
Sbjct: 188 SGWSSGGGDATTAVKIIKIISESAPSAGDASGWSAGGGGASGGGWSSGGPSSGGWSSGGA 247

Query: 302 -GGGW 313
             GGW
Sbjct: 248 SSGGW 252

[159][TOP]
>UniRef100_UPI000198522B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI000198522B
          Length = 1426

 Score =  115 bits (287), Expect = 2e-24
 Identities = 67/116 (57%), Positives = 70/116 (60%), Gaps = 16/116 (13%)
 Frame = -3

Query: 345  IGNPKPN*RNYHPPPPPL---PP*PPP-----SPPPYPPPPSRLPPP*LPPPPPLEE*PP 190
            +G P P      PPPPPL   PP PPP      PPP PPPPSR  PP  PPPPPL   PP
Sbjct: 827  LGVPPP------PPPPPLRGGPPAPPPPPSRGGPPPPPPPPSRGGPP-PPPPPPLHGAPP 879

Query: 189  PPPLYPPPPSRLPPPPP*LPP----PPE*PPPPPLRYPPPPPP----RWPPPPPLP 46
            PPP  PPP S +PPPPP  PP    PP  PPPPP+R  PPPPP    R PPPPP P
Sbjct: 880  PPP--PPPRSGVPPPPP--PPMRGAPP--PPPPPMRGAPPPPPPPMGRAPPPPPPP 929

 Score =  107 bits (266), Expect = 5e-22
 Identities = 60/106 (56%), Positives = 60/106 (56%), Gaps = 18/106 (16%)
 Frame = -3

Query: 309  PPPPPLP-------P*PPPS----PPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
            PPPPPLP       P PPP     PPP PPPP R  PP  PPPPP    PPPP   PPPP
Sbjct: 806  PPPPPLPSMRGGPPPPPPPPVLGVPPPPPPPPLRGGPP-APPPPPSRGGPPPP---PPPP 861

Query: 162  SRLPPPPP*LPP----PPE*PPPPPLRYPPPPPPRW---PPPPPLP 46
            SR  PPPP  PP    PP  PPPP    PPPPPP     PPPPP P
Sbjct: 862  SRGGPPPPPPPPLHGAPPPPPPPPRSGVPPPPPPPMRGAPPPPPPP 907

 Score =  106 bits (264), Expect = 9e-22
 Identities = 62/116 (53%), Positives = 63/116 (54%), Gaps = 28/116 (24%)
 Frame = -3

Query: 309  PPPPPLPP*PP---------PSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPP-------- 181
            PPPPP PP PP         PSPPP PP PS    P  PPPPP+   PPPPP        
Sbjct: 783  PPPPPPPPPPPSSNLVGFGVPSPPPPPPLPSMRGGPPPPPPPPVLGVPPPPPPPPLRGGP 842

Query: 180  -LYPPPPSRLPPPPP*LPPPPE*-----PPPPPLR---YPPPPPPR--WPPPPPLP 46
               PPPPSR  PPPP  PPPP       PPPPPL     PPPPPPR   PPPPP P
Sbjct: 843  PAPPPPPSRGGPPPP--PPPPSRGGPPPPPPPPLHGAPPPPPPPPRSGVPPPPPPP 896

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/111 (52%), Positives = 59/111 (53%), Gaps = 14/111 (12%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPP------LPP*PPPSP----PPYPPPPSRLPPP*LPPPPPLEE*PPP 187
            P P      PPPPP       PP PPP P    PP PPPP R  PP  PPPPP+   PPP
Sbjct: 857  PPPPPSRGGPPPPPPPPLHGAPPPPPPPPRSGVPPPPPPPMRGAPP--PPPPPMRGAPPP 914

Query: 186  PPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPP----RWPPPPPLP 46
            P   PPP  R PPPP   PPP    PPPP    PPPPP    R PPPPP P
Sbjct: 915  P---PPPMGRAPPPP---PPPMRGAPPPPFGGAPPPPPPPTGRGPPPPPPP 959

 Score =  101 bits (252), Expect = 2e-20
 Identities = 62/117 (52%), Positives = 64/117 (54%), Gaps = 17/117 (14%)
 Frame = -3

Query: 342  GNPKPN*RNYHPPPPPL---PP*PPPSP----PPYPPPPSRLPPP*LPPPPPLE--E*PP 190
            G P P      PPPPPL   PP PPP P    PP PPPP R  PP  PPPPP+     PP
Sbjct: 864  GGPPP------PPPPPLHGAPPPPPPPPRSGVPPPPPPPMRGAPP--PPPPPMRGAPPPP 915

Query: 189  PPPL-----YPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPP---RWPPPPPLPR 43
            PPP+      PPPP R  PPPP    PP  PPPP  R PPPPPP   R P PP  PR
Sbjct: 916  PPPMGRAPPPPPPPMRGAPPPPFGGAPPP-PPPPTGRGPPPPPPPGGRAPGPPAPPR 971

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 55/108 (50%), Positives = 59/108 (54%), Gaps = 13/108 (12%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPP-----LPP*PPP----SPPPYPPPPSRLPPP*LPPPPPLEE*PPPP 184
            P P  R+  PPPPP      PP PPP    +PPP PPP  R PPP   PPPP+   PPPP
Sbjct: 881  PPPPPRSGVPPPPPPPMRGAPPPPPPPMRGAPPPPPPPMGRAPPP---PPPPMRGAPPPP 937

Query: 183  ----PLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
                P  PPPP+   PPPP  PPP    P PP   PP PP   PPPPP
Sbjct: 938  FGGAPPPPPPPTGRGPPPP--PPPGGRAPGPPA--PPRPPGGGPPPPP 981

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 60/118 (50%), Positives = 61/118 (51%), Gaps = 21/118 (17%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLP----P*PPPSP----PPYPPPPSRLPPP*LPPPPPLEE*PPPPP 181
            P P      PPPPP P    P PPP P    PP PPPP R  PP  PPPPP+   PPPPP
Sbjct: 870  PPPPLHGAPPPPPPPPRSGVPPPPPPPMRGAPPPPPPPMRGAPP--PPPPPMGRAPPPPP 927

Query: 180  -----LYPPPPSRLPPPPP*----LPPPPE*PPPPPLRYP-PPPPPRWP---PPPPLP 46
                   PPP    PPPPP      PPP   PPPP  R P PP PPR P   PPPP P
Sbjct: 928  PPMRGAPPPPFGGAPPPPPPPTGRGPPP---PPPPGGRAPGPPAPPRPPGGGPPPPPP 982

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/99 (53%), Positives = 54/99 (54%), Gaps = 21/99 (21%)
 Frame = -3

Query: 279  PPSPPPYPPPPSRLPPP*L----------PPPPPLEE---*PPPPPLYPPPPSRLPPPPP 139
            PPSPPP PPPP   PPP            PPPPPL      PPPPP  PPP   +PPPPP
Sbjct: 778  PPSPPP-PPPPPPPPPPSSNLVGFGVPSPPPPPPLPSMRGGPPPPP--PPPVLGVPPPPP 834

Query: 138  *LPPP----PE*PPPPPLR----YPPPPPPRWPPPPPLP 46
              PPP    P  PPPPP R     PPPPP R  PPPP P
Sbjct: 835  --PPPLRGGPPAPPPPPSRGGPPPPPPPPSRGGPPPPPP 871

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 48/99 (48%), Positives = 48/99 (48%), Gaps = 24/99 (24%)
 Frame = -3

Query: 270  PPPYPPPPSRLPPP*LPPPPPLEE*PPPPP----------LYPPPPSRLP-----PPPP* 136
            P P P     LPP   PPPPP    PPPPP            PPPP  LP     PPPP 
Sbjct: 767  PHPGPEQVIALPPSPPPPPPP----PPPPPPSSNLVGFGVPSPPPPPPLPSMRGGPPPP- 821

Query: 135  LPPP-----PE*PPPPPLR----YPPPPPPRWPPPPPLP 46
             PPP     P  PPPPPLR     PPPPP R  PPPP P
Sbjct: 822  -PPPPVLGVPPPPPPPPLRGGPPAPPPPPSRGGPPPPPP 859

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 34/71 (47%), Positives = 37/71 (52%), Gaps = 11/71 (15%)
 Frame = -3

Query: 225 LPPPPPLEE*PPPPPLYPPPPSRLPPPPP-------*LPPPPE*PPPPPLRYPPPPPPRW 67
           LP P P E+    PP  PPPP   PPPPP        +P PP  PP P +R  PPPPP  
Sbjct: 766 LPHPGP-EQVIALPPSPPPPPPPPPPPPPSSNLVGFGVPSPPPPPPLPSMRGGPPPPPPP 824

Query: 66  P----PPPPLP 46
           P    PPPP P
Sbjct: 825 PVLGVPPPPPP 835

[160][TOP]
>UniRef100_UPI0000E127A2 Os06g0317400 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E127A2
          Length = 160

 Score =  115 bits (287), Expect = 2e-24
 Identities = 59/96 (61%), Positives = 60/96 (62%), Gaps = 7/96 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG--- 217
           G G GGG+ GG G GY  G GGGY GG G YGGG G   GGGG  GG GGY   GGG   
Sbjct: 66  GYGHGGGYGGGYGSGYGGGNGGGYGGGYGGYGGGYGGGYGGGGGGGGYGGYGGYGGGGYE 125

Query: 218 --GGSYGGGRREGGGGYGGG--EGGGYGGSGGGGGW 313
             G  YGGG   GGGGYGGG   GGGY G GGGGGW
Sbjct: 126 GYGRGYGGG--GGGGGYGGGGYPGGGYYGGGGGGGW 159

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 43/71 (60%), Positives = 43/71 (60%), Gaps = 4/71 (5%)
 Frame = +2

Query: 107 GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG--- 277
           G GY  GGG YGGG G   GGG     GGGY   GGG G YGGG    GGGYGGG G   
Sbjct: 64  GDGYGHGGG-YGGGYGSGYGGGN----GGGY---GGGYGGYGGGY---GGGYGGGGGGGG 112

Query: 278 -GGYGGSGGGG 307
            GGYGG GGGG
Sbjct: 113 YGGYGGYGGGG 123

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 37/62 (59%), Positives = 38/62 (61%)
 Frame = +2

Query: 128 GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G  YG GGG    GGGY  G GG     G GG YGGG     GGYGGG GGGYGG GGGG
Sbjct: 64  GDGYGHGGGY---GGGYGSGYGG-----GNGGGYGGGY----GGYGGGYGGGYGGGGGGG 111

Query: 308 GW 313
           G+
Sbjct: 112 GY 113

[161][TOP]
>UniRef100_Q566W6 Zgc:112425 n=1 Tax=Danio rerio RepID=Q566W6_DANRE
          Length = 185

 Score =  115 bits (287), Expect = 2e-24
 Identities = 60/101 (59%), Positives = 66/101 (65%)
 Frame = +2

Query: 5   LDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG 184
           +DGR+I V+EA  +G GGGGG R GGGG YR GGGGG  GGGG + GG GR  GGGGY G
Sbjct: 71  VDGRTIRVDEA-GKGGGGGGG-RSGGGGSYR-GGGGGRGGGGGFFRGGRGRGGGGGGYGG 127

Query: 185 GGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G   Y  R  GGG  GGG + GGGGY  G GGGY    G G
Sbjct: 128 GDRSYGDRSYGGG--GGGYKSGGGGYSSGGGGGYNRDRGSG 166

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 43/76 (56%), Positives = 47/76 (61%), Gaps = 11/76 (14%)
 Frame = +2

Query: 119 SGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRRE--GGGGYGGGE------ 274
           +G GG  GGGGGR  GGG Y GGGGG   RGGGGG + GGR    GGGGYGGG+      
Sbjct: 81  AGKGG--GGGGGRSGGGGSYRGGGGG---RGGGGGFFRGGRGRGGGGGGYGGGDRSYGDR 135

Query: 275 ---GGGYGGSGGGGGW 313
              GGG G   GGGG+
Sbjct: 136 SYGGGGGGYKSGGGGY 151

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 38/75 (50%), Positives = 42/75 (56%), Gaps = 2/75 (2%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGY-SGGGGGYS-SRGGG 217
           RG GGGG   GG GGG RS G   Y GGGG Y      + GGGGY SGGGGGY+  RG G
Sbjct: 116 RGRGGGG---GGYGGGDRSYGDRSYGGGGGGY------KSGGGGYSSGGGGGYNRDRGSG 166

Query: 218 GGSYGGGRREGGGGY 262
            G      ++G   Y
Sbjct: 167 YGDRSSSYKDGYDSY 181

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/64 (53%), Positives = 36/64 (56%), Gaps = 3/64 (4%)
 Frame = +2

Query: 128 GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY---GGGRREGGGGYGGGEGGGYGGSG 298
           G S  G   R +  G   GGGGG S   GGGGSY   GGGR  GGG + GG G G GG G
Sbjct: 68  GKSVDGRTIRVDEAGKGGGGGGGRS---GGGGSYRGGGGGRGGGGGFFRGGRGRGGGGGG 124

Query: 299 GGGG 310
            GGG
Sbjct: 125 YGGG 128

[162][TOP]
>UniRef100_Q5Z4P5 Os06g0317400 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5Z4P5_ORYSJ
          Length = 153

 Score =  115 bits (287), Expect = 2e-24
 Identities = 59/96 (61%), Positives = 60/96 (62%), Gaps = 7/96 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG--- 217
           G G GGG+ GG G GY  G GGGY GG G YGGG G   GGGG  GG GGY   GGG   
Sbjct: 59  GYGHGGGYGGGYGSGYGGGNGGGYGGGYGGYGGGYGGGYGGGGGGGGYGGYGGYGGGGYE 118

Query: 218 --GGSYGGGRREGGGGYGGG--EGGGYGGSGGGGGW 313
             G  YGGG   GGGGYGGG   GGGY G GGGGGW
Sbjct: 119 GYGRGYGGG--GGGGGYGGGGYPGGGYYGGGGGGGW 152

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 43/71 (60%), Positives = 43/71 (60%), Gaps = 4/71 (5%)
 Frame = +2

Query: 107 GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG--- 277
           G GY  GGG YGGG G   GGG     GGGY   GGG G YGGG    GGGYGGG G   
Sbjct: 57  GDGYGHGGG-YGGGYGSGYGGGN----GGGY---GGGYGGYGGGY---GGGYGGGGGGGG 105

Query: 278 -GGYGGSGGGG 307
            GGYGG GGGG
Sbjct: 106 YGGYGGYGGGG 116

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 37/62 (59%), Positives = 38/62 (61%)
 Frame = +2

Query: 128 GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G  YG GGG    GGGY  G GG     G GG YGGG     GGYGGG GGGYGG GGGG
Sbjct: 57  GDGYGHGGGY---GGGYGSGYGG-----GNGGGYGGGY----GGYGGGYGGGYGGGGGGG 104

Query: 308 GW 313
           G+
Sbjct: 105 GY 106

[163][TOP]
>UniRef100_C5XT04 Putative uncharacterized protein Sb04g001720 n=1 Tax=Sorghum
           bicolor RepID=C5XT04_SORBI
          Length = 251

 Score =  115 bits (287), Expect = 2e-24
 Identities = 70/140 (50%), Positives = 73/140 (52%), Gaps = 40/140 (28%)
 Frame = +2

Query: 8   DGRSITVNEAQSRGS--GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGG--GGGRREGGGG 175
           DGR+  V+     GS   GG G  GGGGGGY S GGGG  GGG SYGG  GGGRR GGGG
Sbjct: 62  DGRTKAVDVTGPDGSYVKGGSGGGGGGGGGYGSRGGGGSGGGGRSYGGSWGGGRRSGGGG 121

Query: 176 YSG--------------------GGGGYSSRGGGGGSYGGGRR----------------E 247
            +G                    GGGGY   GGGGG YGGG                   
Sbjct: 122 GAGACYKCGEPGHMARDCPSADGGGGGY---GGGGGGYGGGGGGCFKCGEPGHMARDCPS 178

Query: 248 GGGGYGGGEGGGYGGSGGGG 307
           GGGGYGGG GGGYGG GGGG
Sbjct: 179 GGGGYGGGGGGGYGGGGGGG 198

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 57/139 (41%), Positives = 60/139 (43%), Gaps = 50/139 (35%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGG----YR--------------SGGGGGYSGGGGSYGGGGGR-- 157
           +S G   GGG R GGGGG    Y+               GGGGGY GGGG YGGGGG   
Sbjct: 105 RSYGGSWGGGRRSGGGGGAGACYKCGEPGHMARDCPSADGGGGGYGGGGGGYGGGGGGCF 164

Query: 158 ------------REGGGGYSGGGGG-YSSRGGGGGSY-----------------GGGRRE 247
                         GGGGY GGGGG Y   GGGG  Y                 GGG R 
Sbjct: 165 KCGEPGHMARDCPSGGGGYGGGGGGGYGGGGGGGACYNCGQTGHMARDCPSGGGGGGGRF 224

Query: 248 GGGGYGGGEGGGYGGSGGG 304
           GGGG GGG+   Y     G
Sbjct: 225 GGGGGGGGDRSCYNCGEAG 243

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 48/97 (49%), Positives = 52/97 (53%), Gaps = 12/97 (12%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGYS------------GGGGSYGGGGGRREGGGGYSGGGGGY 199
           GGGG  GGGGGGY  GGGG +              GGG YGGGGG     GGY GGGGG 
Sbjct: 144 GGGGGYGGGGGGYGGGGGGCFKCGEPGHMARDCPSGGGGYGGGGG-----GGYGGGGGGG 198

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           +      G  G   R+   G GGG GG +GG GGGGG
Sbjct: 199 ACY--NCGQTGHMARDCPSG-GGGGGGRFGGGGGGGG 232

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 44/93 (47%), Positives = 45/93 (48%), Gaps = 29/93 (31%)
 Frame = +2

Query: 119 SGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY----------GGGRREGGGGYGG 268
           +G  GSY  GG    GGGG  GGGGGY SRGGGG S           GGGRR GGGG  G
Sbjct: 71  TGPDGSYVKGGS---GGGG--GGGGGYGSRGGGG-SGGGGRSYGGSWGGGRRSGGGGGAG 124

Query: 269 -------------------GEGGGYGGSGGGGG 310
                              G GGGYGG GGG G
Sbjct: 125 ACYKCGEPGHMARDCPSADGGGGGYGGGGGGYG 157

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 32/72 (44%), Positives = 37/72 (51%), Gaps = 21/72 (29%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGY------------------SGGGGSYGGGGGRREGGGG-- 175
           GGGG+ GGGGGGY  GGGGG                    GGGG +GGGGG   GGG   
Sbjct: 179 GGGGYGGGGGGGYGGGGGGGACYNCGQTGHMARDCPSGGGGGGGRFGGGGG---GGGDRS 235

Query: 176 -YSGGGGGYSSR 208
            Y+ G  G+ +R
Sbjct: 236 CYNCGEAGHIAR 247

[164][TOP]
>UniRef100_B9HFC9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HFC9_POPTR
          Length = 241

 Score =  115 bits (287), Expect = 2e-24
 Identities = 59/92 (64%), Positives = 61/92 (66%), Gaps = 3/92 (3%)
 Frame = +2

Query: 44  RGSGGGGGHRGG---GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           RGSGG GG RGG   GGGG   GGGGG  GGGG  G G G   GGGG  GGGGG    GG
Sbjct: 125 RGSGGNGGGRGGASSGGGGGGGGGGGGGGGGGGGNGKGFGFGHGGGGGGGGGGG----GG 180

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG  GGG   GGGG GGG+GGG+G  GGGGG
Sbjct: 181 GGGGGGGGSGGGGGGGGGGQGGGWGWGGGGGG 212

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/90 (63%), Positives = 59/90 (65%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           S G GGGGG  GGGGGG   GGGG   G G  +GGGGG   GGGG  GGGGG    GGGG
Sbjct: 138 SSGGGGGGGGGGGGGGG---GGGGNGKGFGFGHGGGGG---GGGGGGGGGGG----GGGG 187

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GS GGG   GGGG G G G G+GG GGGGG
Sbjct: 188 GSGGGG---GGGGGGQGGGWGWGGGGGGGG 214

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 51/89 (57%), Positives = 55/89 (61%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG  +G G G+  GGG  GGGGG   GGGG  GGGGG     GGGG 
Sbjct: 142 GGGGGGGGGGGGGGGGGNGKGFGFGHGGGGGGGGGG---GGGGGGGGGGG----SGGGGG 194

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
            GGG + GG G+GGG GGG G  G    W
Sbjct: 195 GGGGGQGGGWGWGGGGGGGGGNQGDCLPW 223

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 57/105 (54%), Positives = 59/105 (56%), Gaps = 17/105 (16%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSG------------GGGGYSGGGGSYGGGGGRREGGGGYSGGG 190
           G+GGGGG  G G GG  SG            GG   SGG GS G GGGR   GG  SGGG
Sbjct: 86  GNGGGGGGSGVGKGGDHSGHGKEIGKPHQRKGGKPSSGGRGSGGNGGGR---GGASSGGG 142

Query: 191 GGYSSRGGGGGSYGGGRREG-----GGGYGGGEGGGYGGSGGGGG 310
           GG    GGGGG  GGG  +G     GGG GGG GGG GG GGGGG
Sbjct: 143 GGGGGGGGGGGGGGGGNGKGFGFGHGGGGGGGGGGGGGGGGGGGG 187

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 55/109 (50%), Positives = 58/109 (53%), Gaps = 15/109 (13%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG------GG----GGRREGGGGY 178
           N   + G  GGG   GGGGGG   G GG +SG G   G      GG    GGR  GG G 
Sbjct: 73  NSDLNNGGRGGGNGNGGGGGGSGVGKGGDHSGHGKEIGKPHQRKGGKPSSGGRGSGGNG- 131

Query: 179 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGG-----GYGGSGGGGG 310
            GG GG SS GGGGG  GGG    GGG GGG  G     G+GG GGGGG
Sbjct: 132 -GGRGGASSGGGGGGGGGGG----GGGGGGGGNGKGFGFGHGGGGGGGG 175

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/112 (44%), Positives = 53/112 (47%), Gaps = 31/112 (27%)
 Frame = +2

Query: 68  HRGGGGGGYRSGGGGGYSGGGGSYGGGGG-------------RREGG---------GGYS 181
           H      G R GG G   GGGGS  G GG             +R+GG         GG  
Sbjct: 72  HNSDLNNGGRGGGNGNGGGGGGSGVGKGGDHSGHGKEIGKPHQRKGGKPSSGGRGSGGNG 131

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGG---------GYGGGEGGGYGGSGGGGG 310
           GG GG SS GGGGG  GGG   GGG         G+GGG GGG GG GGGGG
Sbjct: 132 GGRGGASSGGGGGGGGGGGGGGGGGGGNGKGFGFGHGGGGGGGGGGGGGGGG 183

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/72 (55%), Positives = 42/72 (58%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G G GH GGGGGG   GGGGG  GGGG  G GGG   GGGG  GG G     GGGGG+
Sbjct: 160 GKGFGFGHGGGGGGG---GGGGGGGGGGGGGGSGGGGGGGGGGQGGGWGWGGGGGGGGGN 216

Query: 227 YGGGRREGGGGY 262
            G     G GG+
Sbjct: 217 QGDCLPWGCGGH 228

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 34/65 (52%), Positives = 37/65 (56%), Gaps = 5/65 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG-----GGGGYSSRG 211
           G GGGGG  GG GGG   GGGGG  GGG  +GGGGG   GGGG  G     G GG+  + 
Sbjct: 178 GGGGGGGGGGGSGGG--GGGGGGGQGGGWGWGGGGG---GGGGNQGDCLPWGCGGHPRKS 232

Query: 212 GGGGS 226
            G  S
Sbjct: 233 IGARS 237

[165][TOP]
>UniRef100_Q4TB22 Chromosome 15 SCAF7210, whole genome shotgun sequence. (Fragment) n=1
            Tax=Tetraodon nigroviridis RepID=Q4TB22_TETNG
          Length = 1021

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/91 (70%), Positives = 67/91 (73%), Gaps = 4/91 (4%)
 Frame = +2

Query: 53   GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG--GGGS 226
            G GG  +GGGGGGY  GGGGGY GGGG YGGGGG R GGGGY GG  GY   GG  GGG 
Sbjct: 936  GRGGPFQGGGGGGY--GGGGGYRGGGG-YGGGGGYR-GGGGY-GGRRGYRGSGGYRGGGG 990

Query: 227  YGGGR-REGGGGYGGGEG-GGYGGSGGGGGW 313
            YGGGR   GGGGYGGG G GG GG+GGGGG+
Sbjct: 991  YGGGRGNGGGGGYGGGGGYGGGGGNGGGGGY 1021

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 44/66 (66%), Positives = 46/66 (69%), Gaps = 2/66 (3%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSG--GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
            G GGGGG+RGGGG G R G  G GGY GGGG    GGGR  GGGG  GGGGGY   GGGG
Sbjct: 960  GYGGGGGYRGGGGYGGRRGYRGSGGYRGGGGY---GGGRGNGGGGGYGGGGGY---GGGG 1013

Query: 221  GSYGGG 238
            G+ GGG
Sbjct: 1014 GNGGGG 1019

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 42/83 (50%), Positives = 44/83 (53%), Gaps = 22/83 (26%)
 Frame = +2

Query: 131  GSYGGGGGRREGGGGYSGGGGGYSSRGG--GGGSYG-----------GGRR--------E 247
            G + GGG R  GG    GGGGGY   GG  GGG YG           GGRR         
Sbjct: 927  GRFEGGGYRGRGGPFQGGGGGGYGGGGGYRGGGGYGGGGGYRGGGGYGGRRGYRGSGGYR 986

Query: 248  GGGGYGGGEG-GGYGGSGGGGGW 313
            GGGGYGGG G GG GG GGGGG+
Sbjct: 987  GGGGYGGGRGNGGGGGYGGGGGY 1009

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 37/56 (66%), Positives = 39/56 (69%), Gaps = 4/56 (7%)
 Frame = +2

Query: 44   RGSGGGGGHRG-GGGGGYRSG---GGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 199
            RG GG GG RG  G GGYR G   GGG  +GGGG YGGGGG   GGGG +GGGGGY
Sbjct: 968  RGGGGYGGRRGYRGSGGYRGGGGYGGGRGNGGGGGYGGGGG--YGGGGGNGGGGGY 1021

[166][TOP]
>UniRef100_C0H8U7 Cold-inducible RNA-binding protein n=1 Tax=Salmo salar
           RepID=C0H8U7_SALSA
          Length = 193

 Score =  114 bits (286), Expect = 3e-24
 Identities = 62/105 (59%), Positives = 66/105 (62%), Gaps = 5/105 (4%)
 Frame = +2

Query: 5   LDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG 184
           +DGR+I V+EA      GGG   GGGGGG+R   GGG  GGGG YGGG GR  GGGGY G
Sbjct: 71  VDGRTIRVDEAGK----GGGRSGGGGGGGFRGSRGGGGYGGGGGYGGGRGR--GGGGYGG 124

Query: 185 GGGGYSSR---GGGGGSYGGGRRE--GGGGYGGGEGGGYGGSGGG 304
           G  GY  R   GGG  SYGGG R   GGGGY  G GGGY   GGG
Sbjct: 125 GDRGYGERSYGGGGDRSYGGGDRSYGGGGGYRSGGGGGYSSGGGG 169

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/79 (54%), Positives = 44/79 (55%), Gaps = 18/79 (22%)
 Frame = +2

Query: 125 GGGSYGGGGG----RREGGGGYSGGGGGYSSRGGGGGSYGGG------RREGGGG---YG 265
           GGG  GGGGG       GGGGY GGGG    RG GGG YGGG      R  GGGG   YG
Sbjct: 84  GGGRSGGGGGGGFRGSRGGGGYGGGGGYGGGRGRGGGGYGGGDRGYGERSYGGGGDRSYG 143

Query: 266 GGE-----GGGYGGSGGGG 307
           GG+     GGGY   GGGG
Sbjct: 144 GGDRSYGGGGGYRSGGGGG 162

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 44/83 (53%), Positives = 48/83 (57%), Gaps = 18/83 (21%)
 Frame = +2

Query: 119 SGGGGSYGGGGGRREGGGGYSG--GGGGYSSRGGGGGSYGGGRREGGGGYGGGE------ 274
           +G GG   GGG    GGGG+ G  GGGGY    GGGG YGGGR  GGGGYGGG+      
Sbjct: 81  AGKGGGRSGGG----GGGGFRGSRGGGGY----GGGGGYGGGRGRGGGGYGGGDRGYGER 132

Query: 275 --GGG----YGGS----GGGGGW 313
             GGG    YGG     GGGGG+
Sbjct: 133 SYGGGGDRSYGGGDRSYGGGGGY 155

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 48/92 (52%), Positives = 48/92 (52%), Gaps = 8/92 (8%)
 Frame = +2

Query: 44  RGSGGGG--------GHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 199
           RG GGGG        G R  GGGG RS     Y GG  SYGGGGG R      SGGGGGY
Sbjct: 115 RGRGGGGYGGGDRGYGERSYGGGGDRS-----YGGGDRSYGGGGGYR------SGGGGGY 163

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGS 295
           SS   GGG Y   R  G GGYG   GG Y  S
Sbjct: 164 SS---GGGGYRDNR--GQGGYGDRSGGSYRDS 190

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/65 (52%), Positives = 36/65 (55%), Gaps = 5/65 (7%)
 Frame = +2

Query: 38  QSRGSGG----GGGHRG-GGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYS 202
           +S G GG    GGG R  GGGGGYRSGGGGGYS GGG Y    G+           GGY 
Sbjct: 132 RSYGGGGDRSYGGGDRSYGGGGGYRSGGGGGYSSGGGGYRDNRGQ-----------GGYG 180

Query: 203 SRGGG 217
            R GG
Sbjct: 181 DRSGG 185

[167][TOP]
>UniRef100_B0S6Z1 Novel protein similar to vertebrate DEAH (Asp-Glu-Ala-His) box
            polypeptide 9 (DHX9) n=1 Tax=Danio rerio
            RepID=B0S6Z1_DANRE
          Length = 1271

 Score =  114 bits (286), Expect = 3e-24
 Identities = 63/93 (67%), Positives = 64/93 (68%), Gaps = 6/93 (6%)
 Frame = +2

Query: 53   GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGY-SGGGGGYSSRGGGGGSY 229
            GGGG  RGGGG  YR  GGGGY GGGG Y GGGG + GGGGY  GGGGGY   GGGGG  
Sbjct: 1176 GGGGDFRGGGG--YR--GGGGYRGGGGGYRGGGGYQGGGGGYRGGGGGGYRGYGGGGGYR 1231

Query: 230  G-GGRR--EGGGGYGGGEGG--GYGGSGGGGGW 313
            G GG R   GGGGYGGG  G  G GG GGGGGW
Sbjct: 1232 GSGGYRGSSGGGGYGGGGRGFRGGGGGGGGGGW 1264

 Score =  109 bits (273), Expect = 8e-23
 Identities = 59/91 (64%), Positives = 62/91 (68%), Gaps = 8/91 (8%)
 Frame = +2

Query: 56   GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG---YSGGGGGYSSRGG---- 214
            GGGG+R  GGGGYR GGGGGY GGGG  GGGGG R GGGG     GGGGGY   GG    
Sbjct: 1183 GGGGYR--GGGGYR-GGGGGYRGGGGYQGGGGGYRGGGGGGYRGYGGGGGYRGSGGYRGS 1239

Query: 215  -GGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
             GGG YGGG R   GG GGG GGG+GG+ GG
Sbjct: 1240 SGGGGYGGGGRGFRGGGGGGGGGGWGGNRGG 1270

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 52/85 (61%), Positives = 55/85 (64%), Gaps = 9/85 (10%)
 Frame = +2

Query: 53   GGGGGHRGGGG-----GGYRSGGGGGYSG--GGGSYGGGGGRR--EGGGGYSGGGGGYSS 205
            GGGGG+RGGGG     GGYR GGGGGY G  GGG Y G GG R   GGGGY GGG G+  
Sbjct: 1195 GGGGGYRGGGGYQGGGGGYRGGGGGGYRGYGGGGGYRGSGGYRGSSGGGGYGGGGRGF-- 1252

Query: 206  RGGGGGSYGGGRREGGGGYGGGEGG 280
            RGGGGG        GGGG+GG  GG
Sbjct: 1253 RGGGGGG-------GGGGWGGNRGG 1270

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 46/73 (63%), Positives = 49/73 (67%), Gaps = 3/73 (4%)
 Frame = +2

Query: 53   GGGGGHRGGGGGGYRS-GGGGGYSGGGGSYG--GGGGRREGGGGYSGGGGGYSSRGGGGG 223
            GGGGG+RGGGGGGYR  GGGGGY G GG  G  GGGG   GG G+ GGGG     GGGGG
Sbjct: 1208 GGGGGYRGGGGGGYRGYGGGGGYRGSGGYRGSSGGGGYGGGGRGFRGGGG-----GGGGG 1262

Query: 224  SYGGGRREGGGGY 262
             +GG R    GGY
Sbjct: 1263 GWGGNR----GGY 1271

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/60 (66%), Positives = 43/60 (71%), Gaps = 1/60 (1%)
 Frame = +2

Query: 137  YGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRRE-GGGGYGGGEGGGYGGSGGGGGW 313
            +GGGG  R GGGGY GGGG    RGGGGG  GGG  + GGGGY GG GGGY G GGGGG+
Sbjct: 1175 FGGGGDFR-GGGGYRGGGG---YRGGGGGYRGGGGYQGGGGGYRGGGGGGYRGYGGGGGY 1230

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 1/53 (1%)
 Frame = +2

Query: 44   RGSGGGGGHRGGGGGGYR-SGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 199
            RG GGGGG+R  G GGYR S GGGGY GGG  + GGGG   GGGG+ G  GGY
Sbjct: 1222 RGYGGGGGYR--GSGGYRGSSGGGGYGGGGRGFRGGGG-GGGGGGWGGNRGGY 1271

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 31/59 (52%), Positives = 32/59 (54%), Gaps = 5/59 (8%)
 Frame = +2

Query: 146  GGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGG-----GEGGGYGGSGGGG 307
            G G R      +  GGG   RGGGG   GGG R GGGGY G     G GGGY G GGGG
Sbjct: 1162 GDGPRPPKMARTDFGGGGDFRGGGGYRGGGGYRGGGGGYRGGGGYQGGGGGYRGGGGGG 1220

[168][TOP]
>UniRef100_Q2V4A1 Putative uncharacterized protein At2g05440.4 n=1 Tax=Arabidopsis
           thaliana RepID=Q2V4A1_ARATH
          Length = 147

 Score =  114 bits (286), Expect = 3e-24
 Identities = 58/98 (59%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGY--RSGGGG----GYSGGGGSYGGGGGRREGGGGYSGGGG 193
           E    G GG GGH GGGG G+   +GGGG    GY GGGG YGGGGG   GGGG+ GGGG
Sbjct: 41  EGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGG 100

Query: 194 GYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G+   GGGGG +GGG   GGGG G G GGG+ G GG G
Sbjct: 101 GH--YGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 136

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/99 (61%), Positives = 66/99 (66%), Gaps = 8/99 (8%)
 Frame = +2

Query: 38  QSRGSGGG-GGHRGGGGGGYRSGGGGGYSGGGG----SYGGGGGRREGGGGYSGGGGGYS 202
           Q  G GGG GGH G GGGG    G GG++GGGG     YGGGGG   GGGG+ GGGGG+ 
Sbjct: 39  QPEGYGGGHGGHGGHGGGG--GHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGH- 95

Query: 203 SRGGGGGSY-GGGRREGGGGYGGGEGGGYGGSGG--GGG 310
             GGGGG Y GGG   GGGG+ GG GGGYGG GG  GGG
Sbjct: 96  -YGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGG 133

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 49/79 (62%), Positives = 51/79 (64%), Gaps = 3/79 (3%)
 Frame = +2

Query: 47  GSGGGGGHR---GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G  GGGGH     GGGGG+  GGGG Y GGGG YGGGGG   GGGG  GGGG Y   GGG
Sbjct: 63  GHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYG--GGG 120

Query: 218 GGSYGGGRREGGGGYGGGE 274
           GG  GGG   GGGG+G  E
Sbjct: 121 GGYGGGGGHHGGGGHGLNE 139

[169][TOP]
>UniRef100_A7P909 Chromosome chr3 scaffold_8, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7P909_VITVI
          Length = 162

 Score =  114 bits (286), Expect = 3e-24
 Identities = 67/102 (65%), Positives = 71/102 (69%), Gaps = 1/102 (0%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQSRGSGGGGG  GGGGGGYR  GGGGY        GGGGRRE  GGYS
Sbjct: 73  NLDGRNITVNEAQSRGSGGGGGG-GGGGGGYR--GGGGY--------GGGGRRE--GGYS 119

Query: 182 -GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
            GGGGGY   GGGGG YGGG R+ G G GG      GG+  G
Sbjct: 120 RGGGGGY---GGGGGGYGGGSRDRGYGDGGSRYSRSGGASDG 158

[170][TOP]
>UniRef100_B9QIA3 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii VEG
           RepID=B9QIA3_TOXGO
          Length = 481

 Score =  114 bits (286), Expect = 3e-24
 Identities = 59/89 (66%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRR-EGGGGYSGGGGGYSSRGGGG 220
           RG GGGG   GGGGGGY  GGGGGY GGGG YGGGGG    GGGGY  GGGGY   G GG
Sbjct: 58  RGYGGGG--YGGGGGGY-GGGGGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGY---GAGG 111

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G YG G   GG G GGG  GGYG   GGG
Sbjct: 112 GGYGAGGGGGGYGAGGGNSGGYGSGYGGG 140

 Score =  114 bits (286), Expect = 3e-24
 Identities = 60/101 (59%), Positives = 62/101 (61%), Gaps = 14/101 (13%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG-GGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G GGGGG  GGGGGGY  GGGGGY GGGG YG GGGG   GGGGY  GGGGY + GGGGG
Sbjct: 64  GYGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGGGG 122

Query: 224 SYGGGRREG--GGGYGGGEGG-----------GYGGSGGGG 307
              GG   G  G GYGGG  G           G GG+ GGG
Sbjct: 123 YGAGGGNSGGYGSGYGGGRSGREKHRSRSRSPGGGGAAGGG 163

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/88 (64%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +2

Query: 50  SGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 229
           SGG    RG GGGGY  GGGGGY GGGG YGGGGG      GY GGGGGY + GGG G+ 
Sbjct: 51  SGGPQSDRGYGGGGY-GGGGGGYGGGGGGYGGGGG------GYGGGGGGYGAGGGGYGAG 103

Query: 230 GGGRREGGGGYG-GGEGGGYGGSGGGGG 310
           GGG   GGGGYG GG GGGYG  GG  G
Sbjct: 104 GGGYGAGGGGYGAGGGGGGYGAGGGNSG 131

 Score =  102 bits (254), Expect = 1e-20
 Identities = 59/109 (54%), Positives = 63/109 (57%), Gaps = 8/109 (7%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGG-----GGHRGGGGGGYRSGG---GGGYSGGGGSYGGGGGRREG 166
           GR       +SR S  G     G + GG G G  SGG     GY GGG   GGGGG   G
Sbjct: 17  GRDRDARGPRSRDSFRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYG-GGGGGYGGG 75

Query: 167 GGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGY GGGGGY   GGG G+ GGG   GGGGYG G GGGYG  GGGGG+
Sbjct: 76  GGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGYGAG-GGGYGAGGGGGGY 123

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/96 (54%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG---RREGGGGYSGGGGGYSSRGGG 217
           G GGGGG  GGGGGGY   GGGGY  GGG YG GGG      GGGGY  GGG   + GG 
Sbjct: 78  GYGGGGGGYGGGGGGY-GAGGGGYGAGGGGYGAGGGGYGAGGGGGGYGAGGG---NSGGY 133

Query: 218 GGSYGGGR--------REGGGGYGGGEGGGYGGSGG 301
           G  YGGGR        R    G GG  GGG G  GG
Sbjct: 134 GSGYGGGRSGREKHRSRSRSPGGGGAAGGGKGARGG 169

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 46/88 (52%), Positives = 46/88 (52%), Gaps = 3/88 (3%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG---GGGGYSSRGGGGGS 226
           GGG  R   G   R    G     G  YGG G     GG  S    GGGGY   GGGGG 
Sbjct: 15  GGGRDRDARGPRSRDSFRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGY---GGGGGG 71

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           YGG    GGGGYGGG GGGYGG GGG G
Sbjct: 72  YGG----GGGGYGGG-GGGYGGGGGGYG 94

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 41/85 (48%), Positives = 44/85 (51%), Gaps = 7/85 (8%)
 Frame = +2

Query: 80  GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG-------GGGYSSRGGGGGSYGGG 238
           G   +R GG    + G  S     G RE  G Y GG       GG  S RG GGG YGGG
Sbjct: 9   GRDAWRGGGRDRDARGPRSRDSFRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYGGG 68

Query: 239 RREGGGGYGGGEGGGYGGSGGGGGW 313
               GGGYGGG GGGY   GGGGG+
Sbjct: 69  ----GGGYGGG-GGGY--GGGGGGY 86

[171][TOP]
>UniRef100_B6KPI0 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii ME49
           RepID=B6KPI0_TOXGO
          Length = 538

 Score =  114 bits (286), Expect = 3e-24
 Identities = 59/89 (66%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRR-EGGGGYSGGGGGYSSRGGGG 220
           RG GGGG   GGGGGGY  GGGGGY GGGG YGGGGG    GGGGY  GGGGY   G GG
Sbjct: 115 RGYGGGG--YGGGGGGY-GGGGGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGY---GAGG 168

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G YG G   GG G GGG  GGYG   GGG
Sbjct: 169 GGYGAGGGGGGYGAGGGNSGGYGSGYGGG 197

 Score =  114 bits (286), Expect = 3e-24
 Identities = 60/101 (59%), Positives = 62/101 (61%), Gaps = 14/101 (13%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG-GGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G GGGGG  GGGGGGY  GGGGGY GGGG YG GGGG   GGGGY  GGGGY + GGGGG
Sbjct: 121 GYGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGGGG 179

Query: 224 SYGGGRREG--GGGYGGGEGG-----------GYGGSGGGG 307
              GG   G  G GYGGG  G           G GG+ GGG
Sbjct: 180 YGAGGGNSGGYGSGYGGGRSGREKHRSRSRSPGGGGAAGGG 220

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/88 (64%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +2

Query: 50  SGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 229
           SGG    RG GGGGY  GGGGGY GGGG YGGGGG      GY GGGGGY + GGG G+ 
Sbjct: 108 SGGPQSDRGYGGGGY-GGGGGGYGGGGGGYGGGGG------GYGGGGGGYGAGGGGYGAG 160

Query: 230 GGGRREGGGGYG-GGEGGGYGGSGGGGG 310
           GGG   GGGGYG GG GGGYG  GG  G
Sbjct: 161 GGGYGAGGGGYGAGGGGGGYGAGGGNSG 188

 Score =  102 bits (254), Expect = 1e-20
 Identities = 59/109 (54%), Positives = 63/109 (57%), Gaps = 8/109 (7%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGG-----GGHRGGGGGGYRSGG---GGGYSGGGGSYGGGGGRREG 166
           GR       +SR S  G     G + GG G G  SGG     GY GGG   GGGGG   G
Sbjct: 74  GRDRDARGPRSRDSFRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYG-GGGGGYGGG 132

Query: 167 GGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGGY GGGGGY   GGG G+ GGG   GGGGYG G GGGYG  GGGGG+
Sbjct: 133 GGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGYGAG-GGGYGAGGGGGGY 180

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/96 (54%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG---RREGGGGYSGGGGGYSSRGGG 217
           G GGGGG  GGGGGGY   GGGGY  GGG YG GGG      GGGGY  GGG   + GG 
Sbjct: 135 GYGGGGGGYGGGGGGY-GAGGGGYGAGGGGYGAGGGGYGAGGGGGGYGAGGG---NSGGY 190

Query: 218 GGSYGGGR--------REGGGGYGGGEGGGYGGSGG 301
           G  YGGGR        R    G GG  GGG G  GG
Sbjct: 191 GSGYGGGRSGREKHRSRSRSPGGGGAAGGGKGARGG 226

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 46/88 (52%), Positives = 46/88 (52%), Gaps = 3/88 (3%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG---GGGGYSSRGGGGGS 226
           GGG  R   G   R    G     G  YGG G     GG  S    GGGGY   GGGGG 
Sbjct: 72  GGGRDRDARGPRSRDSFRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGY---GGGGGG 128

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           YGG    GGGGYGGG GGGYGG GGG G
Sbjct: 129 YGG----GGGGYGGG-GGGYGGGGGGYG 151

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 41/85 (48%), Positives = 44/85 (51%), Gaps = 7/85 (8%)
 Frame = +2

Query: 80  GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG-------GGGYSSRGGGGGSYGGG 238
           G   +R GG    + G  S     G RE  G Y GG       GG  S RG GGG YGGG
Sbjct: 66  GRDAWRGGGRDRDARGPRSRDSFRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYGGG 125

Query: 239 RREGGGGYGGGEGGGYGGSGGGGGW 313
               GGGYGGG GGGY   GGGGG+
Sbjct: 126 ----GGGYGGG-GGGY--GGGGGGY 143

[172][TOP]
>UniRef100_C5MJJ9 Predicted protein n=1 Tax=Candida tropicalis MYA-3404
           RepID=C5MJJ9_CANTT
          Length = 747

 Score =  114 bits (286), Expect = 3e-24
 Identities = 59/95 (62%), Positives = 60/95 (63%), Gaps = 8/95 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG-GGSYGGGGGRREGGGGYSGGGGGY------SS 205
           G+GGGGG  GG GGG   G GGGY GG GG YGGG G   GGG   G G GY       S
Sbjct: 336 GTGGGGGSGGGSGGGSGGGSGGGYGGGYGGGYGGGYGGGYGGGYGGGSGSGYCDGYGGGS 395

Query: 206 RGGGGGSYGGGRREG-GGGYGGGEGGGYGGSGGGG 307
            GG GG YGGG   G GGGYGGG GGGYGG GGGG
Sbjct: 396 GGGSGGGYGGGYGGGYGGGYGGGYGGGYGGGGGGG 430

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/83 (57%), Positives = 48/83 (57%), Gaps = 12/83 (14%)
 Frame = +2

Query: 95  RSGGGGGYSGGGGSYGGGGGRREGG--GGYSGG-GGGYSSRGGGGGSYGGGRREG----- 250
           R G  GG  GGGGS GG GG   GG  GGY GG GGGY   GG GG YGGG   G     
Sbjct: 330 RKGPVGGTGGGGGSGGGSGGGSGGGSGGGYGGGYGGGYG--GGYGGGYGGGYGGGSGSGY 387

Query: 251 ----GGGYGGGEGGGYGGSGGGG 307
               GGG GGG GGGYGG  GGG
Sbjct: 388 CDGYGGGSGGGSGGGYGGGYGGG 410

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 23/37 (62%), Positives = 25/37 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGR 157
           G G GGG+ GG GGGY  G GGGY GG G  GGGG +
Sbjct: 396 GGGSGGGYGGGYGGGYGGGYGGGYGGGYGGGGGGGNQ 432

[173][TOP]
>UniRef100_UPI000180C465 PREDICTED: similar to cold-inducible RNA-binding protein n=1
           Tax=Ciona intestinalis RepID=UPI000180C465
          Length = 167

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/102 (61%), Positives = 66/102 (64%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           D  GRS+TV EAQS+  GGGGG  GG GGG R GGGGG  GGGG  GG GG   GGGGY 
Sbjct: 70  DFLGRSVTVREAQSKRGGGGGGGYGGRGGGGRYGGGGGGYGGGG--GGYGG---GGGGYG 124

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GGGGGY   GG GG  GGGRR     Y GG+   Y G GGGG
Sbjct: 125 GGGGGYGGGGGYGGG-GGGRRYNDDNYSGGD---YRGGGGGG 162

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 26/34 (76%), Positives = 26/34 (76%)
 Frame = +2

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGGG YGG  R GGG YGGG GGGYGG GGG G
Sbjct: 87  GGGGGGYGG--RGGGGRYGGG-GGGYGGGGGGYG 117

[174][TOP]
>UniRef100_UPI0000DB6C07 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera
           RepID=UPI0000DB6C07
          Length = 431

 Score =  114 bits (285), Expect = 3e-24
 Identities = 62/114 (54%), Positives = 68/114 (59%), Gaps = 14/114 (12%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGG---YSGGGGSYGGGGGR---REGGG 172
           G    +    S G GGGGG  GGGGGGY  GGGGG   + GGGG +GGGGG      GGG
Sbjct: 231 GGGAIIEHHDSGGFGGGGGGYGGGGGGYGGGGGGGIIEHHGGGGGFGGGGGGFDDHHGGG 290

Query: 173 GYSGGGGGYSSRGGGGGSYGGG--RREGGGGYGGGEGGGY------GGSGGGGG 310
           G+ GGGGG    GGGGG  GGG     G GG+GGG GGG+      GG GGGGG
Sbjct: 291 GFGGGGGG--GYGGGGGFGGGGFDDHHGSGGFGGGGGGGFDDHHGGGGFGGGGG 342

 Score =  112 bits (279), Expect = 2e-23
 Identities = 59/102 (57%), Positives = 65/102 (63%), Gaps = 16/102 (15%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGYSGGG-------GSYGGGGGR----REGGGGYSGGGGGYS 202
           GGGG  GGGGGGY  GGGGG+ GGG       G +GGGGG       GGGG+ GGGGGY 
Sbjct: 288 GGGGFGGGGGGGY--GGGGGFGGGGFDDHHGSGGFGGGGGGGFDDHHGGGGFGGGGGGYG 345

Query: 203 SRGGGGGSYGGGRREGGGGYGGGEGG-----GYGGSGGGGGW 313
           S GGG  ++ GG   GGGGYGGG GG     G GG GGGGG+
Sbjct: 346 SGGGGFDAHHGGGGFGGGGYGGGGGGFDDHHGGGGFGGGGGF 387

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/107 (54%), Positives = 63/107 (58%), Gaps = 20/107 (18%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG-------GGYRSGGGGGYSGGGGSYGGGGG-----RREGGGGYSGGG 190
           G GGGGG  GGG        GG+  GGGGGY GGGG YGGGGG        GGGG+ GGG
Sbjct: 222 GGGGGGGGFGGGAIIEHHDSGGF-GGGGGGYGGGGGGYGGGGGGGIIEHHGGGGGFGGGG 280

Query: 191 GGYSSR-------GGGGGSYGGGRREGGGGYGGGEG-GGYGGSGGGG 307
           GG+          GGGGG YGGG   GGGG+    G GG+GG GGGG
Sbjct: 281 GGFDDHHGGGGFGGGGGGGYGGGGGFGGGGFDDHHGSGGFGGGGGGG 327

 Score =  105 bits (263), Expect = 1e-21
 Identities = 59/107 (55%), Positives = 61/107 (57%), Gaps = 21/107 (19%)
 Frame = +2

Query: 53  GGGGGHRGGGGGG----YRSGGGGGYSG-----------GGGSYGGGGGRREGGGGYSGG 187
           GGGGG  GGGGGG    +  GGGGG  G            GG  GGGGG   GGGGY GG
Sbjct: 202 GGGGGGFGGGGGGAIIEHHGGGGGGGGGFGGGAIIEHHDSGGFGGGGGGYGGGGGGYGGG 261

Query: 188 GGG--YSSRGGGGGSYGGG----RREGGGGYGGGEGGGYGGSGGGGG 310
           GGG      GGGGG  GGG       GGGG+GGG GGGYGG GG GG
Sbjct: 262 GGGGIIEHHGGGGGFGGGGGGFDDHHGGGGFGGGGGGGYGGGGGFGG 308

 Score =  104 bits (259), Expect = 3e-21
 Identities = 61/122 (50%), Positives = 66/122 (54%), Gaps = 33/122 (27%)
 Frame = +2

Query: 47  GSGGGGG-----HRGGGGGGYRSGGGG-------GYSGGGGSYGGG--------GGRREG 166
           G GGGGG     H GGGGGG+  GGGG       G  GGGG +GGG        GG   G
Sbjct: 188 GFGGGGGGSIIEHHGGGGGGFGGGGGGAIIEHHGGGGGGGGGFGGGAIIEHHDSGGFGGG 247

Query: 167 GGGYSGGGGGYSSRGGGG--------GSYGGGR-----REGGGGYGGGEGGGYGGSGGGG 307
           GGGY GGGGGY   GGGG        G +GGG        GGGG+GGG GGG    GGGG
Sbjct: 248 GGGYGGGGGGYGGGGGGGIIEHHGGGGGFGGGGGGFDDHHGGGGFGGGGGGG---YGGGG 304

Query: 308 GW 313
           G+
Sbjct: 305 GF 306

 Score =  102 bits (255), Expect = 1e-20
 Identities = 56/103 (54%), Positives = 63/103 (61%), Gaps = 18/103 (17%)
 Frame = +2

Query: 50  SGGGGGHRGGG-GGGYRSGGGGGYSGG-----GGSYGGGGGRREGGGGYS-----GGGGG 196
           S GGGGHRGGG GGG+  G GGG+ GG     GG +GGG G   GGGG+S     GGGGG
Sbjct: 95  SPGGGGHRGGGHGGGFGGGHGGGFGGGHGGGFGGGFGGGHGGGHGGGGFSGHVSFGGGGG 154

Query: 197 YSSRGGGGGSYGGGRREG-------GGGYGGGEGGGYGGSGGG 304
           +   GG GG +GG    G       GGGYG G GGG+GG GGG
Sbjct: 155 HG--GGHGGGFGGKSGHGDVIISSSGGGYGYGGGGGFGGGGGG 195

 Score =  100 bits (250), Expect = 4e-20
 Identities = 55/106 (51%), Positives = 60/106 (56%), Gaps = 21/106 (19%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRRE--------GGGGYSGGGGGYSSR 208
           G GG  GGGGGG+    GGGG+ GGGG YG GGG  +        GGGGY GGGGG+   
Sbjct: 316 GSGGFGGGGGGGFDDHHGGGGFGGGGGGYGSGGGGFDAHHGGGGFGGGGYGGGGGGFDDH 375

Query: 209 GGGGGSYGGGRREGGGGYGGGEGG------------GYGGSGGGGG 310
            GGGG  GGG    GGGYGGG GG            G+G SG GGG
Sbjct: 376 HGGGGFGGGG--GFGGGYGGGGGGVEHHAISNSISSGFGSSGHGGG 419

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 60/119 (50%), Positives = 65/119 (54%), Gaps = 30/119 (25%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSG--------GGGGYS-GGGGSYGGGGG------RREGGGG 175
           S G GGG G   GGG G +SG         GGGY  GGGG +GGGGG         GGGG
Sbjct: 148 SFGGGGGHGGGHGGGFGGKSGHGDVIISSSGGGYGYGGGGGFGGGGGGSIIEHHGGGGGG 207

Query: 176 YSGGGGG-----YSSRGGGGGSYGGGR----------REGGGGYGGGEGGGYGGSGGGG 307
           + GGGGG     +   GGGGG +GGG             GGGGYGGG GGGYGG GGGG
Sbjct: 208 FGGGGGGAIIEHHGGGGGGGGGFGGGAIIEHHDSGGFGGGGGGYGGG-GGGYGGGGGGG 265

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 57/113 (50%), Positives = 62/113 (54%), Gaps = 27/113 (23%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGY------------RSGGGGGYSGGGGSYGGGGG-----RREGGGGYS 181
           GGGGGH GG GGG+             SGGG GY GGGG  GGGGG        GGGG+ 
Sbjct: 150 GGGGGHGGGHGGGFGGKSGHGDVIISSSGGGYGYGGGGGFGGGGGGSIIEHHGGGGGGFG 209

Query: 182 GGGGG-----YSSRGGGGGSYGGG---RREGGGGYGGGEGG--GYGGSGGGGG 310
           GGGGG     +   GGGGG +GGG        GG+GGG GG  G GG  GGGG
Sbjct: 210 GGGGGAIIEHHGGGGGGGGGFGGGAIIEHHDSGGFGGGGGGYGGGGGGYGGGG 262

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 54/100 (54%), Positives = 59/100 (59%), Gaps = 14/100 (14%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG-------GGYRSGGGGGYS---GGGGSYGGGGGRREGGGGYSG--GG 190
           G  GGGG  GGGG       GG+  GGGGG+    GGGG  GGGGG   GGGG+    GG
Sbjct: 298 GGYGGGGGFGGGGFDDHHGSGGFGGGGGGGFDDHHGGGGFGGGGGGYGSGGGGFDAHHGG 357

Query: 191 GGYSSRGGGGGSYGGGRREGGGGYGGGE--GGGYGGSGGG 304
           GG+   G GGG  G     GGGG+GGG   GGGYGG GGG
Sbjct: 358 GGFGGGGYGGGGGGFDDHHGGGGFGGGGGFGGGYGGGGGG 397

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/108 (50%), Positives = 60/108 (55%), Gaps = 22/108 (20%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG-GGSYGGG--------GGRREGGGGYSGGGGGY 199
           G G GGGH GG GGG+  G GGG+ GG GG +GGG        GG    GGG+ GG GG 
Sbjct: 107 GGGFGGGHGGGFGGGHGGGFGGGFGGGHGGGHGGGGFSGHVSFGGGGGHGGGHGGGFGGK 166

Query: 200 SSRG-------GGGGSYGGGRREGGGGYG------GGEGGGYGGSGGG 304
           S  G       GGG  YGGG   GGGG G      GG GGG+GG GGG
Sbjct: 167 SGHGDVIISSSGGGYGYGGGGGFGGGGGGSIIEHHGGGGGGFGGGGGG 214

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/114 (49%), Positives = 61/114 (53%), Gaps = 26/114 (22%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGS----YGGGGGRREG-GGGY----------- 178
           G G GGGH GG GGG+  G GGG+ GGG S    +GGGGG   G GGG+           
Sbjct: 115 GGGFGGGHGGGFGGGFGGGHGGGHGGGGFSGHVSFGGGGGHGGGHGGGFGGKSGHGDVII 174

Query: 179 --SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG--------YGGSGGGGG 310
             SGGG GY   GG GG  GG   E  GG GGG GGG        +GG GGGGG
Sbjct: 175 SSSGGGYGYGGGGGFGGGGGGSIIEHHGGGGGGFGGGGGGAIIEHHGGGGGGGG 228

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 60/124 (48%), Positives = 66/124 (53%), Gaps = 35/124 (28%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRS-GGGGGYSGG-GGSYGG------------GGGRREGGGGYSG 184
           G G GGGH GGG  G+ S GGGGG+ GG GG +GG            GGG   GGGG  G
Sbjct: 131 GGGHGGGHGGGGFSGHVSFGGGGGHGGGHGGGFGGKSGHGDVIISSSGGGYGYGGGGGFG 190

Query: 185 GGGGYS---SRGGGGGSYGGGRREGGG------GYGGGEGGGYGG------------SGG 301
           GGGG S     GGGGG +GGG   GGG      G GGG GGG+GG             GG
Sbjct: 191 GGGGGSIIEHHGGGGGGFGGG---GGGAIIEHHGGGGGGGGGFGGGAIIEHHDSGGFGGG 247

Query: 302 GGGW 313
           GGG+
Sbjct: 248 GGGY 251

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/94 (53%), Positives = 55/94 (58%), Gaps = 9/94 (9%)
 Frame = +2

Query: 53  GGGGGHRGG--------GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG-GGGYSS 205
           GGGGG  GG        GGGG+R GG GG  GGG   G GGG    GGG+ GG GGG+  
Sbjct: 80  GGGGGGGGGDTIIITSPGGGGHRGGGHGGGFGGGHGGGFGGGH---GGGFGGGFGGGHGG 136

Query: 206 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
             GGGG  G     GGGG+GGG GGG+GG  G G
Sbjct: 137 GHGGGGFSGHVSFGGGGGHGGGHGGGFGGKSGHG 170

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/91 (50%), Positives = 51/91 (56%), Gaps = 9/91 (9%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG--RREGGGGYSGGGGGYSSRGGGG 220
           G GGGGG  G GGGG+ +  GGG  GGGG  GGGGG     GGGG+ GGGG     GGGG
Sbjct: 336 GFGGGGGGYGSGGGGFDAHHGGGGFGGGGYGGGGGGFDDHHGGGGFGGGGGFGGGYGGGG 395

Query: 221 G-------SYGGGRREGGGGYGGGEGGGYGG 292
           G       S       G  G+GGG GGG+ G
Sbjct: 396 GGVEHHAISNSISSGFGSSGHGGGGGGGFSG 426

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 47/84 (55%), Positives = 53/84 (63%)
 Frame = +2

Query: 62  GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR 241
           GGH  GGGGG   GGGGG +    S GGGG R   GGG+ GG GG     G GG +GGG 
Sbjct: 74  GGHDHGGGGG---GGGGGDTIIITSPGGGGHR---GGGHGGGFGG-----GHGGGFGGGH 122

Query: 242 REGGGGYGGGEGGGYGGSGGGGGW 313
              GGG+GGG GGG+GG  GGGG+
Sbjct: 123 ---GGGFGGGFGGGHGGGHGGGGF 143

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 31/58 (53%), Positives = 34/58 (58%), Gaps = 9/58 (15%)
 Frame = +2

Query: 161 EGGGGYSGGGGGYSSRGGGGGSY-------GGGRREG--GGGYGGGEGGGYGGSGGGG 307
           E  GG+  GGGG    GGGGG         GGG R G  GGG+GGG GGG+GG  GGG
Sbjct: 71  EDHGGHDHGGGG---GGGGGGDTIIITSPGGGGHRGGGHGGGFGGGHGGGFGGGHGGG 125

[175][TOP]
>UniRef100_A2SMG9 RNA-binding region RNP-1 n=1 Tax=Methylibium petroleiphilum PM1
           RepID=A2SMG9_METPP
          Length = 162

 Score =  114 bits (285), Expect = 3e-24
 Identities = 62/102 (60%), Positives = 66/102 (64%), Gaps = 14/102 (13%)
 Frame = +2

Query: 5   LDGRSITVNEAQSR--------------GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG 142
           L GR+I VNEA+ R              G+GGGGG+ GGGGG  RSGGGGGY GGGG YG
Sbjct: 69  LSGRAIVVNEARPREERPGGFRGPYGGGGAGGGGGYGGGGGG--RSGGGGGYGGGGGGYG 126

Query: 143 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGG 268
           GGGG R GGGG  GGGGG   R GGGG YGG    GGGG GG
Sbjct: 127 GGGGGRSGGGGGYGGGGG---RSGGGGGYGG----GGGGRGG 161

[176][TOP]
>UniRef100_Q9MBF3 Glycine-rich RNA-binding protein n=1 Tax=Citrus unshiu
           RepID=Q9MBF3_CITUN
          Length = 167

 Score =  114 bits (285), Expect = 3e-24
 Identities = 68/110 (61%), Positives = 70/110 (63%), Gaps = 6/110 (5%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +LDGR+ITVNEAQSRGSGGGGG      GGY S GGGGY        GGGGRRE GGG  
Sbjct: 73  NLDGRNITVNEAQSRGSGGGGG------GGYGSRGGGGY--------GGGGRRESGGG-- 116

Query: 182 GGGGGYSSRGGGGGSYGGGRREGG----GGYGGGEGGGYGGSGG--GGGW 313
           GG GG    GGGGG Y GGRREGG    GGYGG  G  Y  SG   GG W
Sbjct: 117 GGYGGSRGYGGGGGGY-GGRREGGYSRDGGYGGDGGSRYSRSGASDGGSW 165

[177][TOP]
>UniRef100_Q75QN9 Cold shock domain protein 2 n=1 Tax=Triticum aestivum
           RepID=Q75QN9_WHEAT
          Length = 205

 Score =  114 bits (285), Expect = 3e-24
 Identities = 62/108 (57%), Positives = 63/108 (58%), Gaps = 18/108 (16%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           SR S GGG   G GGGGY   GGGGY GGGG YGGGGG   GGGG  GGGGGY   GGGG
Sbjct: 80  SRPSEGGGDRGGRGGGGY---GGGGYGGGGGGYGGGGGGYGGGGGSYGGGGGYGGGGGGG 136

Query: 221 ---GSYGGGRR---------------EGGGGYGGGEGGGYGGSGGGGG 310
              G  GGGR                +GGGG GGG GGG G  GGGGG
Sbjct: 137 RYGGGSGGGRECYKCGEEGHISRDCPQGGGGGGGGYGGGGGRGGGGGG 184

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/121 (47%), Positives = 60/121 (49%), Gaps = 20/121 (16%)
 Frame = +2

Query: 8   DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
           DGR+   +     G    GG R   GGG R G GGG  GGGG  GGGGG   GGGGY GG
Sbjct: 60  DGRTKATDVTAPGGGALAGGSRPSEGGGDRGGRGGGGYGGGGYGGGGGGYGGGGGGYGGG 119

Query: 188 GGGYSSRGGGGGSYGGGRREGGGG--------------------YGGGEGGGYGGSGGGG 307
           GG Y   GG GG  GGGR  GG G                     GGG GGGYGG GG G
Sbjct: 120 GGSYGGGGGYGGGGGGGRYGGGSGGGRECYKCGEEGHISRDCPQGGGGGGGGYGGGGGRG 179

Query: 308 G 310
           G
Sbjct: 180 G 180

 Score =  103 bits (258), Expect = 5e-21
 Identities = 63/107 (58%), Positives = 64/107 (59%), Gaps = 18/107 (16%)
 Frame = +2

Query: 44  RGSGG-GGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG--YSGGGGG------ 196
           RG GG GGG  GGGGGGY  GGGGGY GGGGSYGGGGG   GGGG  Y GG GG      
Sbjct: 92  RGGGGYGGGGYGGGGGGY-GGGGGGYGGGGGSYGGGGGYGGGGGGGRYGGGSGGGRECYK 150

Query: 197 -----YSSR----GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
                + SR    GGGGG         GGGYGG  GGG GG GGGGG
Sbjct: 151 CGEEGHISRDCPQGGGGG---------GGGYGG--GGGRGGGGGGGG 186

 Score =  101 bits (251), Expect = 3e-20
 Identities = 59/122 (48%), Positives = 61/122 (50%), Gaps = 22/122 (18%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGG-GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
           G ++      S G G  GG  GGG GGG   GGGGGY GGGG YGGGGG   GGGGY GG
Sbjct: 73  GGALAGGSRPSEGGGDRGGRGGGGYGGGGYGGGGGGYGGGGGGYGGGGGSYGGGGGYGGG 132

Query: 188 GGG--YSSRGGGG-------------------GSYGGGRREGGGGYGGGEGGGYGGSGGG 304
           GGG  Y    GGG                   G  GGG   GGGG GGG GGG   S G 
Sbjct: 133 GGGGRYGGGSGGGRECYKCGEEGHISRDCPQGGGGGGGGYGGGGGRGGGGGGGGCFSCGE 192

Query: 305 GG 310
            G
Sbjct: 193 SG 194

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 38/69 (55%), Positives = 39/69 (56%)
 Frame = +2

Query: 107 GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
           GGG   GG     GGG R G GG   GGGGY   GGGGG YGGG        GGG GGG 
Sbjct: 72  GGGALAGGSRPSEGGGDRGGRGGGGYGGGGY---GGGGGGYGGG--------GGGYGGGG 120

Query: 287 GGSGGGGGW 313
           G  GGGGG+
Sbjct: 121 GSYGGGGGY 129

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 35/72 (48%), Positives = 38/72 (52%), Gaps = 18/72 (25%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGG----YRSG-----------GGGGYSGGGGSYGGGGGRREGGGG-- 175
           G GGGGG  GGG GG    Y+ G           GGGG  GG   YGGGGGR  GGGG  
Sbjct: 130 GGGGGGGRYGGGSGGGRECYKCGEEGHISRDCPQGGGGGGGG---YGGGGGRGGGGGGGG 186

Query: 176 -YSGGGGGYSSR 208
            +S G  G+ SR
Sbjct: 187 CFSCGESGHFSR 198

[178][TOP]
>UniRef100_Q08529 Glycine-rich protein n=1 Tax=Nicotiana tabacum RepID=Q08529_TOBAC
          Length = 271

 Score =  114 bits (285), Expect = 3e-24
 Identities = 60/99 (60%), Positives = 66/99 (66%), Gaps = 11/99 (11%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGG---GGGRREGGGGYSG---GGGGYS 202
           G+GGGGG  GGGGGG   GG  GGG  GGGG +GG   GGG  +GGGG+ G   GGGGY 
Sbjct: 147 GAGGGGGAVGGGGGGRGGGGEGGGGVGGGGGGHGGVRGGGGGGQGGGGHGGAQGGGGGYG 206

Query: 203 SRGGGGGSYGG---GRREGGGGYGGGEGGGYGGSGGGGG 310
            RGGGGG  GG   G  +GGG  GGG GGG GG+GG GG
Sbjct: 207 GRGGGGGGQGGGGAGGAQGGGRGGGGVGGGGGGAGGRGG 245

 Score =  113 bits (283), Expect = 6e-24
 Identities = 60/99 (60%), Positives = 64/99 (64%), Gaps = 11/99 (11%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSG---GGGSYGGGGGRR----EGGGGYSGGGGGYS 202
           +G  GGGG  GGGGGG   G GGGY G   GGG+ GGGGG R    EGGGG  GGGGG+ 
Sbjct: 121 QGGVGGGGQGGGGGGGTHGGVGGGYGGAGGGGGAVGGGGGGRGGGGEGGGGVGGGGGGHG 180

Query: 203 S-RGGGGGSYGGGRR---EGGGGYGGGEGGGYGGSGGGG 307
             RGGGGG  GGG     +GGGG  GG GGG GG GGGG
Sbjct: 181 GVRGGGGGGQGGGGHGGAQGGGGGYGGRGGGGGGQGGGG 219

 Score =  112 bits (281), Expect = 1e-23
 Identities = 61/93 (65%), Positives = 63/93 (67%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG---GGSYGGGGGRREGG--GGYSGGGGGYSSRG 211
           G GGGGGH GGG GG   GGGGGY GG   GG  GGGGG   GG  GGY G GGG  + G
Sbjct: 100 GGGGGGGHGGGGVGG---GGGGGYQGGVGGGGQGGGGGGGTHGGVGGGYGGAGGGGGAVG 156

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGG  GGG  EGGGG GGG GGG+GG  GGGG
Sbjct: 157 GGGGGRGGGG-EGGGGVGGG-GGGHGGVRGGGG 187

 Score =  111 bits (277), Expect = 3e-23
 Identities = 59/101 (58%), Positives = 63/101 (62%), Gaps = 13/101 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGG-GGGGYRSGGGGGYSGG-----GGSYGGGGGRREGGGGYSGGGGGYSSR 208
           G GGGGG++GG GGGG   GGGGG  GG     GG+ GGGG    GGGG  GGG G    
Sbjct: 113 GGGGGGGYQGGVGGGGQGGGGGGGTHGGVGGGYGGAGGGGGAVGGGGGGRGGGGEGGGGV 172

Query: 209 GGGGGSYGGGRREGGGGYGG-------GEGGGYGGSGGGGG 310
           GGGGG +GG R  GGGG GG       G GGGYGG GGGGG
Sbjct: 173 GGGGGGHGGVRGGGGGGQGGGGHGGAQGGGGGYGGRGGGGG 213

 Score =  107 bits (267), Expect = 4e-22
 Identities = 60/97 (61%), Positives = 64/97 (65%), Gaps = 11/97 (11%)
 Frame = +2

Query: 53  GGGGGHRGGGG--GGYRSGGGGGYSG----GGGSYGGGG--GRREGGGGYSGGGGGYSSR 208
           GGGGG RGGGG  GG   GGGGG+ G    GGG  GGGG  G + GGGGY G GGG   +
Sbjct: 156 GGGGGGRGGGGEGGGGVGGGGGGHGGVRGGGGGGQGGGGHGGAQGGGGGYGGRGGGGGGQ 215

Query: 209 GGG--GGSYGGGRREGG-GGYGGGEGGGYGGSGGGGG 310
           GGG  GG+ GGGR  GG GG GGG GG  GG GGGGG
Sbjct: 216 GGGGAGGAQGGGRGGGGVGGGGGGAGGRGGGQGGGGG 252

 Score =  107 bits (267), Expect = 4e-22
 Identities = 56/90 (62%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG--GGG 220
           G GG GG RGGGGGG   GG GG  GGGG YGG GG   GGGG  GGG G +  G  GGG
Sbjct: 175 GGGGHGGVRGGGGGGQGGGGHGGAQGGGGGYGGRGG---GGGGQGGGGAGGAQGGGRGGG 231

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G  GGG   GG G G G GGG GGSGG GG
Sbjct: 232 GVGGGGGGAGGRGGGQGGGGGAGGSGGAGG 261

 Score =  101 bits (252), Expect = 2e-20
 Identities = 59/107 (55%), Positives = 64/107 (59%), Gaps = 7/107 (6%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGG------GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREG-G 169
           G+ IT + A   GS GG      GG  G GGG Y  GGGGG+ GGG   GGGGG + G G
Sbjct: 68  GKGITHSGAG--GSTGGLAIVTVGGGGGSGGGTYGGGGGGGHGGGGVGGGGGGGYQGGVG 125

Query: 170 GGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  GGGGG  + GG GG YGG    GGGG  GG GGG GG G GGG
Sbjct: 126 GGGQGGGGGGGTHGGVGGGYGGA--GGGGGAVGGGGGGRGGGGEGGG 170

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/92 (59%), Positives = 56/92 (60%), Gaps = 8/92 (8%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGY---SGGGGSYGGGG-----GRREGGGGYSGGGGGYSSR 208
           GGGGG +GGGG G   GGGGGY    GGGG  GGGG     G   GGGG  GGGGG   R
Sbjct: 184 GGGGGGQGGGGHGGAQGGGGGYGGRGGGGGGQGGGGAGGAQGGGRGGGGVGGGGGGAGGR 243

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
           GGG G  GGG   G GG GG  GGG GG GGG
Sbjct: 244 GGGQG--GGG---GAGGSGGAGGGGRGGHGGG 270

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 57/96 (59%), Positives = 60/96 (62%), Gaps = 6/96 (6%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGG--GGYRS---GGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSS 205
           S   G G  H G GG  GG      GGGGG   GGG+YGGGGG   GGGG  GGGGG   
Sbjct: 64  SLAGGKGITHSGAGGSTGGLAIVTVGGGGG--SGGGTYGGGGGGGHGGGGV-GGGGGGGY 120

Query: 206 RGG-GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           +GG GGG  GGG   GGGG  GG GGGYGG+GGGGG
Sbjct: 121 QGGVGGGGQGGG---GGGGTHGGVGGGYGGAGGGGG 153

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/94 (42%), Positives = 43/94 (45%), Gaps = 6/94 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G    + GG       G  G  +    S  GG G    G G S GG    + GGGGGS
Sbjct: 35  GIGRTPANSGGVTSSATRGADGSLTPSTSSLAGGKGITHSGAGGSTGGLAIVTVGGGGGS 94

Query: 227 ------YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
                  GGG   GGGG GGG GGGY G  GGGG
Sbjct: 95  GGGTYGGGGGGGHGGGGVGGGGGGGYQGGVGGGG 128

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/62 (58%), Positives = 39/62 (62%), Gaps = 2/62 (3%)
 Frame = +2

Query: 44  RGSGGGGGHRGGG--GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           +G GG GG +GGG  GGG   GGGGG  G GG  GGGGG   GG G +GGGG    RGG 
Sbjct: 215 QGGGGAGGAQGGGRGGGGVG-GGGGGAGGRGGGQGGGGG--AGGSGGAGGGG----RGGH 267

Query: 218 GG 223
           GG
Sbjct: 268 GG 269

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 31/52 (59%), Positives = 34/52 (65%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG 196
           ++G G GGG  GGGGGG  +GG GG  GGGG  GG GG   GGGG  G GGG
Sbjct: 223 AQGGGRGGGGVGGGGGG--AGGRGGGQGGGGGAGGSGG--AGGGGRGGHGGG 270

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 29/47 (61%), Positives = 29/47 (61%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG 175
           AQ  G GGGG   GGGG G R GG GG  G GGS G GGG R G GG
Sbjct: 223 AQGGGRGGGGVGGGGGGAGGRGGGQGGGGGAGGSGGAGGGGRGGHGG 269

[179][TOP]
>UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1
           Tax=Sorghum bicolor RepID=C5XP48_SORBI
          Length = 109

 Score =  114 bits (285), Expect = 3e-24
 Identities = 60/93 (64%), Positives = 62/93 (66%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGG-YRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           GS G   +RGGGGGG Y SGG GG  GGGG  GGG GR  GGGGY GGGGG    GGGGG
Sbjct: 3   GSYGSDDYRGGGGGGGYGSGGYGGRGGGGG--GGGRGRGGGGGGYGGGGGGGGYGGGGGG 60

Query: 224 SYGGG----RREGGGGYGGGEGGGYGGSGGGGG 310
            YGGG    R  GGGG+GGG  GG GG GG GG
Sbjct: 61  GYGGGGGGGRGGGGGGFGGGGRGGVGGGGGRGG 93

 Score =  113 bits (282), Expect = 7e-24
 Identities = 60/91 (65%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRS--GGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           GSGG GG  GGGGGG R   GGGGGY GGGG  G GGG   GGGGY GGGGG   RGGGG
Sbjct: 20  GSGGYGGRGGGGGGGGRGRGGGGGGYGGGGGGGGYGGG---GGGGYGGGGGG--GRGGGG 74

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           G +GGG R G GG GGG GGG  G G  G W
Sbjct: 75  GGFGGGGRGGVGG-GGGRGGGGRGGGREGDW 104

 Score =  112 bits (279), Expect = 2e-23
 Identities = 59/93 (63%), Positives = 60/93 (64%), Gaps = 4/93 (4%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGG---YSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           RG GGGGG+  GG GG   GGGGG     GGGG YGGGGG    GGGY GGGGG    GG
Sbjct: 11  RGGGGGGGYGSGGYGGRGGGGGGGGRGRGGGGGGYGGGGG----GGGYGGGGGGGYGGGG 66

Query: 215 GGGSYGGGRREGGGGYGG-GEGGGYGGSGGGGG 310
           GGG  GGG   GGGG GG G GGG GG G GGG
Sbjct: 67  GGGRGGGGGGFGGGGRGGVGGGGGRGGGGRGGG 99

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/83 (60%), Positives = 53/83 (63%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           + RG GGGG   GGGGGGY  GGGGGY G     GGGGGR  GGGG+ GGG     RGG 
Sbjct: 36  RGRGGGGGGYGGGGGGGGYGGGGGGGYGG-----GGGGGRGGGGGGFGGGG-----RGGV 85

Query: 218 GGSYGGGRREGGGGYGGGEGGGY 286
           GG  GGGR  GGGG GGG  G +
Sbjct: 86  GG--GGGR--GGGGRGGGREGDW 104

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/65 (63%), Positives = 42/65 (64%)
 Frame = +2

Query: 119 SGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 298
           S G   Y GGGG    GGGY  G GGY  RGGGGG  G GR  GGGGYGGG GGG  G G
Sbjct: 4   SYGSDDYRGGGG----GGGY--GSGGYGGRGGGGGGGGRGRGGGGGGYGGGGGGGGYGGG 57

Query: 299 GGGGW 313
           GGGG+
Sbjct: 58  GGGGY 62

[180][TOP]
>UniRef100_B4NBV5 GK25731 n=1 Tax=Drosophila willistoni RepID=B4NBV5_DROWI
          Length = 111

 Score =  114 bits (285), Expect = 3e-24
 Identities = 56/95 (58%), Positives = 62/95 (65%), Gaps = 4/95 (4%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           S G  GGGG  GG GGG++ GGGGG  GGGG  GG GG ++ GGG  GG GG    GGGG
Sbjct: 19  SAGGQGGGGGGGGQGGGWQKGGGGGNGGGGG--GGQGGWQKNGGGGGGGNGGGKHGGGGG 76

Query: 221 GSYGGGRREGGGG----YGGGEGGGYGGSGGGGGW 313
           G  GGG+  GGGG    +GGG GGG GG  GGGGW
Sbjct: 77  GGNGGGKHGGGGGGGGKHGGGGGGGNGGKHGGGGW 111

[181][TOP]
>UniRef100_UPI0000DA1CBA PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA1CBA
          Length = 200

 Score =  114 bits (284), Expect = 4e-24
 Identities = 59/98 (60%), Positives = 61/98 (62%), Gaps = 10/98 (10%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG--------GGSYGGGGGRREGGGGYSGG--GGG 196
           G GGGGG  GGGGGG   GGGGG  GG        GG  GGGGG  +GGGG  GG  GGG
Sbjct: 40  GGGGGGGDDGGGGGGGGGGGGGGCDGGGGGGGGGDGGGGGGGGGGCDGGGGGGGGGDGGG 99

Query: 197 YSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
               GGGGG  G G R GG G GGG+GGG GG GGGGG
Sbjct: 100 GGGGGGGGGGGGDGGRGGGDGGGGGDGGGDGGGGGGGG 137

 Score =  112 bits (280), Expect = 1e-23
 Identities = 58/102 (56%), Positives = 59/102 (57%), Gaps = 14/102 (13%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG--- 217
           G GGGGG  GGGGGG   GGGGG  G GG  GGGGG   G GG  GGGGG   RGGG   
Sbjct: 89  GGGGGGGDGGGGGGGGGGGGGGGDGGRGGGDGGGGGDGGGDGGGGGGGGGDGGRGGGDGG 148

Query: 218 -----------GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
                      GG  GGG   G GG GGG+GGG GG GGGGG
Sbjct: 149 GGDGGGGDGGRGGGDGGGGGGGDGGRGGGDGGGGGGDGGGGG 190

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/102 (59%), Positives = 63/102 (61%)
 Frame = +2

Query: 5   LDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG 184
           LD   +TV      G G GGG  GGGGGG    GGGG  GGGG  GGGGG   GGG   G
Sbjct: 15  LDKTQVTVPAVLICG-GIGGGDDGGGGGG----GGGGDDGGGGGGGGGGG---GGGCDGG 66

Query: 185 GGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGG    GGGGG  GGG   GGGG GGG+GGG GG GGGGG
Sbjct: 67  GGGGGGGDGGGGGGGGGGCDGGGGGGGGGDGGGGGGGGGGGG 108

 Score =  109 bits (272), Expect = 1e-22
 Identities = 55/89 (61%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG-GG 223
           G  GGGG  GGG GG   GGGGG  GGGG  GGG G   GGGG  GGGGG   RGGG GG
Sbjct: 62  GCDGGGGGGGGGDGGGGGGGGGGCDGGGGGGGGGDGGGGGGGGGGGGGGGDGGRGGGDGG 121

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             G G  +GGGG GGG  GG GG  GGGG
Sbjct: 122 GGGDGGGDGGGGGGGGGDGGRGGGDGGGG 150

 Score =  108 bits (270), Expect = 2e-22
 Identities = 55/90 (61%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG    GGGG  GGGG  GGG G R GG G  GG GG    GGGGG 
Sbjct: 78  GGGGGGGCDGGGGGGGGGDGGGGGGGGGGGGGGGDGGRGGGDGGGGGDGGGDGGGGGGGG 137

Query: 227 YGGGR--REGGGGYGGGEGGGYGGSGGGGG 310
             GGR   +GGGG GGG  GG GG  GGGG
Sbjct: 138 GDGGRGGGDGGGGDGGGGDGGRGGGDGGGG 167

 Score =  108 bits (269), Expect = 2e-22
 Identities = 56/91 (61%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG---GSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G GGGG   GGGGGG   GGGGG  GGG   G  GGGGG   GGGG  GGGGG    G G
Sbjct: 57  GGGGGGCDGGGGGGGGGDGGGGGGGGGGCDGGGGGGGGGDGGGGGGGGGGGGGGGDGGRG 116

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  GGG   GG G GGG GGG GG GGG G
Sbjct: 117 GGDGGGGGDGGGDGGGGGGGGGDGGRGGGDG 147

 Score =  107 bits (267), Expect = 4e-22
 Identities = 55/92 (59%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGG----SYGGGGGRREGGGGYSGGGGGYSSRGG 214
           G G  GG  GGGGGG   GGGGG  GGGG      GGGGG  +GGGG  GGGG     GG
Sbjct: 32  GGGDDGGGGGGGGGGDDGGGGGGGGGGGGGGCDGGGGGGGGGDGGGGGGGGGGCDGGGGG 91

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG  GGG   GGGG GGG  GG GG  GGGG
Sbjct: 92  GGGGDGGGGGGGGGGGGGGGDGGRGGGDGGGG 123

 Score =  107 bits (267), Expect = 4e-22
 Identities = 55/91 (60%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG---YSSRGGG 217
           G  GGGG  GGGG     GGGGG  GGGG  GGGGG   G GG  GGGGG       GGG
Sbjct: 34  GDDGGGGGGGGGGDDGGGGGGGGGGGGGGCDGGGGGGGGGDGGGGGGGGGGCDGGGGGGG 93

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  GGG   GGGG GGG+GG  GG GGGGG
Sbjct: 94  GGDGGGGGGGGGGGGGGGDGGRGGGDGGGGG 124

 Score =  105 bits (263), Expect = 1e-21
 Identities = 54/88 (61%), Positives = 54/88 (61%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG G  GGGGGG   GGGGG  GG G  GGGGG   GGGG  G GGG    GG GG 
Sbjct: 69  GGGGGDGGGGGGGGGGCDGGGGGGGGGDGGGGGGGGGGGGGGGDGGRGGGDGGGGGDGGG 128

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG  GG GGG GG G GGG
Sbjct: 129 DGGG--GGGGGGDGGRGGGDGGGGDGGG 154

 Score =  103 bits (258), Expect = 5e-21
 Identities = 52/88 (59%), Positives = 52/88 (59%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG   GGGGG   G GGG  GGGG  GGGG    GGG   GGG G    GGGGG 
Sbjct: 77  GGGGGGGGCDGGGGGGGGGDGGGGGGGGGGGGGGGDGGRGGGDGGGGGDGGGDGGGGGGG 136

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            G G R GG G GG  GGG GG GGG G
Sbjct: 137 GGDGGRGGGDGGGGDGGGGDGGRGGGDG 164

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 45/79 (56%), Positives = 47/79 (59%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G  GGG   GGGGGG   G GGG  GGG   GG GGR  GGG   GGGGG   RGGG G 
Sbjct: 123 GGDGGGDGGGGGGGGGDGGRGGGDGGGGDGGGGDGGR--GGGDGGGGGGGDGGRGGGDGG 180

Query: 227 YGGGRREGGGGYGGGEGGG 283
            GGG  +GGGG GG +  G
Sbjct: 181 GGGG--DGGGGGGGAQPPG 197

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 37/65 (56%), Positives = 39/65 (60%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG G RGGG GG   GGGG    GGG  GGGGG   G GG  GGGGG    GGGGG+
Sbjct: 134 GGGGGDGGRGGGDGGGGDGGGGDGGRGGGDGGGGGGGDGGRGGGDGGGGGGDGGGGGGGA 193

Query: 227 YGGGR 241
              G+
Sbjct: 194 QPPGQ 198

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 31/56 (55%), Positives = 31/56 (55%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG 211
           RG G GGG  GGGG G R GG GG  GGG    GGG    GGG   GGGGG    G
Sbjct: 142 RGGGDGGGGDGGGGDGGRGGGDGGGGGGGDGGRGGGDGGGGGGDGGGGGGGAQPPG 197

[182][TOP]
>UniRef100_UPI0001B7A53E UPI0001B7A53E related cluster n=1 Tax=Rattus norvegicus
            RepID=UPI0001B7A53E
          Length = 1391

 Score =  114 bits (284), Expect = 4e-24
 Identities = 61/109 (55%), Positives = 69/109 (63%), Gaps = 20/109 (18%)
 Frame = +2

Query: 47   GSGGGGGHRGGG-GGGYRSGGGGGY-----SGGGGSYG-GGGGRREGGGGYSGGGGGYSS 205
            G G GGG+  GG GGG+ SGGGGG+     SGGGG +G GGGG   GGGG+ GGGGG+S 
Sbjct: 1188 GGGYGGGYGSGGFGGGFGSGGGGGFGGGFNSGGGGGFGSGGGGFGSGGGGFGGGGGGFSG 1247

Query: 206  RGGGGGSYGGGRREGGGGYGGGE-------------GGGYGGSGGGGGW 313
             GGGGG +GGGR  GGGG  GG              GGGYGG GG GG+
Sbjct: 1248 -GGGGGGFGGGRGGGGGGGFGGSGGFGSGGGGYGVGGGGYGGGGGSGGY 1295

 Score =  113 bits (282), Expect = 7e-24
 Identities = 60/98 (61%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +2

Query: 29   NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
            N     G G GGG  G GGGG+  GGGGG+SGGGG  G GGGR  GGGG  GG GG+ S 
Sbjct: 1217 NSGGGGGFGSGGGGFGSGGGGF-GGGGGGFSGGGGGGGFGGGRGGGGGGGFGGSGGFGSG 1275

Query: 209  GG----GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG    GGG YGGG   G GGYGGG  GGYGG GGG G
Sbjct: 1276 GGGYGVGGGGYGGG--GGSGGYGGG-SGGYGGGGGGYG 1310

 Score =  111 bits (277), Expect = 3e-23
 Identities = 59/104 (56%), Positives = 61/104 (58%), Gaps = 18/104 (17%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGG------YSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
            G G GGG  GGGGGG+  GGGGG        GGGG +GG GG   GGGGY  GGGGY   
Sbjct: 1230 GFGSGGGGFGGGGGGFSGGGGGGGFGGGRGGGGGGGFGGSGGFGSGGGGYGVGGGGYGG- 1288

Query: 209  GGGGGSYGGGR---REGGGGYGGGEG---------GGYGGSGGG 304
            GGG G YGGG      GGGGYGGGEG         G YGG GGG
Sbjct: 1289 GGGSGGYGGGSGGYGGGGGGYGGGEGYNMSPNSYRGNYGGGGGG 1332

 Score =  106 bits (264), Expect = 9e-22
 Identities = 56/94 (59%), Positives = 61/94 (64%), Gaps = 4/94 (4%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGG-GGGYSGGG--GSYGGGGGRREGGGGYSGGGGGYSSRG 211
            +R   G G  RG GGGGY  GG GGGY  GG  G +G GGG   GGG  SGGGGG+ S G
Sbjct: 1169 ARYDNGSGYRRGYGGGGYGGGGYGGGYGSGGFGGGFGSGGGGGFGGGFNSGGGGGFGSGG 1228

Query: 212  GGGGSYGGGRREGGGGYG-GGEGGGYGGSGGGGG 310
            GG GS GGG   GGGG+  GG GGG+GG  GGGG
Sbjct: 1229 GGFGSGGGGFGGGGGGFSGGGGGGGFGGGRGGGG 1262

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/92 (56%), Positives = 54/92 (58%), Gaps = 6/92 (6%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
            G G GGG  GGGGGG+  GG GG+  GGG YG GGG   GGGG  G GGG    GGGGG 
Sbjct: 1251 GGGFGGGRGGGGGGGF--GGSGGFGSGGGGYGVGGGGYGGGGGSGGYGGGSGGYGGGGGG 1308

Query: 227  YGGGR------REGGGGYGGGEGGGYGGSGGG 304
            YGGG           G YGGG GG  GGS GG
Sbjct: 1309 YGGGEGYNMSPNSYRGNYGGGGGGYRGGSQGG 1340

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 62/129 (48%), Positives = 65/129 (50%), Gaps = 40/129 (31%)
 Frame = +2

Query: 47   GSGGGGGHRGGGGGGYRSG------GGGGYSGGGGSYGGGGGRRE---GGGGYSGGGGGY 199
            G GG GG RGGGGGG   G      GGGGY  GGG YGGGGG      G GGY GGGGGY
Sbjct: 1250 GGGGFGGGRGGGGGGGFGGSGGFGSGGGGYGVGGGGYGGGGGSGGYGGGSGGYGGGGGGY 1309

Query: 200  --------------SSRGGGGGSYGGGRREG-----GGGYGG------GEGGGYGGSGG- 301
                           + GGGGG Y GG + G     GG Y G      G GGGY GSGG 
Sbjct: 1310 GGGEGYNMSPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRGSGGGYRGSGGF 1369

Query: 302  -----GGGW 313
                 GGG+
Sbjct: 1370 QRRGYGGGY 1378

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 62/125 (49%), Positives = 62/125 (49%), Gaps = 35/125 (28%)
 Frame = +2

Query: 41   SRGSGGGGGHRGGGGGGYRSGGG-GGYSGGGGSYGGGGGRREGG-----------GGYSG 184
            S G G GGG  G GGGGY  GGG GGY GG G YGGGGG   GG           G Y G
Sbjct: 1269 SGGFGSGGGGYGVGGGGYGGGGGSGGYGGGSGGYGGGGGGYGGGEGYNMSPNSYRGNYGG 1328

Query: 185  GGGGYSSRGGGGGSY------------------GGGRREGGG----GYGGGE-GGGYGGS 295
            GGGGY  RGG  G Y                  GGG R  GG    GYGGG  G G GG 
Sbjct: 1329 GGGGY--RGGSQGGYRNNFGGDYRGSSGDYRGSGGGYRGSGGFQRRGYGGGYFGQGRGGG 1386

Query: 296  GGGGG 310
            GGGGG
Sbjct: 1387 GGGGG 1391

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 49/96 (51%), Positives = 56/96 (58%), Gaps = 11/96 (11%)
 Frame = +2

Query: 59   GGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG-GRREGGGGYSGG---------GGGYSSR 208
            G G R      Y +G G     GGG YGGGG G   G GG+ GG         GGG++S 
Sbjct: 1160 GDGPRPPKMARYDNGSGYRRGYGGGGYGGGGYGGGYGSGGFGGGFGSGGGGGFGGGFNSG 1219

Query: 209  GGGG-GSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
            GGGG GS GGG   GGGG+GGG GGG+ G GGGGG+
Sbjct: 1220 GGGGFGSGGGGFGSGGGGFGGG-GGGFSGGGGGGGF 1254

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/88 (48%), Positives = 52/88 (59%)
 Frame = +2

Query: 8    DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
            +G +++ N  +    GGGGG+RGG  GGYR+  GG Y G  G Y G       GGGY  G
Sbjct: 1313 EGYNMSPNSYRGNYGGGGGGYRGGSQGGYRNNFGGDYRGSSGDYRG------SGGGYR-G 1365

Query: 188  GGGYSSRGGGGGSYGGGRREGGGGYGGG 271
             GG+  RG GGG +G GR  GGGG GGG
Sbjct: 1366 SGGFQRRGYGGGYFGQGR--GGGGGGGG 1391

[183][TOP]
>UniRef100_A3PA60 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. MIT 9301
           RepID=A3PA60_PROM0
          Length = 217

 Score =  114 bits (284), Expect = 4e-24
 Identities = 64/119 (53%), Positives = 69/119 (57%), Gaps = 15/119 (12%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYS 181
           +L GR + +N+A+ RGSGG    RGG GGGY  G  GG  GGGG  GG  G   GGGGY 
Sbjct: 66  ELMGRPLRINKAEPRGSGGS--RRGGRGGGYGGGNSGGGYGGGGYGGGNSGGGYGGGGYG 123

Query: 182 GG--GGGYSSRGGGGGSYGGGRREGGGGYGGGE-GGGYGG------------SGGGGGW 313
           GG  GGGY   G GGG YGGG   GGGGYGGG  GGGYGG            S G  GW
Sbjct: 124 GGNSGGGYGGGGYGGGGYGGGGY-GGGGYGGGNSGGGYGGGNSESNSSNINKSSGAEGW 181

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 45/88 (51%), Positives = 46/88 (52%), Gaps = 3/88 (3%)
 Frame = +2

Query: 41  SRGSGGGGGHRGG-GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG--GGGYSSRG 211
           S G  GGGG+ GG  GGGY   GGGGY  GGG YGGGG    GGGGY GG  GGGY   G
Sbjct: 113 SGGGYGGGGYGGGNSGGGY---GGGGY--GGGGYGGGG---YGGGGYGGGNSGGGY---G 161

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGS 295
           GG             G  G E   YG S
Sbjct: 162 GGNSESNSSNINKSSGAEGWEDRSYGNS 189

[184][TOP]
>UniRef100_A4CWS8 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Synechococcus sp. WH 7805 RepID=A4CWS8_SYNPV
          Length = 197

 Score =  114 bits (284), Expect = 4e-24
 Identities = 61/110 (55%), Positives = 68/110 (61%), Gaps = 9/110 (8%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGS-----GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREG 166
           +L GR + +N+A+ RGS     GGGGG+ GGGGGGY  GGGGGY GGGG     GG R G
Sbjct: 66  ELMGRPLRINKAEPRGSAPRRGGGGGGYGGGGGGGYGGGGGGGYGGGGG-----GGYRGG 120

Query: 167 GGGYSGGGGGYSSRGGGGGSYGGGR----REGGGGYGGGEGGGYGGSGGG 304
           GGGY+ GGGGY   GGGG    G R    R  GGG G   GGGY   GGG
Sbjct: 121 GGGYNDGGGGY---GGGGERRSGARGWEDRSYGGGSGAAGGGGYSDGGGG 167

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 47/91 (51%), Positives = 50/91 (54%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG---RREGGGGYSGGGGGYSSRGGG 217
           G GGGGG+RGGGGG   + GGGGY GGG    G  G   R  GGG  + GGGGYS  GGG
Sbjct: 110 GGGGGGGYRGGGGG--YNDGGGGYGGGGERRSGARGWEDRSYGGGSGAAGGGGYSD-GGG 166

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G      RR GG     G G  Y G GG  G
Sbjct: 167 GDDGRSRRRRGGAAPSEGGGDDYSGYGGAEG 197

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/65 (56%), Positives = 37/65 (56%), Gaps = 9/65 (13%)
 Frame = +2

Query: 146 GGGRREGGGGYS---GGGGGYSSRGGG--GGSYGGGRREGGGGYGGGEGGGYGGSG---- 298
           G   R GGGG     GGGGGY   GGG  GG  GGG R GGGGY  G GGGYGG G    
Sbjct: 81  GSAPRRGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGYRGGGGGYNDG-GGGYGGGGERRS 139

Query: 299 GGGGW 313
           G  GW
Sbjct: 140 GARGW 144

[185][TOP]
>UniRef100_Q01AC1 Meltrins, fertilins and related Zn-dependent metalloproteinases of
           the ADAMs family (ISS) n=1 Tax=Ostreococcus tauri
           RepID=Q01AC1_OSTTA
          Length = 872

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/94 (60%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSR-LPPP*LPPPPPLEE*PPPPPLYPP-----PPSRLPP 148
           PPP P PP PPPSPPP PPPPS   PPP  P PPP    PPPPP  PP     PPS  PP
Sbjct: 511 PPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPS---PPPPPSPPPGSAARPPSPPPP 567

Query: 147 PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
            PP   PPP  PPPPP   P PPPP  PPPP  P
Sbjct: 568 SPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPP 601

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/98 (58%), Positives = 57/98 (58%), Gaps = 10/98 (10%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PP---PPPLYPPPPS------- 160
           PP P  PP PPPSPPP  PPPS  PPP  PPP P    PP   PPP  PPPPS       
Sbjct: 502 PPSPSPPPSPPPSPPPPSPPPS--PPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAA 559

Query: 159 RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           R P PPP  PPPP   PPPP   PPP PP  PPPPP P
Sbjct: 560 RPPSPPPPSPPPPS--PPPPSPPPPPSPPPSPPPPPSP 595

 Score =  108 bits (271), Expect = 1e-22
 Identities = 56/96 (58%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPP----PYPPPPSRLPPP*LPPPP-----PLEE*PPPPPLYPPPPSR 157
           PPPP  PP PPPSPP    P PPPPS  PPP  PPPP          P PPP  PPPPS 
Sbjct: 515 PPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPS- 573

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPL 49
             PPPP  PPPP  PP PP   PP PPP  PPPPP+
Sbjct: 574 --PPPPSPPPPPSPPPSPP--PPPSPPPPSPPPPPV 605

 Score =  105 bits (263), Expect = 1e-21
 Identities = 53/96 (55%), Positives = 55/96 (57%), Gaps = 11/96 (11%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPP-----P*LPPPPPLEE*PPPPPLYPPPPSRLP-P 148
           PP PP PP P PSPPP PPPP   PP     P  PPPP      PPPP  PPPPS  P P
Sbjct: 530 PPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSP 589

Query: 147 PPP*LPPPPE*PPPPPLRYPPPPPP-----RWPPPP 55
           PPP  PPPP  PPPP +  P  PPP      +PPPP
Sbjct: 590 PPPPSPPPPSPPPPPVVVVPSSPPPVLVNDMYPPPP 625

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 54/98 (55%), Positives = 55/98 (56%), Gaps = 10/98 (10%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYP-PPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           P  PP+   PPPSP P P PPPS  PPP  PPP P    PPP P  PPPPS  PPP P  
Sbjct: 493 PTAPPVSS-PPPSPSPPPSPPPS--PPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSP-- 547

Query: 132 PPPPE*P---------PPPPLRYPPPPPPRWPPPPPLP 46
           PPPP  P         PPPP   PP PPP  PPPPP P
Sbjct: 548 PPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSP 585

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 39/70 (55%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query: 252 PPSRLPP-P*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPP 76
           P S LP  P +  PPP    PP PP  PPPPS  P PPP  PPPP  P PPP   P P P
Sbjct: 488 PSSELPTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPP-SPPPPSPPSPPP---PSPSP 543

Query: 75  PRWPPPPPLP 46
           P  PPPPP P
Sbjct: 544 PPSPPPPPSP 553

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 23/44 (52%), Positives = 27/44 (61%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPL 178
           P PPP PP PP  PPP PPPP  +  P  PPP  + +  PPPP+
Sbjct: 583 PSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPPVLVNDMYPPPPV 626

[186][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score =  114 bits (284), Expect = 4e-24
 Identities = 53/87 (60%), Positives = 53/87 (60%), Gaps = 3/87 (3%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP---PPP* 136
           PPPP PP P PSPPP  PPP   PPP   PPPP    P PPP  PPPPS  PP   PPP 
Sbjct: 414 PPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPP 473

Query: 135 LPPPPE*PPPPPLRYPPPPPPRWPPPP 55
            PPPP  PPP P   PP PPP  PPPP
Sbjct: 474 SPPPPSPPPPSPSPPPPSPPPPSPPPP 500

 Score =  109 bits (273), Expect = 8e-23
 Identities = 56/90 (62%), Positives = 56/90 (62%), Gaps = 3/90 (3%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPP-PLEE*PPPPPLYPPPPSRLPP-PPP*L 133
           P PPLPP  P  PPP PPPPS  PPP  PPPP P    P PPP  PPPPS  PP PPP  
Sbjct: 405 PSPPLPP--PSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPS 462

Query: 132 PPPPE*PPPPPLRYPP-PPPPRWPPPPPLP 46
           PPPP   PPPP   PP PPPP   PPPP P
Sbjct: 463 PPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 492

 Score =  107 bits (267), Expect = 4e-22
 Identities = 54/97 (55%), Positives = 55/97 (56%), Gaps = 13/97 (13%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPP---P* 136
           PPPP P  PPPSPPP  PPP   PPP  PPP P    P PPP  PPPPS  PPPP   P 
Sbjct: 436 PPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP 495

Query: 135 LPPPPE*PPPPPL-------RYPPPPPPRW---PPPP 55
            PPPP   PPPP        RY  PPPP +   PPPP
Sbjct: 496 SPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPP 532

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/95 (56%), Positives = 55/95 (57%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P   +  PPPP  PP  PP P P PPPPS  PPP  PPP P    PPPP   PPPPS 
Sbjct: 417 PSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP-PPPSPPPPSPPPPSPPPPSPSPPPPS- 474

Query: 156 LPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPP 52
            PPPP   PPPP   PPPP   PP PPP  P PPP
Sbjct: 475 -PPPPS--PPPPSPSPPPPSPPPPSPPPPSPSPPP 506

 Score =  105 bits (261), Expect = 2e-21
 Identities = 53/95 (55%), Positives = 54/95 (56%), Gaps = 11/95 (11%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           PPPP PP P PSPPP  PPP   PPP  PPP P    P PPP  PPPPS  PPPP   PP
Sbjct: 431 PPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPS--PPPPSPSPP 488

Query: 126 PPE*PPP-PPLRYPPPPPPRW----------PPPP 55
           PP  PPP PP   P PPPP +          PPPP
Sbjct: 489 PPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPP 523

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 56/118 (47%), Positives = 60/118 (50%), Gaps = 31/118 (26%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPP-YPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP--------SRL 154
           PPPP P  PPPSPPP  PPPPS  PPP  PPPP     PPPP   PPPP          L
Sbjct: 463 PPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPS----PPPPSPSPPPPYYEVSPEERYL 518

Query: 153 PPPPP---*LPPPPE----------*PPPPPLRYPPPPPPRW---------PPPPPLP 46
            PPPP    +PPPP            PPPPP+ + PPPPP +          PPPP P
Sbjct: 519 SPPPPAYTEVPPPPYYEVSPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRYLSPPPPSP 576

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 47/124 (37%), Positives = 52/124 (41%), Gaps = 29/124 (23%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPY-----------PPPP--SRLPPP*L--------- 223
           P P+     PPPP  PP  P  PPPY           PPPP  + +PPP           
Sbjct: 483 PSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPPYYEVSPEDRY 542

Query: 222 --PPPPPLEE*PPPPPLYPPPP-----SRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWP 64
             PPPPP+   PPPPP Y   P     S  PP P  LP      PPPP   P  P   + 
Sbjct: 543 LSPPPPPVHHDPPPPPYYEVSPEDRYLSPPPPSPASLPKYDYSSPPPPRALPKLPVYDYS 602

Query: 63  PPPP 52
            PPP
Sbjct: 603 SPPP 606

[187][TOP]
>UniRef100_C1EFP7 Receptor-like cell wall protein n=1 Tax=Micromonas sp. RCC299
            RepID=C1EFP7_9CHLO
          Length = 1985

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/90 (63%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*LP 130
            PPPP PP PPPSPPP  PPP   PPP   PPPP    P PPP  PPPPS  PP PPP LP
Sbjct: 1459 PPPPPPPSPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLP 1516

Query: 129  PPPE*PP---PPPLRYPPPPPPRWPPPPPL 49
            PPP  PP   PPP+   PPPPP  PP PPL
Sbjct: 1517 PPPSPPPPSSPPPMSPSPPPPP--PPFPPL 1544

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 49/83 (59%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = -3

Query: 279  PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP*LPPPPE*PPP- 106
            PP PPP  PPPS  PP    PPPP    P PPP  PPPPS  PP PPP  PPPP  PPP 
Sbjct: 1459 PPPPPPPSPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPL 1515

Query: 105  PPLRYPPP---PPPRWPPPPPLP 46
            PP   PPP   PPP  P PPP P
Sbjct: 1516 PPPPSPPPPSSPPPMSPSPPPPP 1538

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 31/59 (52%), Positives = 33/59 (55%), Gaps = 3/59 (5%)
 Frame = -3

Query: 336  PKPN*RNYHPPPPPLPP*PPPSPPP---YPPPPSRLPPP*LPPPPPLEE*PPPPPLYPP 169
            P P   +  PP PP P  PPPSPPP     PPPS  PPP   PPP     PPPPP +PP
Sbjct: 1489 PSPPPPSPPPPSPPPPSPPPPSPPPPLP--PPPS--PPPPSSPPPMSPSPPPPPPPFPP 1543

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 23/35 (65%), Positives = 24/35 (68%)
 Frame = -3

Query: 306  PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLE 202
            PPPPLPP P P PP  PPP S  PPP  PP PPL+
Sbjct: 1511 PPPPLPPPPSPPPPSSPPPMSPSPPPPPPPFPPLD 1545

[188][TOP]
>UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8J1N3_CHLRE
          Length = 527

 Score =  114 bits (284), Expect = 4e-24
 Identities = 54/91 (59%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPP P PP P P  PP PPPPS  PP   PP PP    PPPPP  PPPP   PPP P  P
Sbjct: 388 PPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPP---PPPFPPFP 444

Query: 129 PPPE*PPP---PPLRYPPPPPPRWPPPPPLP 46
           PPP  PPP   PP   PP PPP  PPPPP P
Sbjct: 445 PPPSPPPPSPGPPSPAPPSPPPPPPPPPPSP 475

 Score =  113 bits (282), Expect = 7e-24
 Identities = 52/88 (59%), Positives = 52/88 (59%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPP P PP P P  PP PPPP   PPP  PPPPP    PPPP   PPPPS  PP P    
Sbjct: 406 PPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPS--PPPPSPGPPSPAPPS 463

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP  PPPPP  YPP P P  PP PP P
Sbjct: 464 PPPPPPPPPPSPYPPSPAPPLPPSPPPP 491

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/96 (56%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS-RLPP-PPP* 136
           PPPPP PP PP  PPP PPPPS  PP   PP PP    PPPP  YPP P+  LPP PPP 
Sbjct: 432 PPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPP 491

Query: 135 LPPPPE*PPP------PPLRYPPPPPPRWPPPPPLP 46
            P PP   PP      PP   PP P P  PPPPP P
Sbjct: 492 SPYPPSPAPPVPPSPAPPSPEPPSPAPPSPPPPPSP 527

 Score =  104 bits (259), Expect = 3e-21
 Identities = 55/92 (59%), Positives = 57/92 (61%), Gaps = 5/92 (5%)
 Frame = -3

Query: 306 PPPPLPP*P-PPSPPPY--PPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR-LPPPPP 139
           PP PLPP P PPSP P   PPPPS  PP   PP PP    PPPP  YPP P+   PP PP
Sbjct: 368 PPSPLPPSPAPPSPQPPLPPPPPSPYPPSPAPPVPPS---PPPPSPYPPSPAPPAPPSPP 424

Query: 138 *LPPPPE*PPPPPLRYPP-PPPPRWPPPPPLP 46
             PPPP  PPPPP  +PP PPPP  PPP P P
Sbjct: 425 PPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGP 456

 Score =  104 bits (259), Expect = 3e-21
 Identities = 52/90 (57%), Positives = 53/90 (58%), Gaps = 2/90 (2%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPP-PPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPP-PPP* 136
           PPPPP PP PPP PPP+PP PP   PPP  P PP      PPPP  PPPPS  PP P P 
Sbjct: 424 PPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPP 483

Query: 135 LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           LPP     PPPP  YPP P P  PP P  P
Sbjct: 484 LPP----SPPPPSPYPPSPAPPVPPSPAPP 509

 Score =  102 bits (253), Expect = 2e-20
 Identities = 51/94 (54%), Positives = 52/94 (55%), Gaps = 6/94 (6%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PP PP PP P P+PP  PPPPS  PP   P PP  E   PPPP  P PPS  PP P    
Sbjct: 250 PPTPPGPPPPSPAPPNPPPPPSPAPPS--PKPPSPEPPSPPPPPSPEPPSPKPPSPEPPS 307

Query: 129 PPPE*PPPPPLRYPP------PPPPRWPPPPPLP 46
           P P  PPPPP  YPP      PPPP  PPP P P
Sbjct: 308 PQPPLPPPPPSPYPPSPSPPSPPPPSPPPPSPAP 341

 Score =  100 bits (248), Expect = 7e-20
 Identities = 53/96 (55%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*P-PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
           P P   N  PPP P PP P PPSP P  PPP   P P  P PP  E   P PPL PPPPS
Sbjct: 259 PSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPS 318

Query: 159 RLPP-PPP*LPPPPE*PPPPPLRYPPPPPPRWPPPP 55
             PP P P  PPPP   PPPP   PP P P  PPPP
Sbjct: 319 PYPPSPSPPSPPPPS--PPPPSPAPPSPAPPSPPPP 352

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 55/96 (57%), Positives = 55/96 (57%), Gaps = 9/96 (9%)
 Frame = -3

Query: 306 PPPPLPP*P-PPSP-PPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPP-PPSRLPPPPP* 136
           PP PLPP P PPSP PP PPPP   PPP   PP P    PPPP   PP PPS  PP PP 
Sbjct: 196 PPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPG 255

Query: 135 LPPP---PE*PPPPPLRYPP---PPPPRWPPPPPLP 46
            PPP   P  PPPPP   PP   PP P  P PPP P
Sbjct: 256 PPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPP 291

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 55/116 (47%), Positives = 58/116 (50%), Gaps = 18/116 (15%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPPSPP----PYPPPPSRLP----------PP*LPPPPPLE 202
           +PKP      PPPPP PP P P+PP    P PPPPS  P          PP  PPP P  
Sbjct: 208 SPKPP----SPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSPAP 263

Query: 201 E*PPPPPLYPPPPSRLPPPPP*LPPPPE*P----PPPPLRYPPPPPPRWPPPPPLP 46
             PPPPP   PP  + P P P  PPPP  P    P PP   PP P P  PPPPP P
Sbjct: 264 PNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPSP 319

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 54/119 (45%), Positives = 55/119 (46%), Gaps = 21/119 (17%)
 Frame = -3

Query: 339 NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
           +PKP       PPPP  P PP   PP P PPS  PP  LPPPPP    P P P  PPPPS
Sbjct: 276 SPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPP--LPPPPPSPYPPSPSPPSPPPPS 333

Query: 159 RLPP-PPP*LPPPPE*PPP--------------------PPLRYPPPPPPRWPPPPPLP 46
             PP P P  P PP  PPP                    PP   PP P P  PPPPP P
Sbjct: 334 PPPPSPAPPSPAPPSPPPPCECLAGERELTCAFLPPSPLPPSPAPPSPQPPLPPPPPSP 392

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 57/119 (47%), Positives = 58/119 (48%), Gaps = 31/119 (26%)
 Frame = -3

Query: 309 PPPPPLP----P*PPPSPPPYPPPPSRLPP---P*LPPPP------------------PL 205
           PPPPP P    P PP  PPP PPPPS  PP   P  PPPP                  PL
Sbjct: 313 PPPPPSPYPPSPSPPSPPPPSPPPPSPAPPSPAPPSPPPPCECLAGERELTCAFLPPSPL 372

Query: 204 EE*PPPP----PLYPPPPSRLPPPP-P*LPPPPE*PPP-PPLRYPPPPPPRWPPPPPLP 46
              P PP    PL PPPPS  PP P P +PP P  P P PP   PP PP   PPPPP P
Sbjct: 373 PPSPAPPSPQPPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPP 431

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/88 (50%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = -3

Query: 306 PPPPLPP*PPPSP-PPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PP P PP PPP P PP P P    P P  PPPP  +   PP P  P PP   PP P    
Sbjct: 206 PPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSPAPPN 265

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PPP   P PP   PP P P  PPPPP P
Sbjct: 266 PPPPPSPAPPSPKPPSPEPPSPPPPPSP 293

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 44/83 (53%), Positives = 45/83 (54%), Gaps = 4/83 (4%)
 Frame = -3

Query: 279 PPSP-PPYPPPPSRLPPP*LP---PPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*P 112
           PPSP PP P PPS  PP   P   PPPP    P P P  PPPPS  PP PP   PP    
Sbjct: 196 PPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPG 255

Query: 111 PPPPLRYPPPPPPRWPPPPPLPR 43
           PPPP   PP PPP   P PP P+
Sbjct: 256 PPPPSPAPPNPPPPPSPAPPSPK 278

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/83 (53%), Positives = 44/83 (53%), Gaps = 6/83 (7%)
 Frame = -3

Query: 276 PSPPPYPPPPSRLPPP*LPPPPPLEE*PP-PPPLYPPPPSRLPP-PPP*LPPPPE*PPPP 103
           PSPP   PP  R P P  P PPP    PP PPP  P PPS  PP PPP  P PP  P P 
Sbjct: 194 PSPPSPLPPSPRPPSPKPPSPPP----PPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPA 249

Query: 102 PLRYPPPPPPR----WPPPPPLP 46
           P   P PPPP      PPPPP P
Sbjct: 250 PPTPPGPPPPSPAPPNPPPPPSP 272

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/90 (47%), Positives = 46/90 (51%)
 Frame = -3

Query: 342 GNPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPP 163
           G P P   +  PPPPP    PPPS  PYPP P+          PPL   PPPP  YPP P
Sbjct: 455 GPPSPAPPSPPPPPPP----PPPS--PYPPSPA----------PPLPPSPPPPSPYPPSP 498

Query: 162 SRLPPPPP*LPPPPE*PPPPPLRYPPPPPP 73
           +   PP P  PP PE P P P   PPPP P
Sbjct: 499 APPVPPSP-APPSPEPPSPAPPSPPPPPSP 527

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 27/56 (48%), Positives = 29/56 (51%)
 Frame = -3

Query: 213 PPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPPPPLP 46
           P ++   P PP   PP  R P P P  PPPP  PPPP    P P PP  PPP P P
Sbjct: 187 PQVQAGTPSPPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQP 242

[189][TOP]
>UniRef100_P51968 Heterogeneous nuclear ribonucleoprotein A3 homolog 1 n=1
           Tax=Xenopus laevis RepID=RO31_XENLA
          Length = 373

 Score =  114 bits (284), Expect = 4e-24
 Identities = 58/105 (55%), Positives = 66/105 (62%), Gaps = 11/105 (10%)
 Frame = +2

Query: 23  TVNEAQSRGSGG------GGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG 184
           T +  + RG GG      GG + GG GG +  GGGGG+   GG YGGGGGR  GGGGY G
Sbjct: 201 TASAQRGRGGGGSNFMGRGGNYGGGDGGNFGRGGGGGFGNRGG-YGGGGGR--GGGGYGG 257

Query: 185 GGGGYSSRGGGGGSYGGGRREGGGGYG-----GGEGGGYGGSGGG 304
           GG GY+  GG GG+YGGG   GG GYG     G +GGGYGG GGG
Sbjct: 258 GGDGYNGFGGDGGNYGGGPGYGGRGYGGSPGYGNQGGGYGGGGGG 302

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 63/134 (47%), Positives = 67/134 (50%), Gaps = 45/134 (33%)
 Frame = +2

Query: 44  RGSGGGGGHRGG-------GGGGYRSGGGG--GYSGGGGSYGGG---GGRREG------- 166
           RG GGG G+RGG       GGGGY  GG G  G+ G GG+YGGG   GGR  G       
Sbjct: 232 RGGGGGFGNRGGYGGGGGRGGGGYGGGGDGYNGFGGDGGNYGGGPGYGGRGYGGSPGYGN 291

Query: 167 -GGGYSGGGGGY-----SSRGGGG-----GSYGG---------------GRREGGGGYGG 268
            GGGY GGGGGY     S   GGG     G+YGG               GR  GG G  G
Sbjct: 292 QGGGYGGGGGGYDGYNESGNFGGGNYNDFGNYGGQQQSNYGPMKGGSFSGRSSGGSG-SG 350

Query: 269 GEGGGYGGSGGGGG 310
             GGGYG  GGGGG
Sbjct: 351 PYGGGYGSGGGGGG 364

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 49/107 (45%), Positives = 50/107 (46%), Gaps = 28/107 (26%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGG--GYRSGG-------GGGYSGGGGSYGG-------GGGRREGGGGY 178
           G GG GG+ GGG G  G   GG       GGGY GGGG Y G       GGG     G Y
Sbjct: 264 GFGGDGGNYGGGPGYGGRGYGGSPGYGNQGGGYGGGGGGYDGYNESGNFGGGNYNDFGNY 323

Query: 179 SG----------GG--GGYSSRGGGGGSYGGGRREGGGGYGGGEGGG 283
            G          GG   G SS G G G YGGG   GGGG GGG  GG
Sbjct: 324 GGQQQSNYGPMKGGSFSGRSSGGSGSGPYGGGYGSGGGGGGGGSYGG 370

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 38/63 (60%), Positives = 38/63 (60%), Gaps = 6/63 (9%)
 Frame = +2

Query: 140 GGGGGRREG-GGGYSGGGGGYSSRGGGG-----GSYGGGRREGGGGYGGGEGGGYGGSGG 301
           GGGG    G GG Y GG GG   RGGGG     G YGGG   GGGGYGGG G GY G GG
Sbjct: 209 GGGGSNFMGRGGNYGGGDGGNFGRGGGGGFGNRGGYGGGGGRGGGGYGGG-GDGYNGFGG 267

Query: 302 GGG 310
            GG
Sbjct: 268 DGG 270

[190][TOP]
>UniRef100_UPI0000DC195F UPI0000DC195F related cluster n=1 Tax=Rattus norvegicus
           RepID=UPI0000DC195F
          Length = 434

 Score =  113 bits (283), Expect = 6e-24
 Identities = 60/94 (63%), Positives = 60/94 (63%), Gaps = 8/94 (8%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*P--PPPPLYPPPPSRLPP--PPP 139
           PPPPL P PP  PPP  PPP  LPPP L PPP L   P  PPPPL PPPP   PP  PPP
Sbjct: 302 PPPPLLPSPPLLPPPLLPPPPLLPPPPLLPPPLLPPPPLLPPPPLLPPPPLLPPPLLPPP 361

Query: 138 *LP----PPPE*PPPPPLRYPPPPPPRWPPPPPL 49
            LP    PPP  PPPPPL  PPPPP   PPPPPL
Sbjct: 362 LLPPPLLPPPLLPPPPPLLLPPPPP--LPPPPPL 393

 Score =  110 bits (276), Expect = 4e-23
 Identities = 66/127 (51%), Positives = 68/127 (53%), Gaps = 28/127 (22%)
 Frame = -3

Query: 342 GNPKPN*RNYHPPPPPLP---P*PPPS--------------PPPYPPPPSRLPPP*LPPP 214
           G P P+  +  PPPPPLP   P PPPS              PPP  P P  LPPP LPPP
Sbjct: 264 GPPGPS--SSSPPPPPLPPPLPPPPPSSSFPPLPLPLPLLPPPPLLPSPPLLPPPLLPPP 321

Query: 213 PPLEE*P-------PPPPLYPPPPSRLPPP--PP*LPPPPE*PPP--PPLRYPPPPPPRW 67
           P L   P       PPPPL PPPP   PPP  PP L PPP  PPP  PP   PPPPP   
Sbjct: 322 PLLPPPPLLPPPLLPPPPLLPPPPLLPPPPLLPPPLLPPPLLPPPLLPPPLLPPPPPLLL 381

Query: 66  PPPPPLP 46
           PPPPPLP
Sbjct: 382 PPPPPLP 388

 Score =  102 bits (253), Expect = 2e-20
 Identities = 61/110 (55%), Positives = 62/110 (56%), Gaps = 22/110 (20%)
 Frame = -3

Query: 309 PPP-----PPLPP*PPPSPPPYP----PPPSRLPPP*LPPPPPLEE*PPPP---PLYPPP 166
           PPP     PP+P  P PS PP P    PPP  LPPP LPPPPP    PP P   PL PPP
Sbjct: 246 PPPGGLPLPPMPTGPAPSGPPGPSSSSPPPPPLPPP-LPPPPPSSSFPPLPLPLPLLPPP 304

Query: 165 PSRLPPP---PP*LPPPPE*PP----PPPLRYPP---PPPPRWPPPPPLP 46
           P    PP   PP LPPPP  PP    PPPL  PP   PPPP  PPPP LP
Sbjct: 305 PLLPSPPLLPPPLLPPPPLLPPPPLLPPPLLPPPPLLPPPPLLPPPPLLP 354

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 59/108 (54%), Positives = 62/108 (57%), Gaps = 8/108 (7%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PP--PPPLYPPP---PSRLPPPP 142
           PPPPL P PP  PPP  PPP  LPPP L PPPPL   PP  PPPL PPP   P  LPPPP
Sbjct: 319 PPPPLLPPPPLLPPPLLPPPPLLPPPPLLPPPPLLP-PPLLPPPLLPPPLLPPPLLPPPP 377

Query: 141 P*-LPPPPE*PPPPPLRYPPPPPPRWP--PPPPLPRD*ASLTVMLRPS 7
           P  LPPPP  PPPPPL +   P  + P    P    +   L   LRPS
Sbjct: 378 PLLLPPPPPLPPPPPLGHAMEPGSQEPEGAEPAATGEHCLLPAGLRPS 425

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 53/108 (49%), Positives = 54/108 (50%), Gaps = 20/108 (18%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPL----YPPPPSR----- 157
           PP P   P PPP   P PP P+   P    PP P    PPPPPL     PPPPS      
Sbjct: 237 PPVPDALPPPPPGGLPLPPMPTGPAPS--GPPGPSSSSPPPPPLPPPLPPPPPSSSFPPL 294

Query: 156 -----LPPPPP*LPPPPE*P----PPPPLRYPPP--PPPRWPPPPPLP 46
                L PPPP LP PP  P    PPPPL  PPP  PPP  PPPP LP
Sbjct: 295 PLPLPLLPPPPLLPSPPLLPPPLLPPPPLLPPPPLLPPPLLPPPPLLP 342

[191][TOP]
>UniRef100_Q41187 Glycine-rich protein (Fragment) n=1 Tax=Arabidopsis thaliana
           RepID=Q41187_ARATH
          Length = 210

 Score =  113 bits (283), Expect = 6e-24
 Identities = 53/88 (60%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG-GGGYSSRGGGGG 223
           G+GGGGGH GG GGG+  G GGG   GGG+ GG GG   GGGG+ GG GGG+    GGGG
Sbjct: 67  GAGGGGGHGGGAGGGFGGGVGGGGGHGGGAGGGFGGGAGGGGGHGGGAGGGFGGGAGGGG 126

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGG 307
             GGG    GGG+GGG GGG+GG  GGG
Sbjct: 127 GQGGG---AGGGFGGGAGGGFGGGAGGG 151

 Score =  112 bits (281), Expect = 1e-23
 Identities = 55/102 (53%), Positives = 63/102 (61%), Gaps = 14/102 (13%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGY--RSGGGGGYSGG-GGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G+GGGGGH GG GGG+   +GGGGG  GG GG +GGG G   GGG   G GGG+    GG
Sbjct: 103 GAGGGGGHGGGAGGGFGGGAGGGGGQGGGAGGGFGGGAGGGFGGGAGGGAGGGFGGGAGG 162

Query: 218 GGSYGGGR-----------REGGGGYGGGEGGGYGGSGGGGG 310
           GG +GGG              GGGG+GGG GGG+GG  GGGG
Sbjct: 163 GGGHGGGAGGGAGGGFGGGAGGGGGHGGGAGGGFGGGAGGGG 204

 Score =  110 bits (274), Expect = 6e-23
 Identities = 53/95 (55%), Positives = 59/95 (62%), Gaps = 8/95 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG-GGGYSSRGGGGG 223
           G G GGGH GG GGG+  G GGG   GGG+ GG GG   GGGG+ GG GGG+    GGGG
Sbjct: 49  GGGAGGGHGGGAGGGFGGGAGGGGGHGGGAGGGFGGGVGGGGGHGGGAGGGFGGGAGGGG 108

Query: 224 SYGGGR-------REGGGGYGGGEGGGYGGSGGGG 307
            +GGG          GGGG GGG GGG+GG  GGG
Sbjct: 109 GHGGGAGGGFGGGAGGGGGQGGGAGGGFGGGAGGG 143

 Score =  109 bits (272), Expect = 1e-22
 Identities = 53/89 (59%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG-GGYSGGGGGYSSRGGGGG 223
           G G GGG  GG GGG+  G GGG+ GG G  GG GG   GG GG  GGGGG+   GG GG
Sbjct: 41  GGGAGGGFGGGAGGGHGGGAGGGFGGGAGGGGGHGGGAGGGFGGGVGGGGGHG--GGAGG 98

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            +GGG   GGGG+GGG GGG+GG  GGGG
Sbjct: 99  GFGGGAG-GGGGHGGGAGGGFGGGAGGGG 126

 Score =  108 bits (269), Expect = 2e-22
 Identities = 51/90 (56%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG--GGYSGGGGGYSSRGGGG 220
           G+G GGG  GG GGG+  G GGG   GGG  GG GG   GG  GG+ GG GG    GGG 
Sbjct: 19  GAGAGGGLGGGAGGGFGGGAGGGGGAGGGFGGGAGGGHGGGAGGGFGGGAGGGGGHGGGA 78

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G   GG   GGGG+GGG GGG+GG  GGGG
Sbjct: 79  GGGFGGGVGGGGGHGGGAGGGFGGGAGGGG 108

 Score =  107 bits (268), Expect = 3e-22
 Identities = 51/88 (57%), Positives = 54/88 (61%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGGH GG GGG+  G GGG   GGG+ GG GG   GGGG  GG GG    G GGG 
Sbjct: 85  GVGGGGGHGGGAGGGFGGGAGGGGGHGGGAGGGFGGGAGGGGGQGGGAGGGFGGGAGGGF 144

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GG     GGG+GGG GGG G  GG GG
Sbjct: 145 GGGAGGGAGGGFGGGAGGGGGHGGGAGG 172

 Score =  104 bits (260), Expect = 3e-21
 Identities = 52/91 (57%), Positives = 59/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYR--SGGGGGYSGG-GGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G+G GGG  GG GGG+   +G GGG  GG GG +GGG G   G GG  GGG G    GG 
Sbjct: 1   GAGAGGGFGGGAGGGHGGGAGAGGGLGGGAGGGFGGGAGGGGGAGGGFGGGAGGGHGGGA 60

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG +GGG   GGGG+GGG GGG+GG  GGGG
Sbjct: 61  GGGFGGGAG-GGGGHGGGAGGGFGGGVGGGG 90

 Score =  103 bits (258), Expect = 5e-21
 Identities = 53/94 (56%), Positives = 59/94 (62%), Gaps = 6/94 (6%)
 Frame = +2

Query: 47  GSGGGGGHRG--GGGGGYRSGGGGGYSGGGGSYGGGGGRREGG-GGYSGGGGGYSSRGGG 217
           G G GGG  G  GGGGG+  G GGG+ GG G  GG GG   GG GG +GGG G  + GG 
Sbjct: 93  GGGAGGGFGGGAGGGGGHGGGAGGGFGGGAGGGGGQGGGAGGGFGGGAGGGFGGGAGGGA 152

Query: 218 GGSYGGGRREG---GGGYGGGEGGGYGGSGGGGG 310
           GG +GGG   G   GGG GGG GGG+GG  GGGG
Sbjct: 153 GGGFGGGAGGGGGHGGGAGGGAGGGFGGGAGGGG 186

 Score =  101 bits (251), Expect = 3e-20
 Identities = 53/90 (58%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG-GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G G GGG  GGGG G  +GGG GG +GGGG +GGG G   GGG   GGG G    GG GG
Sbjct: 79  GGGFGGGVGGGGGHGGGAGGGFGGGAGGGGGHGGGAGGGFGGGAGGGGGQG----GGAGG 134

Query: 224 SYGGGRREG-GGGYGGGEGGGYGGSGGGGG 310
            +GGG   G GGG GGG GGG+GG  GGGG
Sbjct: 135 GFGGGAGGGFGGGAGGGAGGGFGGGAGGGG 164

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 45/85 (52%), Positives = 49/85 (57%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGG  GG GGG+  GGG G  GG G  GG GG         G GGG+    GGGG 
Sbjct: 141 GGGFGGGAGGGAGGGF--GGGAGGGGGHG--GGAGG---------GAGGGFGGGAGGGGG 187

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGG 301
           +GGG    GGG+GGG GGG GG GG
Sbjct: 188 HGGG---AGGGFGGGAGGG-GGHGG 208

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 33/54 (61%), Positives = 36/54 (66%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           G+GGGGGH GG GGG   G GGG  GGGG  GG GG   G GG +GGGGG+  R
Sbjct: 159 GAGGGGGHGGGAGGGAGGGFGGGAGGGGGHGGGAGG---GFGGGAGGGGGHGGR 209

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +2

Query: 167 GGGYSGG-GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGG+ GG GGG+    G GG  GGG    GGG+GGG GGG    G GGG+
Sbjct: 5   GGGFGGGAGGGHGGGAGAGGGLGGG---AGGGFGGGAGGG---GGAGGGF 48

[192][TOP]
>UniRef100_P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein n=2
           Tax=Zea mays RepID=GRPA_MAIZE
          Length = 157

 Score =  113 bits (283), Expect = 6e-24
 Identities = 61/95 (64%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGG--GGSYGGGGGRREGGGG 175
           +LDGR+ITVN+AQSRG GGGGG  GGG GG      GGY GG   G YGGGGG    GG 
Sbjct: 73  ELDGRNITVNQAQSRGGGGGGGGYGGGRGG------GGYGGGRRDGGYGGGGGY---GGR 123

Query: 176 YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGG 280
             GGGGGY    GGGG YGG R  GGGGYGGG GG
Sbjct: 124 REGGGGGY----GGGGGYGGRREGGGGGYGGGGGG 154

[193][TOP]
>UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus
           RepID=Q9DVW0_9BBAC
          Length = 158

 Score =  113 bits (282), Expect = 7e-24
 Identities = 54/100 (54%), Positives = 58/100 (58%), Gaps = 1/100 (1%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPP 127
           PPP  PP PPP+PPP PPP     PP  PPPPP+   P PP   P PP   PPPPP  PP
Sbjct: 50  PPPTFPPTPPPTPPPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPP--PP 107

Query: 126 PPE*PPPPPLRYPPPPPPRWPP-PPPLPRD*ASLTVMLRP 10
           PP  PP PP   PP PPP  PP PPP P   A +  + RP
Sbjct: 108 PPPPPPTPPPTPPPTPPPTPPPTPPPTPNPDAVIPPITRP 147

 Score =  110 bits (276), Expect = 4e-23
 Identities = 56/109 (51%), Positives = 58/109 (53%), Gaps = 8/109 (7%)
 Frame = -3

Query: 348 FIGNPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPP 169
           FI  PK      H P PPLPP  PP+PPP PP     PPP  PP PP    P PPP  PP
Sbjct: 19  FILKPK----TIHTPSPPLPP--PPTPPPTPPTSPATPPPTFPPTPPPTPPPTPPPTPPP 72

Query: 168 PPSRLPPPPP*LPPP--------PE*PPPPPLRYPPPPPPRWPPPPPLP 46
            P   PPPPP +P P        P  PPPPP   PPPPPP  PPP P P
Sbjct: 73  TPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTPPP 121

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/107 (51%), Positives = 58/107 (54%), Gaps = 4/107 (3%)
 Frame = -3

Query: 351 TFIGNPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYP 172
           TF   P P       PPP  PP PPP+PPP PPPP  +P P  P  PP    PPPPP  P
Sbjct: 53  TFPPTPPPT------PPPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPPQ---PPPPPPPP 103

Query: 171 PPPSRLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWPPP----PPLPR 43
           PPP   PPPPP  PPP   P PPP   PPP PP  P P    PP+ R
Sbjct: 104 PPPP--PPPPPPTPPPTPPPTPPPT--PPPTPPPTPNPDAVIPPITR 146

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 45/85 (52%), Positives = 48/85 (56%), Gaps = 3/85 (3%)
 Frame = -3

Query: 309 PPPPPLPP*P-PPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPPPP+ P P PP+ PP PPPP   PPP  PPPPP    PP PP  P PP   PP PP  
Sbjct: 78  PPPPPIIPAPSPPTAPPQPPPPPPPPPP-PPPPPP----PPTPP--PTPPPTPPPTPPPT 130

Query: 132 PPPPE*PPP--PPLRYPPPPPPRWP 64
           PPP   P    PP+  PP  PP  P
Sbjct: 131 PPPTPNPDAVIPPITRPPLRPPSLP 155

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 39/81 (48%), Positives = 42/81 (51%)
 Frame = -3

Query: 336 PKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSR 157
           P P      PPPPP PP PPP PPP PP P   PPP  PPP P    PP PP  P P + 
Sbjct: 87  PSPPTAPPQPPPPPPPP-PPPPPPPPPPTPPPTPPP-TPPPTP----PPTPPPTPNPDAV 140

Query: 156 LPPPPP*LPPPPE*PPPPPLR 94
           +PP    +  PP  PP  P R
Sbjct: 141 IPP----ITRPPLRPPSLPNR 157

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 30/56 (53%), Positives = 34/56 (60%), Gaps = 4/56 (7%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPP---PPLYPPP-PSRL 154
           PPPPP P  PPP+PPP PPP    PPP  PP P  +   PP   PPL PP  P+R+
Sbjct: 107 PPPPPPPT-PPPTPPPTPPP---TPPPTPPPTPNPDAVIPPITRPPLRPPSLPNRI 158

[194][TOP]
>UniRef100_C0Z2P2 AT2G05440 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2P2_ARATH
          Length = 137

 Score =  113 bits (282), Expect = 7e-24
 Identities = 55/90 (61%), Positives = 59/90 (65%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           Q  G GGG G  GG GGG   G GG Y GGGG YGGGGG   GGGG+ GGGGG+   GGG
Sbjct: 39  QPEGYGGGHGGHGGHGGGGGHGHGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGH--YGGG 96

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           GG +GGG   GGGG G G GGG+ G GG G
Sbjct: 97  GGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 126

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/97 (59%), Positives = 64/97 (65%), Gaps = 3/97 (3%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           +E   +  G GGGH G GG     GGGGG+ G GG YGGGGG   GGGG+ GGGGG+   
Sbjct: 34  SEETVQPEGYGGGHGGHGG----HGGGGGH-GHGGHYGGGGGHYGGGGGHYGGGGGH--Y 86

Query: 209 GGGGGSY-GGGRREGGGGYGGGEGGGYGGSGG--GGG 310
           GGGGG Y GGG   GGGG+ GG GGGYGG GG  GGG
Sbjct: 87  GGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGG 123

 Score =  101 bits (252), Expect = 2e-20
 Identities = 50/78 (64%), Positives = 52/78 (66%), Gaps = 2/78 (2%)
 Frame = +2

Query: 47  GSGGGGGHRG--GGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           G GGG GH G  GGGGG+  GGGG Y GGGG YGGGGG   GGGG  GGGG Y   GGGG
Sbjct: 54  GGGGGHGHGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYG--GGGG 111

Query: 221 GSYGGGRREGGGGYGGGE 274
           G  GGG   GGGG+G  E
Sbjct: 112 GYGGGGGHHGGGGHGLNE 129

[195][TOP]
>UniRef100_A7PDA4 Chromosome chr17 scaffold_12, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PDA4_VITVI
          Length = 277

 Score =  113 bits (282), Expect = 7e-24
 Identities = 67/107 (62%), Positives = 70/107 (65%), Gaps = 4/107 (3%)
 Frame = +2

Query: 2   DLDGRSITVN----EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG 169
           DL GR + VN     A+S G GGGGG+ GGGGGGY   GGGGY  GGG YGG GG   GG
Sbjct: 105 DLHGRRVRVNYATDRARSGGFGGGGGY-GGGGGGY---GGGGY--GGGGYGGSGG--YGG 156

Query: 170 GGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGY GG GGY   GGGG SYG     GGG YG G GGGYGGS GG G
Sbjct: 157 GGYGGGSGGY---GGGGDSYG----SGGGNYGSG-GGGYGGSSGGYG 195

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/90 (48%), Positives = 48/90 (53%), Gaps = 6/90 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGR-REGGGGYSGGGGGYSSRG---- 211
           G GG GG+   GGGGY  GG GGY GGG SYG GGG    GGGGY G  GGY S G    
Sbjct: 147 GYGGSGGY---GGGGY-GGGSGGYGGGGDSYGSGGGNYGSGGGGYGGSSGGYGSGGNFSV 202

Query: 212 -GGGGSYGGGRREGGGGYGGGEGGGYGGSG 298
            GG  +Y GG      G+  G G  +   G
Sbjct: 203 AGGSDNYVGGAAGSSSGFPSGGGSSFASGG 232

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 41/91 (45%), Positives = 42/91 (46%), Gaps = 4/91 (4%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG--GYSGGGGGYSS--R 208
           S G GGGG   G GGG Y SGGGG Y G  G YG GG     GG   Y GG  G SS   
Sbjct: 163 SGGYGGGGDSYGSGGGNYGSGGGG-YGGSSGGYGSGGNFSVAGGSDNYVGGAAGSSSGFP 221

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGG 301
            GGG S+  G   G    G  E    G   G
Sbjct: 222 SGGGSSFASG---GADQLGTNESSSVGDGAG 249

[196][TOP]
>UniRef100_A5BQ96 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BQ96_VITVI
          Length = 219

 Score =  113 bits (282), Expect = 7e-24
 Identities = 67/116 (57%), Positives = 68/116 (58%), Gaps = 27/116 (23%)
 Frame = +2

Query: 44  RGSGGGGGHRGG-GGGGYRSGGGGG-YSGGGGSYG--GGGGRREGGGGYSGGGGGYSSRG 211
           +GS GGGG RGG GGGGY  GGGGG Y GGGG YG  GGGGR  G GG  GGGGG SS G
Sbjct: 76  QGSRGGGGGRGGRGGGGYGGGGGGGGYGGGGGGYGYNGGGGRGGGRGGRGGGGGGRSSGG 135

Query: 212 GGGGSYGGGRREGGGGYGGG-------------------EGGGYGG----SGGGGG 310
            GGG YGGG   GGGG GGG                    GGG GG    SGGGGG
Sbjct: 136 YGGGGYGGGGGYGGGGGGGGGACYNCGEEGHLARDCSQSSGGGGGGGRYSSGGGGG 191

 Score =  107 bits (267), Expect = 4e-22
 Identities = 59/102 (57%), Positives = 63/102 (61%), Gaps = 1/102 (0%)
 Frame = +2

Query: 8   DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
           DGR+  V+     G+   G   GGGG G R GGG G  GGGG YGGGG    GG GY+GG
Sbjct: 59  DGRTKAVDVTGPDGNPVQGSRGGGGGRGGRGGGGYGGGGGGGGYGGGG----GGYGYNGG 114

Query: 188 GGGYSSRGGGGGSYGGGRREGG-GGYGGGEGGGYGGSGGGGG 310
           GG    RGG GG  GGGR  GG GG G G GGGYGG GGGGG
Sbjct: 115 GGRGGGRGGRGGG-GGGRSSGGYGGGGYGGGGGYGGGGGGGG 155

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 58/116 (50%), Positives = 58/116 (50%), Gaps = 29/116 (25%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRRE----GGGGYSGGGGGYSSRGG 214
           G GGGGG  GGGGGGY   GGGG  GG G  GGGGG R     GGGGY GGGGGY   GG
Sbjct: 94  GGGGGGGGYGGGGGGYGYNGGGGRGGGRGGRGGGGGGRSSGGYGGGGY-GGGGGYGGGGG 152

Query: 215 GGGSY----------------------GGGRRE---GGGGYGGGEGGGYGGSGGGG 307
           GGG                        GGGR     GGGG GGG GGG    G  G
Sbjct: 153 GGGGACYNCGEEGHLARDCSQSSGGGGGGGRYSSGGGGGGGGGGGGGGCYRCGEAG 208

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 47/89 (52%), Positives = 49/89 (55%), Gaps = 8/89 (8%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG--------GRREGGGGYSGGGGGY 199
           R SGG GG   GGGGGY  GGGGG  GGG  Y  G          +  GGG   GGGG Y
Sbjct: 131 RSSGGYGGGGYGGGGGY-GGGGGG--GGGACYNCGEEGHLARDCSQSSGGG---GGGGRY 184

Query: 200 SSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
           SS GGGGG  GGG   GGG Y  GE G +
Sbjct: 185 SSGGGGGGGGGGG---GGGCYRCGEAGHF 210

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 35/75 (46%), Positives = 38/75 (50%), Gaps = 21/75 (28%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGG------------------YRSGGGGG---YSGGGGSYGGGGGRRE 163
           G GGGGG+ GGGGGG                    SGGGGG   YS GGG  GGGGG   
Sbjct: 140 GYGGGGGYGGGGGGGGGACYNCGEEGHLARDCSQSSGGGGGGGRYSSGGG--GGGGGGGG 197

Query: 164 GGGGYSGGGGGYSSR 208
           GGG Y  G  G+ +R
Sbjct: 198 GGGCYRCGEAGHFAR 212

[197][TOP]
>UniRef100_A5B074 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5B074_VITVI
          Length = 272

 Score =  113 bits (282), Expect = 7e-24
 Identities = 67/107 (62%), Positives = 70/107 (65%), Gaps = 4/107 (3%)
 Frame = +2

Query: 2   DLDGRSITVN----EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG 169
           DL GR + VN     A+S G GGGGG+ GGGGGGY   GGGGY  GGG YGG GG   GG
Sbjct: 105 DLHGRRVRVNYATDRARSGGFGGGGGY-GGGGGGY---GGGGY--GGGGYGGSGG--YGG 156

Query: 170 GGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGY GG GGY   GGGG SYG     GGG YG G GGGYGGS GG G
Sbjct: 157 GGYGGGSGGY---GGGGDSYG----SGGGNYGSG-GGGYGGSSGGYG 195

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/90 (48%), Positives = 48/90 (53%), Gaps = 6/90 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGR-REGGGGYSGGGGGYSSRG---- 211
           G GG GG+   GGGGY  GG GGY GGG SYG GGG    GGGGY G  GGY S G    
Sbjct: 147 GYGGSGGY---GGGGY-GGGSGGYGGGGDSYGSGGGNYGSGGGGYGGSSGGYGSGGNFSV 202

Query: 212 -GGGGSYGGGRREGGGGYGGGEGGGYGGSG 298
            GG  +Y GG      G+  G G  +   G
Sbjct: 203 AGGSDNYVGGAAGSSSGFPSGGGSSFASGG 232

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/70 (51%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG--GYSGGGGGYSS--R 208
           S G GGGG   G GGG Y SGGGG Y G  G YG GG     GG   Y GG  G SS   
Sbjct: 163 SGGYGGGGDSYGSGGGNYGSGGGG-YGGSSGGYGSGGNFSVAGGSDNYVGGAAGSSSGFP 221

Query: 209 GGGGGSYGGG 238
            GGG S+  G
Sbjct: 222 SGGGSSFASG 231

[198][TOP]
>UniRef100_Q5CLM1 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis
            RepID=Q5CLM1_CRYHO
          Length = 2646

 Score =  113 bits (282), Expect = 7e-24
 Identities = 59/131 (45%), Positives = 67/131 (51%), Gaps = 25/131 (19%)
 Frame = -3

Query: 363  ARERTFIGNPKPN*RNYHPPPPPLPP*PP--PSPPPYPPPPSRLPPP*-LPPPPPLEE*P 193
            A   +  G P P   ++ PPPPP+PP P   P PPP PPPPS  PPP  +P  PPL    
Sbjct: 2133 AEVSSIAGTPIPTPPSFSPPPPPIPPPPSFSPPPPPIPPPPSSPPPPPPVPEYPPLSSAI 2192

Query: 192  PPPPLYPPPPSRLPPPPP*LPPPPE----------------*PPPPPLRYPPP------P 79
            PPPP + PPP  +PPPPP +P PP                  PPPP   YPPP      P
Sbjct: 2193 PPPPSFSPPPPPIPPPPPPIPSPPSPIPSSPSPIPSPPSSPPPPPPKPEYPPPSSPIPSP 2252

Query: 78   PPRWPPPPPLP 46
            P   PPPPP P
Sbjct: 2253 PSSPPPPPPKP 2263

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/101 (50%), Positives = 55/101 (54%), Gaps = 12/101 (11%)
 Frame = -3

Query: 318  NYHPPPPPLPP*PPPSP-PPYP----PPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRL 154
            ++ PPPPP+PP PPP P PP P    P P   PP   PPPPP  E PPP    P PPS  
Sbjct: 2197 SFSPPPPPIPPPPPPIPSPPSPIPSSPSPIPSPPSSPPPPPPKPEYPPPSSPIPSPPSSP 2256

Query: 153  PPPPP*LPPPPE*PPP-------PPLRYPPPPPPRWPPPPP 52
            PPP    PP PE PPP       PP   P PP P +PP PP
Sbjct: 2257 PPP----PPKPEYPPPSSPIPTLPPSSPPTPPMPAFPPSPP 2293

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 46/100 (46%), Positives = 52/100 (52%), Gaps = 2/100 (2%)
 Frame = -3

Query: 339  NPKPN*RNYHPPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPS 160
            +P P+  +  P PP  PP PPP  P YPPP S +P P   PPP     PPP P YPPP S
Sbjct: 2217 SPIPSSPSPIPSPPSSPP-PPPPKPEYPPPSSPIPSPPSSPPP-----PPPKPEYPPPSS 2270

Query: 159  RLPPPPP*LPPPPE*PPPPPLRYPPPPPPRWP--PPPPLP 46
             +P  PP  P     P PP   +PP PPP  P  P P  P
Sbjct: 2271 PIPTLPPSSP-----PTPPMPAFPPSPPPTTPGVPSPTFP 2305

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 41/84 (48%), Positives = 43/84 (51%), Gaps = 9/84 (10%)
 Frame = -3

Query: 336  PKPN*RNYHPP------PPPLPP*PPPSPPPYPPPPSRLP--PP*LPPPPPLEE*PP-PP 184
            PKP    Y PP      PP  PP PPP  P YPPP S +P  PP  PP PP+   PP PP
Sbjct: 2238 PKPE---YPPPSSPIPSPPSSPP-PPPPKPEYPPPSSPIPTLPPSSPPTPPMPAFPPSPP 2293

Query: 183  PLYPPPPSRLPPPPP*LPPPPE*P 112
            P  P  PS  P  P  L P PE P
Sbjct: 2294 PTTPGVPS--PTFPSQLSPIPEAP 2315

[199][TOP]
>UniRef100_P10496 Glycine-rich cell wall structural protein 1.8 n=1 Tax=Phaseolus
           vulgaris RepID=GRP2_PHAVU
          Length = 465

 Score =  113 bits (282), Expect = 7e-24
 Identities = 56/90 (62%), Positives = 61/90 (67%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           G GGGGG   GGGGGY +GG  GGGY  GGG+ GGGGG  + GGGY   GGG  + GG G
Sbjct: 140 GYGGGGGSGAGGGGGYNAGGAQGGGYGTGGGAGGGGGGGGDHGGGY---GGGQGAGGGAG 196

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G YGGG   GGGG GGG+GGG GG  G GG
Sbjct: 197 GGYGGGGEHGGGG-GGGQGGGAGGGYGAGG 225

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/107 (55%), Positives = 61/107 (57%), Gaps = 19/107 (17%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG--GGGYSGG---------------GGSYGGGGGRREGGGG 175
           G GGGGG  GG GGGY + G  GGGY GG               GG YGGG G   GGG 
Sbjct: 316 GGGGGGGQGGGAGGGYAAVGEHGGGYGGGQGGGDGGGYGTGGEHGGGYGGGQGGGAGGGY 375

Query: 176 YSGG--GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            +GG  GGGY    GGGG YG G   G  GYGGGEGGG GGSGGG G
Sbjct: 376 GTGGEHGGGYGGGQGGGGGYGAGGDHGAAGYGGGEGGG-GGSGGGYG 421

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/101 (58%), Positives = 60/101 (59%), Gaps = 13/101 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG--GGGY---SGGGGSYGGGG-------GRREGGGGYSGGG 190
           G G GGG  GG GGGY +GG  GGGY    GGGG YG GG       G  EGGGG  G G
Sbjct: 360 GGGYGGGQGGGAGGGYGTGGEHGGGYGGGQGGGGGYGAGGDHGAAGYGGGEGGGG--GSG 417

Query: 191 GGYSSRGGGGGSYGGGRREGGG-GYGGGEGGGYGGSGGGGG 310
           GGY   G  GG YGGG   GGG G GG  GGGYGG GG GG
Sbjct: 418 GGYGDGGAHGGGYGGGAGGGGGYGAGGAHGGGYGGGGGIGG 458

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/102 (56%), Positives = 62/102 (60%), Gaps = 11/102 (10%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGG-----GGGGYRSGGGGGYSGG-GGSYGGGG----GRREGGGGYSGG 187
           Q  G GGGGG  GG     GGGG R G GGG  GG GG YG GG    G   GGG  +GG
Sbjct: 92  QGAGYGGGGGSGGGGGVAYGGGGERGGYGGGQGGGAGGGYGAGGEHGIGYGGGGGSGAGG 151

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGGGE-GGGYGGSGGGGG 310
           GGGY++ G  GG YG G   GGGG GGG+ GGGYGG  G GG
Sbjct: 152 GGGYNAGGAQGGGYGTGGGAGGGGGGGGDHGGGYGGGQGAGG 193

 Score =  105 bits (262), Expect = 2e-21
 Identities = 59/100 (59%), Positives = 62/100 (62%), Gaps = 12/100 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRR----EGGGGYSGG-----GGGY 199
           G G GGG  GG GGGY +GG  G  GGGG  GG GG      E GGGY GG     GGGY
Sbjct: 294 GGGAGGGQGGGAGGGYGAGGEHGGGGGGGQGGGAGGGYAAVGEHGGGYGGGQGGGDGGGY 353

Query: 200 SSRGGGGGSYGGGRREG-GGGYG-GGE-GGGYGGSGGGGG 310
            + G  GG YGGG+  G GGGYG GGE GGGYGG  GGGG
Sbjct: 354 GTGGEHGGGYGGGQGGGAGGGYGTGGEHGGGYGGGQGGGG 393

 Score =  105 bits (261), Expect = 2e-21
 Identities = 58/99 (58%), Positives = 60/99 (60%), Gaps = 14/99 (14%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGYSGGGG---SYGGGGGRREGGGG-YSGGG---GGYSSRGG 214
           GGGG RGG GGG   G GGGY  GG     YGGGGG   GGGG Y+ GG   GGY + GG
Sbjct: 111 GGGGERGGYGGGQGGGAGGGYGAGGEHGIGYGGGGGSGAGGGGGYNAGGAQGGGYGTGGG 170

Query: 215 GGGSYGGGRREGGG-----GYGGGEGGGYGGSG--GGGG 310
            GG  GGG   GGG     G GGG GGGYGG G  GGGG
Sbjct: 171 AGGGGGGGGDHGGGYGGGQGAGGGAGGGYGGGGEHGGGG 209

 Score =  105 bits (261), Expect = 2e-21
 Identities = 54/101 (53%), Positives = 59/101 (58%), Gaps = 13/101 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG--GGGYSGG-----------GGSYGGGGGRREGGGGYSGG 187
           G G GGG  GG GGGY +GG  GGGY GG           GG +GGG G  +GGGG  G 
Sbjct: 338 GGGYGGGQGGGDGGGYGTGGEHGGGYGGGQGGGAGGGYGTGGEHGGGYGGGQGGGGGYGA 397

Query: 188 GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG + + G GGG  GGG   GG G GG  GGGYGG  GGGG
Sbjct: 398 GGDHGAAGYGGGEGGGGGSGGGYGDGGAHGGGYGGGAGGGG 438

 Score =  104 bits (260), Expect = 3e-21
 Identities = 55/100 (55%), Positives = 58/100 (58%), Gaps = 12/100 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG-GGYSGGGGSYGGGGGRREGG--------GGYSGGGGGY 199
           G GGGG H GG GGG  +GGG GG  GGGG +GGGGG  +GG        GG  GGG G 
Sbjct: 174 GGGGGGDHGGGYGGGQGAGGGAGGGYGGGGEHGGGGGGGQGGGAGGGYGAGGEHGGGAGG 233

Query: 200 SSRGGGGGSYGGGRREG---GGGYGGGEGGGYGGSGGGGG 310
              GG GG YG G   G   GGG GGG GGGYG  G  GG
Sbjct: 234 GQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGG 273

 Score =  104 bits (259), Expect = 3e-21
 Identities = 55/95 (57%), Positives = 62/95 (65%), Gaps = 8/95 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGG--GGGYRSGGG-GGYSGGGGSYGGGGGRREGGGGYSGG--GGGYSSRG 211
           G+GGGGG+  GG  GGGY +GGG GG  GGGG +GGG G  +G GG +GG  GGG    G
Sbjct: 148 GAGGGGGYNAGGAQGGGYGTGGGAGGGGGGGGDHGGGYGGGQGAGGGAGGGYGGGGEHGG 207

Query: 212 GGGGSYGGGRREG---GGGYGGGEGGGYGGSGGGG 307
           GGGG  GGG   G   GG +GGG GGG GG  GGG
Sbjct: 208 GGGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGG 242

 Score =  103 bits (258), Expect = 5e-21
 Identities = 59/99 (59%), Positives = 63/99 (63%), Gaps = 12/99 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG------GGGYSGG-GGSYGGGGGRREGGGGYSGGG--GGY 199
           G G GGG  GG GGGY +GG      GGG  GG GG YG GG    GGGG  GGG  GGY
Sbjct: 272 GGGAGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGGGGGQGGGAGGGY 331

Query: 200 SSRGGGGGSYGGGRREG-GGGYG-GGE-GGGYGGSGGGG 307
           ++ G  GG YGGG+  G GGGYG GGE GGGYGG  GGG
Sbjct: 332 AAVGEHGGGYGGGQGGGDGGGYGTGGEHGGGYGGGQGGG 370

 Score =  103 bits (257), Expect = 6e-21
 Identities = 62/119 (52%), Positives = 69/119 (57%), Gaps = 22/119 (18%)
 Frame = +2

Query: 20  ITVNEAQSRGSGGGGGHRG-----GGGGGYRSGGGGGYSGGGG--SYGGGGGRREGGG-G 175
           +T++     G G GGG+ G     GGGGG  SGGGGGY+G  G   YGGG G  +GGG G
Sbjct: 28  LTLDAGYGLGHGTGGGYGGAAGSYGGGGGGGSGGGGGYAGEHGVVGYGGGSGGGQGGGVG 87

Query: 176 YSGG-----GGGYSSRGGGGGSYGGGRREG--GGGYGGGEGGGYG-------GSGGGGG 310
           Y G      GGG  S GGGG +YGGG   G  GGG GGG GGGYG       G GGGGG
Sbjct: 88  YGGDQGAGYGGGGGSGGGGGVAYGGGGERGGYGGGQGGGAGGGYGAGGEHGIGYGGGGG 146

 Score =  102 bits (255), Expect = 1e-20
 Identities = 52/99 (52%), Positives = 55/99 (55%), Gaps = 11/99 (11%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG--------GGYSGGGGGYS 202
           G  GGGG  GGGGGG + GG GG  G GG +GGG G  +GG        GG  GGG G  
Sbjct: 197 GGYGGGGEHGGGGGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGAGGG 256

Query: 203 SRGGGGGSYGGGRREG---GGGYGGGEGGGYGGSGGGGG 310
             GG GG YG G   G   GGG GGG GGGYG  G  GG
Sbjct: 257 QGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGG 295

 Score =  102 bits (254), Expect = 1e-20
 Identities = 53/101 (52%), Positives = 58/101 (57%), Gaps = 10/101 (9%)
 Frame = +2

Query: 38  QSRGSGGG---GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           Q  G+GGG   GG  GGG GG + GG GG  G GG +GGG G  +GGG   G G G    
Sbjct: 257 QGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHG 316

Query: 209 GGGGGSYGGGRREG-------GGGYGGGEGGGYGGSGGGGG 310
           GGGGG  GGG   G       GGGYGGG+GGG GG  G GG
Sbjct: 317 GGGGGGQGGGAGGGYAAVGEHGGGYGGGQGGGDGGGYGTGG 357

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/112 (49%), Positives = 56/112 (50%), Gaps = 23/112 (20%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGG-------GSYGGGGGRREGGGGYSGGGGGYSS 205
           G GGGG H GGGGGG   G GGGY  GG       G  GGG G   G GG  GGG G   
Sbjct: 198 GYGGGGEHGGGGGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGAGGGQ 257

Query: 206 RGGGGGSYGGGRREGGG---GYGGGEGGGYG-------------GSGGGGGW 313
            GG GG YG G   GGG   G GGG GGGYG             G G GGG+
Sbjct: 258 GGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGY 309

 Score =  100 bits (249), Expect = 5e-20
 Identities = 52/91 (57%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G+GGG G  GGGGG +    GGGY GG G+ GGG G   GGGG  GGGGG    GG GG 
Sbjct: 166 GTGGGAGGGGGGGGDH----GGGYGGGQGA-GGGAGGGYGGGGEHGGGGGGGQGGGAGGG 220

Query: 227 YGGGRREG---GGGYGGGEGGGYGGSGGGGG 310
           YG G   G   GGG GGG GGGYG  G  GG
Sbjct: 221 YGAGGEHGGGAGGGQGGGAGGGYGAGGEHGG 251

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 61/110 (55%), Positives = 65/110 (59%), Gaps = 17/110 (15%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRS--------GGGGGYSGGGGSYGGGGGRREGGGGYSGGG 190
           A S G GGGGG   GGGGGY          GG GG  GGG  YGG  G   GGGG SGGG
Sbjct: 48  AGSYGGGGGGG--SGGGGGYAGEHGVVGYGGGSGGGQGGGVGYGGDQGAGYGGGGGSGGG 105

Query: 191 GGYSSRGGG-GGSYGGGRREG-GGGYG-GGE------GGGYGGSGGGGGW 313
           GG +  GGG  G YGGG+  G GGGYG GGE      GGG  G+GGGGG+
Sbjct: 106 GGVAYGGGGERGGYGGGQGGGAGGGYGAGGEHGIGYGGGGGSGAGGGGGY 155

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 57/98 (58%), Positives = 62/98 (63%), Gaps = 10/98 (10%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGG-SYGGGGGRREGGGGYSGG-GGGYSSRGGGG 220
           G GGG G+ G  G GY  GGGGG  GGGG +YGGGG R   GGG  GG GGGY + G  G
Sbjct: 81  GQGGGVGYGGDQGAGY--GGGGGSGGGGGVAYGGGGERGGYGGGQGGGAGGGYGAGGEHG 138

Query: 221 GSYGGGRRE---GGGGY--GGGEGGGY---GGSGGGGG 310
             YGGG      GGGGY  GG +GGGY   GG+GGGGG
Sbjct: 139 IGYGGGGGSGAGGGGGYNAGGAQGGGYGTGGGAGGGGG 176

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 55/116 (47%), Positives = 59/116 (50%), Gaps = 25/116 (21%)
 Frame = +2

Query: 38  QSRGSGGG---GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG--------GYSG 184
           Q  G+GGG   GG  GGG GG + GG GG  G GG +GGG G  +GGG        G  G
Sbjct: 213 QGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHG 272

Query: 185 GGGGYSSRGGGGGSYGGGRREGGG---GYGGGEGGGYG-----------GSGGGGG 310
           GG G    GG GG YG G   GGG   G GGG GGGYG           G GGG G
Sbjct: 273 GGAGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGGGGGQGGGAG 328

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 50/96 (52%), Positives = 55/96 (57%), Gaps = 6/96 (6%)
 Frame = +2

Query: 38  QSRGSGGG---GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           Q  G+GGG   GG  GGG GG + GG GG  G GG +GGG G  +GGG   G G G    
Sbjct: 235 QGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHG 294

Query: 209 GGGGGSYGGGRREG---GGGYGGGEGGGYGGSGGGG 307
           GG GG  GGG   G   GG +GGG GGG GG  GGG
Sbjct: 295 GGAGGGQGGGAGGGYGAGGEHGGGGGGGQGGGAGGG 330

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 56/117 (47%), Positives = 59/117 (50%), Gaps = 29/117 (24%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG----GGGYS---------GGGGSYGGGGGRREGG------ 169
           G GGGGG  GG GGGY +GG    G G           G GG +GGG G  +GG      
Sbjct: 206 GGGGGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGY 265

Query: 170 --GGYSGGGGGYSSRGGGGGSYGGGRREG---GGGYGGGEGGGYG-----GSGGGGG 310
             GG  GGG G    GG GG YG G   G   GGG GGG GGGYG     G GGGGG
Sbjct: 266 GAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGAGGGQGGGAGGGYGAGGEHGGGGGGG 322

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 52/91 (57%), Positives = 58/91 (63%), Gaps = 8/91 (8%)
 Frame = +2

Query: 47  GSGG--GGGHRGG--GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG---GGGYSS 205
           G+GG  GGG+ GG  GGGGY +GG  G +G GG  GGGGG    GGGY  G   GGGY  
Sbjct: 376 GTGGEHGGGYGGGQGGGGGYGAGGDHGAAGYGGGEGGGGG---SGGGYGDGGAHGGGYGG 432

Query: 206 RGGGGGSYGGGRREGGG-GYGGGEGGGYGGS 295
             GGGG YG G   GGG G GGG GGG+GG+
Sbjct: 433 GAGGGGGYGAGGAHGGGYGGGGGIGGGHGGN 463

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 32/56 (57%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSG-GGGGYSGGGGSYGGGGGRREGGGGYSGGGGG 196
           E    GSGGG G  G  GGGY  G GGGG  G GG++GGG G   GGGG  GG GG
Sbjct: 410 EGGGGGSGGGYGDGGAHGGGYGGGAGGGGGYGAGGAHGGGYG---GGGGIGGGHGG 462

[200][TOP]
>UniRef100_A0NYD4 Cold shock protein n=1 Tax=Labrenzia aggregata IAM 12614
           RepID=A0NYD4_9RHOB
          Length = 286

 Score =  112 bits (281), Expect = 1e-23
 Identities = 61/98 (62%), Positives = 62/98 (63%), Gaps = 8/98 (8%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG-------GGGYS 202
           RG  GGGG RGG GGG    GGGGY GGGG  G GGG REGGG   GG       GGGY 
Sbjct: 74  RGGYGGGGGRGGYGGGGDREGGGGYGGGGGRGGYGGGGREGGGYGGGGREGGGREGGGYG 133

Query: 203 SRGGGGGSYGGGRREGGG-GYGGGEGGGYGGSGGGGGW 313
             GG  G YGG  REGGG G GG EGGGYGG GG GG+
Sbjct: 134 G-GGSRGGYGGAPREGGGYGGGGREGGGYGGGGGRGGY 170

 Score =  108 bits (269), Expect = 2e-22
 Identities = 65/119 (54%), Positives = 66/119 (55%), Gaps = 31/119 (26%)
 Frame = +2

Query: 47  GSGGGGGHRGGG----GGGYR---------SGGGGGYSGGGGSYG-GGGGRREGGGGYSG 184
           G G  GG+RGG     GGGY           GG GGY GGGG  G GGGG REGGGGY G
Sbjct: 41  GGGRDGGYRGGRDNDFGGGYGRDDNKEGGYGGGRGGYGGGGGRGGYGGGGDREGGGGYGG 100

Query: 185 GGG--GYSSRGGGGGSYGGGRREGGG----GYGGG-----------EGGGYGGSGGGGG 310
           GGG  GY   G  GG YGGG REGGG    GYGGG           EGGGYGG G  GG
Sbjct: 101 GGGRGGYGGGGREGGGYGGGGREGGGREGGGYGGGGSRGGYGGAPREGGGYGGGGREGG 159

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/95 (57%), Positives = 58/95 (61%), Gaps = 2/95 (2%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG--GGYSS 205
           + +  G  GGGG RGG GGG R GGG    GGGG  GGG   RE GGGY GGG  GGY  
Sbjct: 91  DREGGGGYGGGGGRGGYGGGGREGGG---YGGGGREGGG---RE-GGGYGGGGSRGGYGG 143

Query: 206 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
               GG YGGG REGGG  GGG  GGYGG+   GG
Sbjct: 144 APREGGGYGGGGREGGGYGGGGGRGGYGGAPREGG 178

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 56/111 (50%), Positives = 61/111 (54%), Gaps = 17/111 (15%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGG-------------GGGGYRSGGGGGYSGG-GGSYGGGGGRREG 166
           ++ +SRG  GG    GG             GG  Y  G  GGY GG    +GGG GR + 
Sbjct: 6   SDRRSRGRRGGKREFGGPQDFGSDFGGNEFGGDFYGGGRDGGYRGGRDNDFGGGYGRDDN 65

Query: 167 G-GGYSGGGGGYSSRGGGGGSY-GGGRREGGGGYGGGEG-GGYGGSGGGGG 310
             GGY GG GGY   GGG G Y GGG REGGGGYGGG G GGYGG G  GG
Sbjct: 66  KEGGYGGGRGGYGG-GGGRGGYGGGGDREGGGGYGGGGGRGGYGGGGREGG 115

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 47/108 (43%), Positives = 50/108 (46%), Gaps = 14/108 (12%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG-----GGG 196
           ++  R  G  GG R  GG        GG   GG  YGGG       GGY GG     GGG
Sbjct: 5   DSDRRSRGRRGGKREFGGPQDFGSDFGGNEFGGDFYGGGRD-----GGYRGGRDNDFGGG 59

Query: 197 YSSRGGGGGSYGGGRR-----EGGGGYGGG----EGGGYGGSGGGGGW 313
           Y       G YGGGR       G GGYGGG     GGGYGG GG GG+
Sbjct: 60  YGRDDNKEGGYGGGRGGYGGGGGRGGYGGGGDREGGGGYGGGGGRGGY 107

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/81 (54%), Positives = 46/81 (56%), Gaps = 4/81 (4%)
 Frame = +2

Query: 32  EAQSRGSGG--GGGHRGGG--GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 199
           E    G GG  GGG  GGG  GGG R G GG    GGG YGGGG  RE GGGY GGGG  
Sbjct: 113 EGGGYGGGGREGGGREGGGYGGGGSRGGYGGAPREGGG-YGGGG--RE-GGGYGGGGG-- 166

Query: 200 SSRGGGGGSYGGGRREGGGGY 262
             RGG GG+   G  EG  G+
Sbjct: 167 --RGGYGGAPREGGSEGDSGF 185

[201][TOP]
>UniRef100_O65514 Putative glycine-rich cell wall protein n=1 Tax=Arabidopsis
           thaliana RepID=O65514_ARATH
          Length = 221

 Score =  112 bits (281), Expect = 1e-23
 Identities = 62/110 (56%), Positives = 65/110 (59%), Gaps = 14/110 (12%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGG----------SYGGGGGRREGGGGYS 181
           E+++ G GGGGG  GGGGGG  SGGGGG   GG           S GGGGG   GGGG S
Sbjct: 85  ESRAGGGGGGGGGGGGGGGGQGSGGGGGEGNGGNGKDNSHKRNKSSGGGGGGGGGGGGGS 144

Query: 182 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG----GGGW*F 319
           G G G    GGGGG  GGG   GGGG GGG GGG GG GG    GGGW F
Sbjct: 145 GNGSGRGRGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGSDGKGGGWGF 191

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/92 (55%), Positives = 56/92 (60%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           +++ SGGGGG  GGGGGG  +G G G  GGGG  GGGGG   GGGG  GGGGG    GGG
Sbjct: 126 RNKSSGGGGGGGGGGGGGSGNGSGRGRGGGGGGGGGGGG---GGGGGGGGGGG---GGGG 179

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGS G G   GG G+G G GG   G   G  W
Sbjct: 180 GGSDGKG---GGWGFGFGWGGDGPGGNFGRCW 208

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/83 (55%), Positives = 49/83 (59%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           N++   G GGGGG  GG G G   G GGG  GGGG  GGGGG   GGGG  GGGGG  S 
Sbjct: 127 NKSSGGGGGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGG---GGGGGGGGGGGGGSD 183

Query: 209 GGGGGSYGGGRREGGGGYGGGEG 277
           G GGG +G G   GG G GG  G
Sbjct: 184 GKGGG-WGFGFGWGGDGPGGNFG 205

[202][TOP]
>UniRef100_A9NJZ7 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NJZ7_PICSI
          Length = 126

 Score =  112 bits (281), Expect = 1e-23
 Identities = 55/88 (62%), Positives = 57/88 (64%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGG  R GGGGG  GGGG +  GGG   GGGG   GGGG     GG GS
Sbjct: 25  GGGGGGGPGGGGGGPGRGGGGGGPGGGGGGFFSGGGPGFGGGGGGPGGGGGGGAHGGPGS 84

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG  +GGGG GG  GGG GG GGGGG
Sbjct: 85  GGGGGGQGGGGQGGRGGGGGGGRGGGGG 112

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/88 (63%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGG  RGGGGGG   GGGG +SGGG  +GGGGG   GGGG  G  GG  S GGGGG 
Sbjct: 33  GGGGGGPGRGGGGGGPGGGGGGFFSGGGPGFGGGGGGPGGGGG-GGAHGGPGSGGGGGGQ 91

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG+   GGG GGG GGG GG G GGG
Sbjct: 92  GGGGQGGRGGGGGGGRGGGGGGRGFGGG 119

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/88 (62%), Positives = 58/88 (65%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG+ SGGG G+ GGGG  GGGGG    GG  SGGGGG    GG GG 
Sbjct: 40  GRGGGGGGPGGGGGGFFSGGGPGFGGGGGGPGGGGGGGAHGGPGSGGGGGGQGGGGQGGR 99

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGG  GGG G G+GG GGG G
Sbjct: 100 GGGG---GGGRGGGGGGRGFGGGGGGHG 124

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 41/64 (64%), Positives = 42/64 (65%), Gaps = 1/64 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGG-GGRREGGGGYSGGGGGYSSRGGGGG 223
           G GGGGG  GGGGGG   GG G   GGGG  GGG GGR  GGGG  GGGGG    GGGGG
Sbjct: 62  GFGGGGGGPGGGGGGGAHGGPGSGGGGGGQGGGGQGGRGGGGGGGRGGGGGGRGFGGGGG 121

Query: 224 SYGG 235
            +GG
Sbjct: 122 GHGG 125

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 38/63 (60%), Positives = 39/63 (61%), Gaps = 2/63 (3%)
 Frame = +2

Query: 131 GSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGG--SGGG 304
           G  GGGGG   GGGG  GGG G    GGGGG  GGG   G GG GGG GGG GG  SGGG
Sbjct: 3   GRGGGGGGPGGGGGGAGGGGPG--GGGGGGGPGGGGGGPGRGGGGGGPGGGGGGFFSGGG 60

Query: 305 GGW 313
            G+
Sbjct: 61  PGF 63

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 33/54 (61%), Positives = 36/54 (66%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           GSGGGGG +GGGG G   G GGG  GGGG  GGGGGR     G+ GGGGG+  R
Sbjct: 83  GSGGGGGGQGGGGQG---GRGGG--GGGGRGGGGGGR-----GFGGGGGGHGGR 126

[203][TOP]
>UniRef100_A5C837 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5C837_VITVI
          Length = 188

 Score =  112 bits (281), Expect = 1e-23
 Identities = 58/111 (52%), Positives = 68/111 (61%), Gaps = 9/111 (8%)
 Frame = +2

Query: 8   DGRSITVNEAQSRGSGGGGGHRGGGG--GGYRSG--GGGGYSGGGGSYGGGGGRREGGGG 175
           + R +  +     G GGGGG  GGGG  GG+  G  GGGG+ GG G  GG GG + GGGG
Sbjct: 24  EARKLEKDSFSGGGLGGGGGFGGGGGAGGGFGGGKGGGGGFGGGKGGGGGFGGGKGGGGG 83

Query: 176 YSGG-----GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           + GG     GGG  S GG GG +GGG+  GGGG+GGG GGG GG  GGG W
Sbjct: 84  FGGGSGGGFGGGGGSGGGAGGGFGGGKG-GGGGFGGGAGGGAGGGFGGGSW 133

 Score =  105 bits (261), Expect = 2e-21
 Identities = 58/113 (51%), Positives = 65/113 (57%), Gaps = 25/113 (22%)
 Frame = +2

Query: 47  GSGGGGGHRGG--GGGGYRSGGGGGYSGGGGSYGGGGGR----REGGGGYSGGGGGYSSR 208
           G GGGGG  GG  GGGG+  G GGG+ GGGGS GG GG     + GGGG+ GG GG +  
Sbjct: 67  GKGGGGGFGGGKGGGGGFGGGSGGGFGGGGGSGGGAGGGFGGGKGGGGGFGGGAGGGAGG 126

Query: 209 GGGGGSY-------------------GGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G GGGS+                   GGG R GGGG GGG GGG+GG  GGGG
Sbjct: 127 GFGGGSWCWRGFWRWIRWGLEGFGGAGGGFR-GGGGSGGGIGGGHGGGAGGGG 178

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 49/112 (43%), Positives = 55/112 (49%), Gaps = 32/112 (28%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG---------GGYSGGGGSYGGGGGRREGGG--------- 172
           G GGGGG  GG GGG+  GGG         GG  GGGG +GGG G   GGG         
Sbjct: 77  GKGGGGGFGGGSGGGFGGGGGSGGGAGGGFGGGKGGGGGFGGGAGGGAGGGFGGGSWCWR 136

Query: 173 -----------GYSGGGGGYSSRGGGGGSYGGGR---REGGGGYGGGEGGGY 286
                      G+ G GGG+   GG GG  GGG      GGGG+GGG GGG+
Sbjct: 137 GFWRWIRWGLEGFGGAGGGFRGGGGSGGGIGGGHGGGAGGGGGFGGGSGGGF 188

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 50/105 (47%), Positives = 53/105 (50%), Gaps = 16/105 (15%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG---------------- 172
           S G  GGGG  GGG GG   GG GG  G GG  GGG G   GGG                
Sbjct: 88  SGGGFGGGGGSGGGAGGGFGGGKGGGGGFGGGAGGGAGGGFGGGSWCWRGFWRWIRWGLE 147

Query: 173 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G+ G GGG+   GG GG  GGG    GGG GG  GGG+GG  GGG
Sbjct: 148 GFGGAGGGFRGGGGSGGGIGGGH---GGGAGG--GGGFGGGSGGG 187

[204][TOP]
>UniRef100_B7PYQ7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PYQ7_IXOSC
          Length = 209

 Score =  112 bits (281), Expect = 1e-23
 Identities = 61/90 (67%), Positives = 61/90 (67%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           SRG  GGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGG
Sbjct: 132 SRGKAGGGGGGGGGGGGGGGGGGGGGGGGGG--GGGGG---GGGGGGGGGGG----GGGG 182

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 183 GGGGGG---GGGGGGGGGGGGGGGGGGGGG 209

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 33/49 (67%), Positives = 33/49 (67%)
 Frame = +2

Query: 101 GGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRRE 247
           GGGGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG  GGG RE
Sbjct: 1   GGGGGGGGGGGGGGGGGG---GGGGGGGGGGG----GGGGGGGGGGGRE 42

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 32/46 (69%), Positives = 32/46 (69%)
 Frame = +2

Query: 56  GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGG 193
           GGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGG
Sbjct: 1   GGGGGGGGGGGG---GGGGGGGGGGGGGGGGGG---GGGGGGGGGG 40

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 34/49 (69%), Positives = 34/49 (69%)
 Frame = +2

Query: 164 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGG  GGGGG    GGGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 1   GGGGGGGGGGG----GGGGG--GGG---GGGGGGGGGGGGGGGGGGGGG 40

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 30/43 (69%), Positives = 30/43 (69%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG 175
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GGGG
Sbjct: 1   GGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 29/44 (65%), Positives = 29/44 (65%)
 Frame = +2

Query: 77  GGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           GGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG   R
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGREIR 44

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 28/39 (71%), Positives = 28/39 (71%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRRE 163
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG RE
Sbjct: 4   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRE 42

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/55 (61%), Positives = 34/55 (61%)
 Frame = +2

Query: 140 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 304
           GGGGG   GGGG  GGGGG    GGGGG        GGGG GGG GGG GG GGG
Sbjct: 1   GGGGG---GGGGGGGGGGG----GGGGG--------GGGGGGGGGGGGGGGGGGG 40

[205][TOP]
>UniRef100_B4JKF1 GH12063 n=1 Tax=Drosophila grimshawi RepID=B4JKF1_DROGR
          Length = 143

 Score =  112 bits (281), Expect = 1e-23
 Identities = 59/108 (54%), Positives = 63/108 (58%), Gaps = 20/108 (18%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG--YSSRGGGG 220
           G G GGG+ GGGGGGY  GGG G   GGG  GG GG ++GGGG  GGGGG  +   GGGG
Sbjct: 24  GGGSGGGYGGGGGGGYGGGGGHGGGAGGGKGGGHGGWQKGGGGGGGGGGGGGWQKGGGGG 83

Query: 221 GSYGGG----------------RREGGGGY--GGGEGGGYGGSGGGGG 310
           G YGGG                   GGGG   GGG GGGYGG GGGGG
Sbjct: 84  GGYGGGGGRSLAGNRGSSASWQGSNGGGGKHGGGGGGGGYGGGGGGGG 131

 Score =  102 bits (254), Expect = 1e-20
 Identities = 57/108 (52%), Positives = 61/108 (56%), Gaps = 19/108 (17%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGG--------YRSGGGGGYSGGGGSY---GGGGGRREGGGGYS---- 181
           G GGGGGH GG GGG         + GGGGG  GGGG +   GGGGG   GGGG S    
Sbjct: 38  GYGGGGGHGGGAGGGKGGGHGGWQKGGGGGGGGGGGGGWQKGGGGGGGYGGGGGRSLAGN 97

Query: 182 -GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG---YGGSGGGGGW 313
            G    +    GGGG +GGG   GGGGYGGG GGG    GG  GGGGW
Sbjct: 98  RGSSASWQGSNGGGGKHGGG--GGGGGYGGGGGGGGKHGGGKHGGGGW 143

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/80 (52%), Positives = 45/80 (56%)
 Frame = +2

Query: 74  GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGG 253
           GG GGGY  GGGGGY GGGG +GGG      GGG  GG GG+   GGGGG          
Sbjct: 25  GGSGGGYGGGGGGGY-GGGGGHGGGA-----GGGKGGGHGGWQKGGGGGGG--------- 69

Query: 254 GGYGGGEGGGYGGSGGGGGW 313
              GGG GG   G GGGGG+
Sbjct: 70  ---GGGGGGWQKGGGGGGGY 86

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 39/67 (58%), Positives = 44/67 (65%), Gaps = 1/67 (1%)
 Frame = +2

Query: 113 GYSGGGGSYGGGGGRREGGGGYSGGGG-GYSSRGGGGGSYGGGRREGGGGYGGGEGGGYG 289
           G  GGG   G GGG   GGGGY GGGG G  + GG GG +GG ++ GGGG GGG GGG+ 
Sbjct: 21  GLLGGGSGGGYGGG---GGGGYGGGGGHGGGAGGGKGGGHGGWQKGGGGGGGGGGGGGWQ 77

Query: 290 GSGGGGG 310
             GGGGG
Sbjct: 78  KGGGGGG 84

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 32/56 (57%), Positives = 32/56 (57%), Gaps = 9/56 (16%)
 Frame = +2

Query: 173 GYSGGGGGYSSRGGGGGSYGGGRREG---GGGYGGGE------GGGYGGSGGGGGW 313
           G  GGG G    GGGGG YGGG   G   GGG GGG       GGG GG GGGGGW
Sbjct: 21  GLLGGGSGGGYGGGGGGGYGGGGGHGGGAGGGKGGGHGGWQKGGGGGGGGGGGGGW 76

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 3/59 (5%)
 Frame = +2

Query: 11  GRSITVNEAQS---RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGY 178
           GRS+  N   S   +GS GGGG  GGG      GGGGGY GGGG  G  GG + GGGG+
Sbjct: 91  GRSLAGNRGSSASWQGSNGGGGKHGGG------GGGGGYGGGGGGGGKHGGGKHGGGGW 143

[206][TOP]
>UniRef100_B3MYN0 GF22177 n=1 Tax=Drosophila ananassae RepID=B3MYN0_DROAN
          Length = 131

 Score =  112 bits (281), Expect = 1e-23
 Identities = 54/95 (56%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           Q  G GGGGG +GGGGGG + G      GGGG  G GG ++ GGGG  G GGG    GGG
Sbjct: 37  QKNGGGGGGGGKGGGGGGGQGGWQKNGGGGGGGGGQGGWQKNGGGGGGGNGGGGKHGGGG 96

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGG---GGGW 313
           GG  GGG + GGGG GGG+ GG GG GG   GGGW
Sbjct: 97  GGGNGGGGKHGGGGGGGGKHGGGGGGGGGKHGGGW 131

 Score =  106 bits (264), Expect = 9e-22
 Identities = 55/94 (58%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRS---GGGGGYSGGGGSYGGGGGRREGGGGYSGGG-GGYSSRGG 214
           G GGGGG  GGG GG++    GGGGG  GGGG  G GG ++ GGGG  GGG GG+   GG
Sbjct: 23  GQGGGGG--GGGQGGWQKNGGGGGGGGKGGGGGGGQGGWQKNGGGGGGGGGQGGWQKNGG 80

Query: 215 GGG--SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG  + GGG+  GGGG G G GG +GG GGGGG
Sbjct: 81  GGGGGNGGGGKHGGGGGGGNGGGGKHGGGGGGGG 114

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 32/54 (59%), Positives = 35/54 (64%), Gaps = 3/54 (5%)
 Frame = +2

Query: 161 EGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG---EGGGYGGSGGGGGW 313
           +GGGG  GG GG+   GGGGG  GGG+  GGGG  GG    GGG GG GG GGW
Sbjct: 24  QGGGGGGGGQGGWQKNGGGGG--GGGKGGGGGGGQGGWQKNGGGGGGGGGQGGW 75

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/73 (50%), Positives = 42/73 (57%), Gaps = 7/73 (9%)
 Frame = +2

Query: 113 GYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGG-------RREGGGGYGGG 271
           G  G GG  GGGGG   G GG+   GGG    GGGGG  GGG       ++ GGGG GGG
Sbjct: 20  GIDGQGG--GGGGG---GQGGWQKNGGG----GGGGGKGGGGGGGQGGWQKNGGGGGGGG 70

Query: 272 EGGGYGGSGGGGG 310
             GG+  +GGGGG
Sbjct: 71  GQGGWQKNGGGGG 83

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 30/54 (55%), Positives = 33/54 (61%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG 190
           N    +  GGGGG  GGGG   + GGGG   GGGG +GGGGG   GGGG  GGG
Sbjct: 86  NGGGGKHGGGGGGGNGGGG---KHGGGG---GGGGKHGGGGG---GGGGKHGGG 130

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 27/47 (57%), Positives = 30/47 (63%)
 Frame = +2

Query: 173 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           G  G GGG     GGGG  GG ++ GGGG GGG+GGG  G GG GGW
Sbjct: 20  GIDGQGGG-----GGGGGQGGWQKNGGGGGGGGKGGG--GGGGQGGW 59

[207][TOP]
>UniRef100_UPI0001868875 hypothetical protein BRAFLDRAFT_103538 n=1 Tax=Branchiostoma
           floridae RepID=UPI0001868875
          Length = 211

 Score =  112 bits (280), Expect = 1e-23
 Identities = 53/89 (59%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = -3

Query: 306 PPPPLPP*PPPSPPPY-PPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPP+ P PP +PPP  PPPP   PPP  PPPPP+    PPPP+ PPPP  + PPPP + 
Sbjct: 11  PPPPIAPPPPIAPPPMDPPPPMDPPPPVAPPPPPIA---PPPPIAPPPP--IAPPPP-MD 64

Query: 129 PPPE*PPPPPLRYPPPPPPRWPPPP-PLP 46
           PPP  PPPPP+  PPPPPP  P PP P P
Sbjct: 65  PPPMAPPPPPMAPPPPPPPAAPAPPVPAP 93

 Score =  108 bits (270), Expect = 2e-22
 Identities = 54/107 (50%), Positives = 62/107 (57%), Gaps = 5/107 (4%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPP-YPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*L 133
           PPPPP+ P PP +PPP   PPP   PPP  PPPPP+   PPPPP  P PP   P P P  
Sbjct: 40  PPPPPIAPPPPIAPPPPIAPPPPMDPPPMAPPPPPMAPPPPPPPAAPAPPVPAPDPTPAP 99

Query: 132 PPPPE*PPPPPLRYPPPPPPRWPPPPPLP----RD*ASLTVMLRPSR 4
           P     PPPPP   PPPPPP    PPPLP    +D + + V+ R S+
Sbjct: 100 PSITPVPPPPPPAAPPPPPPPPLMPPPLPPAPNQDISPIDVVSRKSK 146

 Score =  105 bits (261), Expect = 2e-21
 Identities = 53/102 (51%), Positives = 59/102 (57%), Gaps = 14/102 (13%)
 Frame = -3

Query: 309 PP--PPPLPP*PPPSPPP--YPPPPSRLPPP*LPPPPPLEE*PP--PPPLYPPPPSRLPP 148
           PP  PPP+ P PP  PPP   PPPP   PPP + PPPP+   PP  PPP+ PPPP   PP
Sbjct: 19  PPIAPPPMDPPPPMDPPPPVAPPPPPIAPPPPIAPPPPIAPPPPMDPPPMAPPPPPMAPP 78

Query: 147 PP-------P*LPPPPE*PPPPPLR-YPPPPPPRWPPPPPLP 46
           PP       P +P P   P PP +   PPPPPP  PPPPP P
Sbjct: 79  PPPPPAAPAPPVPAPDPTPAPPSITPVPPPPPPAAPPPPPPP 120

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 47/83 (56%), Positives = 52/83 (62%), Gaps = 2/83 (2%)
 Frame = -3

Query: 288 P*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PP 109
           P P   PPP  PPP   PPP + PPPP++   PPPP+ PPPP  + PPPP  PPPP  PP
Sbjct: 6   PAPTAPPPPIAPPPPIAPPP-MDPPPPMD---PPPPVAPPPPP-IAPPPPIAPPPPIAPP 60

Query: 108 PP--PLRYPPPPPPRWPPPPPLP 46
           PP  P    PPPPP  PPPPP P
Sbjct: 61  PPMDPPPMAPPPPPMAPPPPPPP 83

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/77 (55%), Positives = 48/77 (62%), Gaps = 2/77 (2%)
 Frame = -3

Query: 273 SPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LPPPPE*PPPPPLR 94
           +P P  PPP   PPP + PPP      PPPP+ PPPP   PPPPP  PPPP   PPPP+ 
Sbjct: 5   APAPTAPPPPIAPPPPIAPPPM----DPPPPMDPPPPVA-PPPPPIAPPPPI-APPPPIA 58

Query: 93  YPPP--PPPRWPPPPPL 49
            PPP  PPP  PPPPP+
Sbjct: 59  PPPPMDPPPMAPPPPPM 75

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 49/112 (43%), Positives = 52/112 (46%), Gaps = 24/112 (21%)
 Frame = -3

Query: 309 PPPPPLPP*PPPSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPPPSRLPPPPP*LP 130
           PPPPP+ P PPP PP  P PP   P P  P PP +   PPPPP   PPP   PPPPP +P
Sbjct: 70  PPPPPMAP-PPPPPPAAPAPPVPAPDP-TPAPPSITPVPPPPPPAAPPP---PPPPPLMP 124

Query: 129 PP------------------------PE*PPPPPLRYPPPPPPRWPPPPPLP 46
           PP                        P  PP PP   PP P P  PP PP P
Sbjct: 125 PPLPPAPNQDISPIDVVSRKSKPSPVPAPPPDPPAPAPPDPDP--PPSPPAP 174

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/98 (43%), Positives = 47/98 (47%), Gaps = 27/98 (27%)
 Frame = -3

Query: 309 PPPPPLPP*PP-PSPPPYPPPPSRLPPP*LPPPPPLEE*PPPPPLYPPP----------- 166
           PPPPP  P PP P+P P P PPS  P P  PPPP     PPPPPL PPP           
Sbjct: 79  PPPPPAAPAPPVPAPDPTPAPPSITPVP-PPPPPAAPPPPPPPPLMPPPLPPAPNQDISP 137

Query: 165 ---------PSRLPPPPP*----LPPPPE*P--PPPPL 97
                    PS +P PPP      PP P+ P  PP P+
Sbjct: 138 IDVVSRKSKPSPVPAPPPDPPAPAPPDPDPPPSPPAPI 175

[208][TOP]
>UniRef100_Q43522 Tfm5 protein n=1 Tax=Solanum lycopersicum RepID=Q43522_SOLLC
          Length = 207

 Score =  112 bits (280), Expect = 1e-23
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           S GSGGGG   GGGG G   GGGG  SGGGGS  GGGG   GGGG SG GGG S  GGGG
Sbjct: 41  SGGSGGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGG-SGSGGGGSGTGGGG 99

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGG 304
           GS GGG    GGG GGG GGG GG GGG
Sbjct: 100 GSGGGG----GGGGGGGGGGGGGGGGGG 123

 Score =  100 bits (249), Expect = 5e-20
 Identities = 53/83 (63%), Positives = 53/83 (63%), Gaps = 2/83 (2%)
 Frame = +2

Query: 68  HRGGGGGGYRSGGGGGYSGGGGSY--GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR 241
           H  G GG   SGGGG  SGGGGS   GGGGG   GGGG   GGGG  S GGG GS GGG 
Sbjct: 37  HPPGSGG---SGGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGS 93

Query: 242 REGGGGYGGGEGGGYGGSGGGGG 310
             GGGG  GG GGG GG GGGGG
Sbjct: 94  GTGGGGGSGGGGGGGGGGGGGGG 116

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/74 (62%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 92  YRSGGGGGYSGGGGSYGGGGGRREGGGGYSG-GGGGYSSRGGGGGSYGGGRREGGGGYGG 268
           Y   G GG  GGG   GGGG    GGGG SG GGGG  S GGG GS GGG   GGGG G 
Sbjct: 36  YHPPGSGGSGGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGT 95

Query: 269 GEGGGYGGSGGGGG 310
           G GGG GG GGGGG
Sbjct: 96  GGGGGSGGGGGGGG 109

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 45/68 (66%), Positives = 46/68 (67%), Gaps = 3/68 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GSGGGGG  G GGGG  SGGGG  SGGGGS  GGGG   GGGG SGGGGG    GGGGG 
Sbjct: 57  GSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGG 116

Query: 227 ---YGGGR 241
               GGG+
Sbjct: 117 GGGGGGGQ 124

[209][TOP]
>UniRef100_B9SS24 Glycine-rich cell wall structural protein 1.8, putative n=1
           Tax=Ricinus communis RepID=B9SS24_RICCO
          Length = 379

 Score =  112 bits (280), Expect = 1e-23
 Identities = 58/94 (61%), Positives = 58/94 (61%), Gaps = 6/94 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGG-GYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           GSGGGGG  GGGG     G GG GY  GGG  GG GG   GGGG SGGGGG    G G G
Sbjct: 215 GSGGGGGKGGGGGAASAGGAGGAGYGSGGGEGGGAGGHTSGGGGGSGGGGGAGYAGSGAG 274

Query: 224 SYGGGRREG-GGGYGGG----EGGGYGGSGGGGG 310
            YGGG   G GGGYG G     GGG GGSGGGGG
Sbjct: 275 GYGGGEGAGSGGGYGAGGAGVGGGGGGGSGGGGG 308

 Score =  108 bits (270), Expect = 2e-22
 Identities = 55/92 (59%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = +2

Query: 50  SGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 229
           SGGGGG  GGGG GY   G GGY GG G+ G GGG   GG G  GGGGG  S GGGG  Y
Sbjct: 254 SGGGGGSGGGGGAGYAGSGAGGYGGGEGA-GSGGGYGAGGAGVGGGGGG-GSGGGGGAGY 311

Query: 230 GGGRREGGGGYGGGEGGGYG-----GSGGGGG 310
            GG   GG G GGGEG G+G     G+GGGGG
Sbjct: 312 AGGAHGGGYGSGGGEGAGHGGGAGIGAGGGGG 343

 Score =  100 bits (249), Expect = 5e-20
 Identities = 58/111 (52%), Positives = 60/111 (54%), Gaps = 23/111 (20%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGG--SYGGGGGRREGGGGYSGGGGGYSSRGGGG 220
           G GGG G+ G GG G  SGGGGG  GGGG  S GG GG   G GG  GGG GY   G  G
Sbjct: 155 GEGGGAGYGGAGGIGGGSGGGGGKGGGGGAASAGGAGGAGYGSGGGEGGGAGYGGAGIAG 214

Query: 221 GSYGGGRREGGGGY-------------GGGEGGGYGG--------SGGGGG 310
           GS GGG + GGGG              GGGEGGG GG        SGGGGG
Sbjct: 215 GSGGGGGKGGGGGAASAGGAGGAGYGSGGGEGGGAGGHTSGGGGGSGGGGG 265

 Score =  100 bits (248), Expect = 7e-20
 Identities = 55/96 (57%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG--RREGGGGYSGGGGGYSSRGGGG 220
           G GGGGG    GG G    G GG  GGG  YGG GG     GGGG  GGGGG +S GG G
Sbjct: 132 GKGGGGGAASAGGAGGAGYGAGGGEGGGAGYGGAGGIGGGSGGGGGKGGGGGAASAGGAG 191

Query: 221 GS-YGGGRREGGG-GYGG----GEGGGYGGSGGGGG 310
           G+ YG G  EGGG GYGG    G  GG GG GGGGG
Sbjct: 192 GAGYGSGGGEGGGAGYGGAGIAGGSGGGGGKGGGGG 227

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 57/97 (58%), Positives = 58/97 (59%), Gaps = 9/97 (9%)
 Frame = +2

Query: 47  GSGGG-GGHRGGGGGGYR--SGGGGGYSGGGG--SYGGGGGRREGGGGYSGGGGGYSSRG 211
           GSGGG GG  G GG G    SGGGGG  GGGG  S GG GG   G GG  GGG G  + G
Sbjct: 196 GSGGGEGGGAGYGGAGIAGGSGGGGGKGGGGGAASAGGAGGAGYGSGGGEGGGAGGHTSG 255

Query: 212 GGGGSYGGGRR----EGGGGYGGGEGGGYGGSGGGGG 310
           GGGGS GGG       G GGYGGGEG G GG  G GG
Sbjct: 256 GGGGSGGGGGAGYAGSGAGGYGGGEGAGSGGGYGAGG 292

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 54/96 (56%), Positives = 58/96 (60%), Gaps = 8/96 (8%)
 Frame = +2

Query: 47  GSGG-GGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG--GGGYSSRGGG 217
           G+GG GGG   G GGGY +GG G   GGGG  GGG     GG GY+GG  GGGY S GG 
Sbjct: 272 GAGGYGGGEGAGSGGGYGAGGAGVGGGGGGGSGGG-----GGAGYAGGAHGGGYGSGGGE 326

Query: 218 GGSYGGGR-----REGGGGYGGGEGGGYGGSGGGGG 310
           G  +GGG        GGGG GGG GGGYG  GGG G
Sbjct: 327 GAGHGGGAGIGAGGGGGGGSGGGGGGGYGAHGGGYG 362

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 52/97 (53%), Positives = 55/97 (56%), Gaps = 7/97 (7%)
 Frame = +2

Query: 38  QSRGSGGG-----GGHRGGGGGGYRSGGGGGYSGG--GGSYGGGGGRREGGGGYSGGGGG 196
           +  GSGGG      G  GGGGGG   GGG GY+GG  GG YG GGG   G GG +G G G
Sbjct: 280 EGAGSGGGYGAGGAGVGGGGGGGSGGGGGAGYAGGAHGGGYGSGGGEGAGHGGGAGIGAG 339

Query: 197 YSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
               GG GG  GGG    GGGYG G G G GG  GGG
Sbjct: 340 GGGGGGSGGGGGGGYGAHGGGYGAGGGSGEGGGHGGG 376

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 56/95 (58%), Positives = 59/95 (62%), Gaps = 9/95 (9%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGG---GGGRREGGGGYSGGGGGYSSRGGG 217
           GGGGG  GGGGG   +GG  G GY  G G  GG   GG    GGGG  GGGGG +S GG 
Sbjct: 86  GGGGGGSGGGGGAAHAGGASGAGYGAGSGEGGGAGYGGAAGIGGGGGKGGGGGAASAGGA 145

Query: 218 GGS-YGGGRREGGG-GYGG--GEGGGYGGSGGGGG 310
           GG+ YG G  EGGG GYGG  G GGG GG GG GG
Sbjct: 146 GGAGYGAGGGEGGGAGYGGAGGIGGGSGGGGGKGG 180

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 58/123 (47%), Positives = 61/123 (49%), Gaps = 23/123 (18%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG------- 169
           G + +   A   G G GGG  GG G G   G GGG  GGGG  GGGG    GG       
Sbjct: 137 GGAASAGGAGGAGYGAGGGEGGGAGYGGAGGIGGGSGGGGGKGGGGGAASAGGAGGAGYG 196

Query: 170 -GGYSGGGGGYSSRGGGGGSYGGGRREGGG-------------GYGGGEGGGYGG--SGG 301
            GG  GGG GY   G  GGS GGG + GGG             G GGGEGGG GG  SGG
Sbjct: 197 SGGGEGGGAGYGGAGIAGGSGGGGGKGGGGGAASAGGAGGAGYGSGGGEGGGAGGHTSGG 256

Query: 302 GGG 310
           GGG
Sbjct: 257 GGG 259

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/106 (50%), Positives = 58/106 (54%), Gaps = 13/106 (12%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGG------------GGSYGGGGGRREGGGG 175
           E    G GG  G  GGGGGG   GGG  ++GG            GG  G GG    GGGG
Sbjct: 72  EGGGAGYGGVAGIGGGGGGGSGGGGGAAHAGGASGAGYGAGSGEGGGAGYGGAAGIGGGG 131

Query: 176 YSGGGGGYSSRGGGGGS-YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGGGG +S GG GG+ YG G  EGGG   GG GG  GGSGGGGG
Sbjct: 132 GKGGGGGAASAGGAGGAGYGAGGGEGGGAGYGGAGGIGGGSGGGGG 177

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 51/92 (55%), Positives = 52/92 (56%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG-GGG 223
           GSG GGG   GG  G   GGG G  GG  S GG GG   G GG  GGG GY   GG GGG
Sbjct: 112 GSGEGGGAGYGGAAGIGGGGGKGGGGGAASAGGAGGAGYGAGGGEGGGAGYGGAGGIGGG 171

Query: 224 SYGGGRREGGGG---YGGGEGGGYGGSGGGGG 310
           S GGG + GGGG    GG  G GYG  GG GG
Sbjct: 172 SGGGGGKGGGGGAASAGGAGGAGYGSGGGEGG 203

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 60/135 (44%), Positives = 67/135 (49%), Gaps = 36/135 (26%)
 Frame = +2

Query: 14  RSITVNEAQSRGS---GGGGGHRGGGGGGYRSGGGGG---YSGGGGS-------YGGGGG 154
           RS+   +A   G    GGGGG  GGGG GY +GG  G   Y+GG GS       YGG  G
Sbjct: 24  RSLLTLDAHIYGGVSGGGGGGSGGGGGSGYAAGGEHGDAVYAGGAGSGEGGGAGYGGVAG 83

Query: 155 RREGGGGYSGGGGGYSSRGGGGGS-YGGGRREGGG---------GYGGGEGGG------- 283
              GGGG SGGGGG +  GG  G+ YG G  EGGG         G GGG+GGG       
Sbjct: 84  IGGGGGGGSGGGGGAAHAGGASGAGYGAGSGEGGGAGYGGAAGIGGGGGKGGGGGAASAG 143

Query: 284 ------YGGSGGGGG 310
                 YG  GG GG
Sbjct: 144 GAGGAGYGAGGGEGG 158

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/101 (53%), Positives = 60/101 (59%), Gaps = 13/101 (12%)
 Frame = +2

Query: 47  GSGGGGGHRG----GGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           G GGG G+ G    GGGGG  SGGGGG +  GG+ G G G   G GG +G GG  +  GG
Sbjct: 71  GEGGGAGYGGVAGIGGGGGGGSGGGGGAAHAGGASGAGYGAGSGEGGGAGYGGA-AGIGG 129

Query: 215 GGGSYGGGRR-----EGGGGY--GGGEGG--GYGGSGGGGG 310
           GGG  GGG        GG GY  GGGEGG  GYGG+GG GG
Sbjct: 130 GGGKGGGGGAASAGGAGGAGYGAGGGEGGGAGYGGAGGIGG 170

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/101 (45%), Positives = 46/101 (45%), Gaps = 21/101 (20%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG-GGGYS--------------------GGGGSYGGGGGRRE 163
           G GGGGG  GGGG GY  G  GGGY                     GGGGS GG      
Sbjct: 296 GGGGGGGSGGGGGAGYAGGAHGGGYGSGGGEGAGHGGGAGIGAGGGGGGGSGGG------ 349

Query: 164 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 286
           GGGGY   GGGY   G GGGS          G GGG GGGY
Sbjct: 350 GGGGYGAHGGGY---GAGGGS----------GEGGGHGGGY 377

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 32/57 (56%), Positives = 33/57 (57%)
 Frame = +2

Query: 32  EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYS 202
           E    G G G G  GGGGGG   GGGGGY   GG YG GGG  EGG    G GGGY+
Sbjct: 326 EGAGHGGGAGIGAGGGGGGGSGGGGGGGYGAHGGGYGAGGGSGEGG----GHGGGYA 378

[210][TOP]
>UniRef100_A9NNT8 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NNT8_PICSI
          Length = 205

 Score =  112 bits (280), Expect = 1e-23
 Identities = 66/121 (54%), Positives = 70/121 (57%), Gaps = 18/121 (14%)
 Frame = +2

Query: 2   DLDGRSITVNEAQSRGSGGG-GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGY 178
           D+ G      +  S G GGG GG RGGGGGGY  GGGGGY GGGG YGGGG    GGGG+
Sbjct: 68  DVTGPDGAFVQGNSGGGGGGRGGGRGGGGGGY-GGGGGGYGGGGGGYGGGG--YGGGGGW 124

Query: 179 SGGGGGYSSRGGG-GGSYGGGRREGGGG----------------YGGGEGGGYGGSGGGG 307
           +GGGGG   RGGG GG  GGG   GGGG                 GGG GGG GG GGG 
Sbjct: 125 NGGGGG--GRGGGRGGGRGGGAGGGGGGSCYKCGESGHFARDCTSGGGGGGGNGGGGGGA 182

Query: 308 G 310
           G
Sbjct: 183 G 183

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/99 (58%), Positives = 59/99 (59%), Gaps = 13/99 (13%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGGY  GGGGG  GGGG YGGGGG   GGGG  GGG G   RGGG G 
Sbjct: 91  GRGGGGGGYGGGGGGY--GGGGGGYGGGG-YGGGGGWNGGGGGGRGGGRG-GGRGGGAGG 146

Query: 227 YGGGR-------------REGGGGYGGGEGGGYGGSGGG 304
            GGG                 GGG GGG GGG GG+GGG
Sbjct: 147 GGGGSCYKCGESGHFARDCTSGGGGGGGNGGGGGGAGGG 185

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 40/62 (64%), Positives = 40/62 (64%)
 Frame = +2

Query: 128 GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G S GGGGGR   GGG  GGGGGY   GGGGG YGGG    GGGYGGG      G GGGG
Sbjct: 79  GNSGGGGGGR---GGGRGGGGGGY---GGGGGGYGGG----GGGYGGG------GYGGGG 122

Query: 308 GW 313
           GW
Sbjct: 123 GW 124

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 38/78 (48%), Positives = 42/78 (53%), Gaps = 5/78 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGY-----SGGGGGYSSRG 211
           G GGGGG  GGGGGG   G GGG  GG G  GGG   + G  G+     + GGGG    G
Sbjct: 117 GYGGGGGWNGGGGGGRGGGRGGGRGGGAGGGGGGSCYKCGESGHFARDCTSGGGGGGGNG 176

Query: 212 GGGGSYGGGRREGGGGYG 265
           GGGG  GGG     G +G
Sbjct: 177 GGGGGAGGGSCYQCGDFG 194

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 31/71 (43%), Positives = 33/71 (46%), Gaps = 17/71 (23%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGY-----------------SGGGGSYGGGGGRREGGGG 175
           G GG GG RGGG GG   GGGGG                   GGGG  GGGGG   GG  
Sbjct: 128 GGGGRGGGRGGGRGGGAGGGGGGSCYKCGESGHFARDCTSGGGGGGGNGGGGGGAGGGSC 187

Query: 176 YSGGGGGYSSR 208
           Y  G  G+ +R
Sbjct: 188 YQCGDFGHFAR 198

[211][TOP]
>UniRef100_A8MUW5 Putative uncharacterized protein FAM98B n=1 Tax=Homo sapiens
           RepID=A8MUW5_HUMAN
          Length = 433

 Score =  112 bits (280), Expect = 1e-23
 Identities = 60/98 (61%), Positives = 65/98 (66%), Gaps = 9/98 (9%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG----GGYSSRG- 211
           G GGGGG RGGGGGG   GG GG+ GGGG +GGGGG   GGGG+ GGG    GG+  RG 
Sbjct: 339 GGGGGGGGRGGGGGG---GGRGGWGGGGGGWGGGGG---GGGGWGGGGGGGRGGFQGRGD 392

Query: 212 -GGGGSYGGGRREGGGGYG---GGEGGGYGGSGGGGGW 313
            GG G YGG    GG GYG   GG GGG GG GGGGG+
Sbjct: 393 YGGRGGYGGRGGYGGRGYGDPYGGGGGGGGGGGGGGGY 430

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/88 (61%), Positives = 55/88 (62%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           RG GGGGG RGG GGG   GG GG  GGGG +GGGGG   GG G   G G Y  RGG GG
Sbjct: 347 RGGGGGGGGRGGWGGG--GGGWGGGGGGGGGWGGGGG---GGRGGFQGRGDYGGRGGYGG 401

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGG 307
             G G R  G  YGGG GGG GG GGGG
Sbjct: 402 RGGYGGRGYGDPYGGGGGGGGGGGGGGG 429

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 47/84 (55%), Positives = 51/84 (60%), Gaps = 12/84 (14%)
 Frame = +2

Query: 95  RSGGGGGYSGGGGSYGGGGGRREGG-----GGYSGGGGGYSSRGGGGGSYGGGRREGGGG 259
           R  GGGG  G GG  GGGGGR  GG     GG+ GGGGG+   GGGGG +GGG   GGGG
Sbjct: 328 RQEGGGGRGGWGGG-GGGGGRGGGGGGGGRGGWGGGGGGWGGGGGGGGGWGGG---GGGG 383

Query: 260 YGGGEG-------GGYGGSGGGGG 310
            GG +G       GGYGG GG GG
Sbjct: 384 RGGFQGRGDYGGRGGYGGRGGYGG 407

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 34/53 (64%), Positives = 36/53 (67%)
 Frame = +2

Query: 155 RREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           R+EGGGG  G GGG    GGGGG  GGG   G GG+GGG GG  GG GGGGGW
Sbjct: 328 RQEGGGGRGGWGGG----GGGGGRGGGGGGGGRGGWGGGGGGWGGGGGGGGGW 376

[212][TOP]
>UniRef100_UPI0001982DB4 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982DB4
          Length = 214

 Score =  112 bits (279), Expect = 2e-23
 Identities = 64/114 (56%), Positives = 65/114 (57%), Gaps = 25/114 (21%)
 Frame = +2

Query: 44  RGSGGGGGHRGG-GGGGYRSGGGGGYSGGGGSY--GGGGGRREGGGGYSGGGGGYSSRGG 214
           +GS GGGG RGG GGGGY  GGGGGY GGGG Y   GGGGR  G GG  GGGGG SS G 
Sbjct: 76  QGSRGGGGGRGGRGGGGY--GGGGGYGGGGGGYGYNGGGGRGGGRGGRGGGGGGRSSGGY 133

Query: 215 GGGSYGGGRREGGGG----------------------YGGGEGGGYGGSGGGGG 310
           GGG YGGG   GGGG                       GGG GG Y G GGGGG
Sbjct: 134 GGGGYGGGGGYGGGGGGGACYNCGEEGHLARDCSQSSGGGGGGGRYSGGGGGGG 187

 Score =  109 bits (272), Expect = 1e-22
 Identities = 65/120 (54%), Positives = 66/120 (55%), Gaps = 30/120 (25%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGGG----GGYRSGGGG-GYSGGGGSYGGGGGRREGGGGYS-------- 181
           SRG GGG G RGGGG    GGY  GGGG GY+GGGG  GG GGR  GGGG S        
Sbjct: 78  SRGGGGGRGGRGGGGYGGGGGYGGGGGGYGYNGGGGRGGGRGGRGGGGGGRSSGGYGGGG 137

Query: 182 -GGGGGYSSRGGGGGSY----------------GGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGGGGY   GGGG  Y                GGG   GGG Y GG GGG GG GGGGG
Sbjct: 138 YGGGGGYGGGGGGGACYNCGEEGHLARDCSQSSGGG--GGGGRYSGGGGGGGGGGGGGGG 195

 Score =  100 bits (249), Expect = 5e-20
 Identities = 59/101 (58%), Positives = 63/101 (62%), Gaps = 1/101 (0%)
 Frame = +2

Query: 8   DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGG 187
           DGR+  V+     G+   G   GGGG G R  GGGGY GGGG YGGGG    GG GY+GG
Sbjct: 59  DGRTKAVDVTGPDGNPVQGSRGGGGGRGGR--GGGGYGGGGG-YGGGG----GGYGYNGG 111

Query: 188 GGGYSSRGGGGGSYGGGRREGG-GGYGGGEGGGYGGSGGGG 307
           GG    RGG GG  GGGR  GG GG G G GGGYGG GGGG
Sbjct: 112 GGRGGGRGGRGGG-GGGRSSGGYGGGGYGGGGGYGGGGGGG 151

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/85 (50%), Positives = 49/85 (57%), Gaps = 2/85 (2%)
 Frame = +2

Query: 38  QSRGSGGGGGHRGGGGGGYRSGGGGG--YSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG 211
           +S G  GGGG+  GGGGGY  GGGGG  Y+ G   +      +  GGG  GGGG YS  G
Sbjct: 128 RSSGGYGGGGY--GGGGGYGGGGGGGACYNCGEEGHLARDCSQSSGGG--GGGGRYSGGG 183

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGY 286
           GGGG  GGG   GGG Y  GE G +
Sbjct: 184 GGGGGGGGG---GGGCYRCGEAGHF 205

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 36/73 (49%), Positives = 39/73 (53%), Gaps = 19/73 (26%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGG----------------YRSGGGGG---YSGGGGSYGGGGGRREGG 169
           G GGGGG+ GGGGGG                  SGGGGG   YSGGGG  GGGGG   GG
Sbjct: 137 GYGGGGGYGGGGGGGACYNCGEEGHLARDCSQSSGGGGGGGRYSGGGG--GGGGGGGGGG 194

Query: 170 GGYSGGGGGYSSR 208
           G Y  G  G+ +R
Sbjct: 195 GCYRCGEAGHFAR 207

[213][TOP]
>UniRef100_UPI0001982BFF PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982BFF
          Length = 274

 Score =  112 bits (279), Expect = 2e-23
 Identities = 61/111 (54%), Positives = 62/111 (55%), Gaps = 23/111 (20%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGS--------YGGGGGRREGGG------GYSG 184
           GSGGG G+ GG GGG   GGGGG  GGGGS        YG GGG   G G      G SG
Sbjct: 80  GSGGGEGYEGGRGGGSGGGGGGGSGGGGGSAYGAGGAGYGSGGGEGSGAGFGGANGGGSG 139

Query: 185 GGGGYSSRGGGGGSYGGGRREGGG---------GYGGGEGGGYGGSGGGGG 310
           GGGG  S GGGG SYG G   GGG         GYG GEGGG GG  GGGG
Sbjct: 140 GGGGGGSGGGGGASYGAGGAHGGGSGSGRGSGGGYGAGEGGGAGGGSGGGG 190

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/104 (52%), Positives = 57/104 (54%), Gaps = 17/104 (16%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGG----------------GYRSGGGGGYSGGGGSYGGGGGRREGGGGY 178
           GSG G G RGGGGG                GY SGGG G  GG G  GG GG   GGGG 
Sbjct: 42  GSGSGYGGRGGGGGSGGGEGYAAVGDHGAAGYGSGGGSGSGGGEGYEGGRGGGSGGGGGG 101

Query: 179 SGGGGGYSSRGGGGGSYGGGRREG-GGGYGGGEGGGYGGSGGGG 307
             GGGG S+ G GG  YG G  EG G G+GG  GGG GG GGGG
Sbjct: 102 GSGGGGGSAYGAGGAGYGSGGGEGSGAGFGGANGGGSGGGGGGG 145

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/104 (52%), Positives = 57/104 (54%), Gaps = 16/104 (15%)
 Frame = +2

Query: 44  RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG-GRREGGGGYSGGGGGYSSRGGGG 220
           RGSGGG G   GGG G  SGGGGG  GGG +YG GG G   G G  SG GGGY + GG G
Sbjct: 168 RGSGGGYGAGEGGGAGGGSGGGGGGGGGGAAYGAGGHGAGSGSGQGSGSGGGYGAGGGKG 227

Query: 221 GSYGGGRREGGG---------------GYGGGEGGGYGGSGGGG 307
           G  GGG   GGG               GYGGG G G GG  GGG
Sbjct: 228 GGGGGGSGGGGGSGGGAASGAGGEHGVGYGGGSGSGEGGGHGGG 271

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/105 (52%), Positives = 58/105 (55%), Gaps = 4/105 (3%)
 Frame = +2

Query: 8   DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGS-YGGGGGRREG-GGGYS 181
           +G       A   GSGGGGG   GGGGG   G GG + GG GS  G GGG   G GGG  
Sbjct: 124 EGSGAGFGGANGGGSGGGGGGGSGGGGGASYGAGGAHGGGSGSGRGSGGGYGAGEGGGAG 183

Query: 182 GGGGGYSSRGGGGGSYG-GGRREG-GGGYGGGEGGGYGGSGGGGG 310
           GG GG    GGGG +YG GG   G G G G G GGGYG  GG GG
Sbjct: 184 GGSGGGGGGGGGGAAYGAGGHGAGSGSGQGSGSGGGYGAGGGKGG 228

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 53/93 (56%), Positives = 55/93 (59%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           A   G G GGG   G G G  +GGG G  GGGGS GGGGG   G GG  GGG G S RG 
Sbjct: 113 AGGAGYGSGGGEGSGAGFGGANGGGSGGGGGGGS-GGGGGASYGAGGAHGGGSG-SGRGS 170

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 313
           GGG YG G    GGG GGG GGG GG GGG  +
Sbjct: 171 GGG-YGAGE---GGGAGGGSGGGGGGGGGGAAY 199

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/105 (50%), Positives = 54/105 (51%), Gaps = 17/105 (16%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGG------------GGGYSGG-----GGSYGGGGGRREGGGG 175
           G GGGGG  GGGG  Y +GG            GGGY  G     GG  GGGGG   GG  
Sbjct: 139 GGGGGGGSGGGGGASYGAGGAHGGGSGSGRGSGGGYGAGEGGGAGGGSGGGGGGGGGGAA 198

Query: 176 YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           Y  GG G  S G G GS  GG    GGG GGG GGG GG GG GG
Sbjct: 199 YGAGGHGAGS-GSGQGSGSGGGYGAGGGKGGGGGGGSGGGGGSGG 242

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 49/85 (57%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGG-GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 229
           GGG G   G GGGY +G GGG  GG GG  GGGGG    G G  G G G     G GG Y
Sbjct: 161 GGGSGSGRGSGGGYGAGEGGGAGGGSGGGGGGGGGGAAYGAGGHGAGSGSGQGSGSGGGY 220

Query: 230 GGGRREGGGGYGGGEGGGYGGSGGG 304
           G G  +GGGG GGG GGG GGSGGG
Sbjct: 221 GAGGGKGGGG-GGGSGGG-GGSGGG 243

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 46/89 (51%), Positives = 46/89 (51%), Gaps = 3/89 (3%)
 Frame = +2

Query: 53  GGGGGHRGGGGGGYRSGGGGGYSGGGGSY---GGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G G G   G G GY   GGGG SGGG  Y   G  G    G GG SG GGG    GG GG
Sbjct: 34  GAGHGAGSGSGSGYGGRGGGGGSGGGEGYAAVGDHGAAGYGSGGGSGSGGGEGYEGGRGG 93

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG   GGGG GGG G  YG  G G G
Sbjct: 94  GSGGG---GGGGSGGGGGSAYGAGGAGYG 119

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/113 (47%), Positives = 55/113 (48%), Gaps = 30/113 (26%)
 Frame = +2

Query: 62  GGHRGGGGGGYRSGGGGGYSGGGGSYGG-----------------GGGRREGGG-GYSGG 187
           G +  G G G  SG G G  GGGG  GG                 GGG   GGG GY GG
Sbjct: 31  GSYGAGHGAGSGSGSGYGGRGGGGGSGGGEGYAAVGDHGAAGYGSGGGSGSGGGEGYEGG 90

Query: 188 GGGYSSRGGGGGSYGGGRR---EGGGGY--GGGEGGGY-------GGSGGGGG 310
            GG S  GGGGGS GGG      GG GY  GGGEG G        GGSGGGGG
Sbjct: 91  RGGGSGGGGGGGSGGGGGSAYGAGGAGYGSGGGEGSGAGFGGANGGGSGGGGG 143

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 44/84 (52%), Positives = 47/84 (55%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           A   G+G G G   G GGGY +GGG G  GGGGS GGGG    GGG  SG GG +     
Sbjct: 201 AGGHGAGSGSGQGSGSGGGYGAGGGKGGGGGGGSGGGGG---SGGGAASGAGGEH----- 252

Query: 215 GGGSYGGGRREGGGGYGGGEGGGY 286
            G  YGGG    G G GGG GGGY
Sbjct: 253 -GVGYGGG---SGSGEGGGHGGGY 272

[214][TOP]
>UniRef100_Q1BU84 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia
           AU 1054 RepID=Q1BU84_BURCA
          Length = 517

 Score =  112 bits (279), Expect = 2e-23
 Identities = 53/89 (59%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGG-GYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G+ GGGGH GGG G G   G GGG+  GGG +G GGG  +GGGG+  GGG     GGGG 
Sbjct: 255 GTSGGGGHGGGGDGDGGGHGNGGGHGDGGGGHGNGGGHGDGGGGHGNGGG--HGNGGGGN 312

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG   GGGG GGG GGG GG GGGGG
Sbjct: 313 GNGGGHGNGGGGGGGGGGGGGGGGGGGGG 341

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/90 (61%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREG--GGGYSGGGGGYSSRGGGG 220
           G+G GGGH  GGGGG   GGGGG  GGGG  GGGGG   G  GGG  GGG G  + GG G
Sbjct: 311 GNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGGGGNGGGNGGGNGGGGNGGGNGGGNG 370

Query: 221 GSYGGGRREG-GGGYGGGEGGGYGGSGGGG 307
           G  GGG   G GGG GGG GGG GG  GGG
Sbjct: 371 GGNGGGNGGGNGGGNGGGNGGGNGGGNGGG 400

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/88 (62%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGGH G GGGG  +GGG G  GGGG  GGGGG   GGGG  GGGGG +  G GGG+
Sbjct: 298 GHGNGGGH-GNGGGGNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGGGGNGGGNGGGN 356

Query: 227 YGGGRREG-GGGYGGGEGGGYGGSGGGG 307
            GGG   G GGG GGG GGG GG  GGG
Sbjct: 357 GGGGNGGGNGGGNGGGNGGGNGGGNGGG 384

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/91 (60%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGG--GYSGGGGGYSSRGGGG 220
           G+GGGGG  GGGGGG   GGGGG  GGGG+ GG GG   GGG  G +GGG G  + GG G
Sbjct: 319 GNGGGGGGGGGGGGGGGGGGGGGGGGGGGNGGGNGGGNGGGGNGGGNGGGNGGGNGGGNG 378

Query: 221 GSYGGGRREG-GGGYGGGEGGGYGGSGGGGG 310
           G  GGG   G GGG GGG GGG+G  GGG G
Sbjct: 379 GGNGGGNGGGNGGGNGGGNGGGHGNGGGGHG 409

 Score =  109 bits (273), Expect = 8e-23
 Identities = 55/93 (59%), Positives = 56/93 (60%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGG----GYRSGGGGGYSGGGGSYGGGGGRREGGG-GYSGGGGGYSSRG 211
           G G GGGH  GGGG    G    GGGG+  GGG   GGGG   GGG G  GGGGG    G
Sbjct: 272 GHGNGGGHGDGGGGHGNGGGHGDGGGGHGNGGGHGNGGGGNGNGGGHGNGGGGGGGGGGG 331

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGGG  GGG   GGGG GGG GGG GG G GGG
Sbjct: 332 GGGGGGGGGGGGGGGGNGGGNGGGNGGGGNGGG 364

 Score =  108 bits (271), Expect = 1e-22
 Identities = 53/91 (58%), Positives = 58/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGG---GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G G GGGH  GGG   GG   G GGG+  GGG +G GGG   GGGG +G GGG+ + GGG
Sbjct: 266 GDGDGGGHGNGGGHGDGGGGHGNGGGHGDGGGGHGNGGGHGNGGGG-NGNGGGHGNGGGG 324

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  GGG   GGGG GGG GGG  G G GGG
Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGGNGGGNGGG 355

 Score =  108 bits (270), Expect = 2e-22
 Identities = 53/90 (58%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGG---GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G+GGG G  GGG   GGG+ +GGGG  +GGG   GGGGG   GGGG  GGGGG    GGG
Sbjct: 287 GNGGGHGDGGGGHGNGGGHGNGGGGNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGGG 346

Query: 218 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 307
           G   G G   GGGG GGG GGG GG  GGG
Sbjct: 347 GNGGGNGGGNGGGGNGGGNGGGNGGGNGGG 376

 Score =  106 bits (265), Expect = 7e-22
 Identities = 55/91 (60%), Positives = 60/91 (65%), Gaps = 4/91 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGG---GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G+GGG G+ GGG   GGG+ +GGGGG  GGGG  GGGGG   GGGG  GG GG +  G G
Sbjct: 300 GNGGGHGNGGGGNGNGGGHGNGGGGGGGGGGGGGGGGGG--GGGGGGGGGNGGGNGGGNG 357

Query: 218 GGSYGGGRREG-GGGYGGGEGGGYGGSGGGG 307
           GG  GGG   G GGG GGG GGG GG  GGG
Sbjct: 358 GGGNGGGNGGGNGGGNGGGNGGGNGGGNGGG 388

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/89 (60%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG-GGYSSRGGGGG 223
           G G GGG  G GGG    GGGGG  GGGG  GGGGG   GGGG +GGG GG +  GG GG
Sbjct: 304 GHGNGGGGNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGGGGNGGGNGGGNGGGGNGG 363

Query: 224 SYGGGRREG-GGGYGGGEGGGYGGSGGGG 307
             GGG   G GGG GGG GGG GG  GGG
Sbjct: 364 GNGGGNGGGNGGGNGGGNGGGNGGGNGGG 392

 Score =  105 bits (263), Expect = 1e-21
 Identities = 51/93 (54%), Positives = 56/93 (60%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGG-----GGGRREGGGGYSGGGGGYSSRG 211
           G GGGGG  GGGGGG   GG GG +GGGG+ GG     GGG   G GG +GGG G  + G
Sbjct: 332 GGGGGGGGGGGGGGGGNGGGNGGGNGGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGG 391

Query: 212 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G GG  GGG   GGGG+G G G G G   GG G
Sbjct: 392 GNGGGNGGGHGNGGGGHGNGGGNGNGNGSGGAG 424

 Score =  104 bits (260), Expect = 3e-21
 Identities = 51/88 (57%), Positives = 53/88 (60%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   G GGG  GG G  G GGG   G GG +GGG G  + GG GG 
Sbjct: 329 GGGGGGGGGGGGGGGGGGGNGGGNGGGNGGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGG 388

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG    GGG GGG G G GG G GGG
Sbjct: 389 NGGG---NGGGNGGGHGNGGGGHGNGGG 413

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 52/97 (53%), Positives = 58/97 (59%), Gaps = 9/97 (9%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG---GGYSGGGGSYGGG---GGRREGGGGYSGGGGGYSSR 208
           G+ GGG   GG  GG  SGGG   GG SGGGG  GGG   GG    GGG+  GGGG+ + 
Sbjct: 230 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGGGGHGNG 289

Query: 209 GG---GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG   GGG +G G   G GG G G GGG+G  GGGGG
Sbjct: 290 GGHGDGGGGHGNGGGHGNGGGGNGNGGGHGNGGGGGG 326

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 53/94 (56%), Positives = 60/94 (63%), Gaps = 6/94 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG---GGYSGGGGSYGGG-GGRREGGGGYSGGGGGYSSRGG 214
           G+ GGG   GG  GG  SGGG   GG SGGG S GGG GG  +G GG  G GGG+   GG
Sbjct: 225 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGGG 284

Query: 215 GGGSYGGGRREGGGGY--GGGEGGGYGGSGGGGG 310
           G G+ GGG  +GGGG+  GGG G G GG+G GGG
Sbjct: 285 GHGN-GGGHGDGGGGHGNGGGHGNGGGGNGNGGG 317

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 45/92 (48%), Positives = 50/92 (54%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY----SSRGG 214
           G G GGG+ GG GGG   G GGG+  GGG +G GGG   G G    G GG     + RG 
Sbjct: 378 GGGNGGGNGGGNGGGNGGGNGGGHGNGGGGHGNGGGNGNGNGSGGAGNGGANGVGNGRGN 437

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG S   G   G GG G G GGG GG+ G GG
Sbjct: 438 GGNSGNAGGSNGNGGGGAGNGGGSGGANGTGG 469

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 45/89 (50%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGG-GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G+GGG GG  GGG GG   GG GG +GGG   G GGG   GGGG+  GGG  +  G GG 
Sbjct: 364 GNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGHGNGGGGHGNGGGNGNGNGSGGA 423

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GG    G G   GG  G  GGS G GG
Sbjct: 424 GNGGANGVGNGRGNGGNSGNAGGSNGNGG 452

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/87 (51%), Positives = 50/87 (57%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGG+ GG GGG   GG GG +GGG   G GGG   G GG +GGG G    GG GG 
Sbjct: 345 GGGNGGGNGGGNGGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNG----GGNGGG 400

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGG 307
           +G G    G G G G G G GG+G GG
Sbjct: 401 HGNGGGGHGNGGGNGNGNGSGGAGNGG 427

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/95 (55%), Positives = 54/95 (56%), Gaps = 5/95 (5%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGG--GGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           S G   GGG  GGG  GGG   GG  GGG SGGG S GG  G    GGG SGGG      
Sbjct: 197 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 256

Query: 209 GGGGGSYGGGRREGGG-GYGGGEGGGYGGSGGGGG 310
            GGGG  GGG  +GGG G GGG G G GG G GGG
Sbjct: 257 SGGGGHGGGGDGDGGGHGNGGGHGDGGGGHGNGGG 291

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/90 (52%), Positives = 50/90 (55%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREG-GGGYSGGGGGYSSRGGGGG 223
           G G GGG+ GGG GG   GG GG +GGG   G GGG   G GGG  GG GG    GGGG 
Sbjct: 349 GGGNGGGNGGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGHGNGGGGH 408

Query: 224 SYGGGRREGGGGYGGGEGGGYG-GSGGGGG 310
             GGG   G G  G G GG  G G+G G G
Sbjct: 409 GNGGGNGNGNGSGGAGNGGANGVGNGRGNG 438

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/94 (54%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG---GGYSGGGGSYGGGGGRREGGGGYSGGG---GGYSSR 208
           G+ GGG   GG  GG  SGGG   GG SGGG S GG  G    GGG SGGG   GG S  
Sbjct: 185 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 244

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G  GG   GG   GGGG+GGG  G  GG G GGG
Sbjct: 245 GTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGG 278

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/95 (54%), Positives = 55/95 (57%), Gaps = 7/95 (7%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG---GGYSGGGGSYGGGGGRREGGGGYSGGG--GGYSSRG 211
           G+ GGG   GG  GG  SGGG   GG SGGG S GG  G    GGG SGGG  GG     
Sbjct: 210 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGD 269

Query: 212 GGGGSYGGGRREGGGGY--GGGEGGGYGGSGGGGG 310
           GGG   GGG  +GGGG+  GGG G G GG G GGG
Sbjct: 270 GGGHGNGGGHGDGGGGHGNGGGHGDGGGGHGNGGG 304

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 43/94 (45%), Positives = 49/94 (52%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           N   + G G GGG+ GG GGG   G GGG  GG G   GGG     GGG+  GGGG+ + 
Sbjct: 352 NGGGNGGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGHGNGGGGHGNG 411

Query: 209 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG G   G G    GG  G G G G GG+ G  G
Sbjct: 412 GGNGNGNGSGGAGNGGANGVGNGRGNGGNSGNAG 445

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/91 (49%), Positives = 49/91 (53%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG-GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 223
           G G GGG+ GG GGG   G GGG  GG GG +G GGG    GGG   G G   +  GG  
Sbjct: 370 GGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGHGNGGGGHGNGGGNGNGNGSGGAGNGGAN 429

Query: 224 SYGGGRREGG--GGYGGGEGGGYGGSGGGGG 310
             G GR  GG  G  GG  G G GG+G GGG
Sbjct: 430 GVGNGRGNGGNSGNAGGSNGNGGGGAGNGGG 460

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 55/103 (53%), Positives = 57/103 (55%), Gaps = 13/103 (12%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGG--GGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGG--GGYS 202
           S G   GGG  GGG  GGG   GG  GGG SGGG S GG  G    GGG SGGG  GG +
Sbjct: 172 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 231

Query: 203 SRGG-------GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           S GG       GGG+ GGG   GG   GGG GGG  G GGG G
Sbjct: 232 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHG 274

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 48/103 (46%), Positives = 53/103 (51%), Gaps = 15/103 (14%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGG-GYSGGGGSYGGGGGRREGG----------GGYSGGGG 193
           G G GGG+ GG GGG+ +GGGG G  GG G+  G GG   GG          GG SG  G
Sbjct: 386 GGGNGGGNGGGNGGGHGNGGGGHGNGGGNGNGNGSGGAGNGGANGVGNGRGNGGNSGNAG 445

Query: 194 GYSSRGGG----GGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G +  GGG    GG  GG    GG G GGG G G G  G G G
Sbjct: 446 GSNGNGGGGAGNGGGSGGANGTGGHGNGGGNGNGNGSGGAGNG 488

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 54/98 (55%), Positives = 56/98 (57%), Gaps = 8/98 (8%)
 Frame = +2

Query: 41  SRGSGGGGGHRGGG--GGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGG--GGYS 202
           S G   GGG  GGG  GGG   GG  GGG SGGG S GG  G    GGG SGGG  GG +
Sbjct: 167 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 226

Query: 203 SRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           S GG  GGG+ GGG   GG   GG  GGG  G GG GG
Sbjct: 227 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGG 264

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/100 (47%), Positives = 52/100 (52%), Gaps = 12/100 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG----GRREGGGGYSG--------GG 190
           G G GGGH G GGGG+ +GGG G   G G  G GG    G   G GG SG        GG
Sbjct: 394 GGGNGGGH-GNGGGGHGNGGGNGNGNGSGGAGNGGANGVGNGRGNGGNSGNAGGSNGNGG 452

Query: 191 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG  + GG GG+ G G    GGG G G G G  G+GG  G
Sbjct: 453 GGAGNGGGSGGANGTGGHGNGGGNGNGNGSGGAGNGGANG 492

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/100 (52%), Positives = 56/100 (56%), Gaps = 6/100 (6%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGG--GG 196
           N + + GSGGG    G  GGG   GG  GGG SGGG S GG  G    GGG SGGG  GG
Sbjct: 140 NASGNGGSGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 199

Query: 197 YSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            +S GG  GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 200 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 239

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 54/104 (51%), Positives = 56/104 (53%), Gaps = 8/104 (7%)
 Frame = +2

Query: 23  TVNEAQSRGSGGGGGHRGGG--GGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGG 190
           T     S G   GGG  GGG  GGG   GG  GGG SGGG S GG  G    GGG SGGG
Sbjct: 151 TSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGG 210

Query: 191 --GGYSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GG +S GG  GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 211 TSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 254

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/97 (54%), Positives = 57/97 (58%), Gaps = 9/97 (9%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG---GGYSGGGGSYGGGGGRREGGGGYSGGG--GGYSSRG 211
           G+ GGG   GG  GG  SGGG   GG SGGG S GG  G    GGG SGGG  GG +S G
Sbjct: 165 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 224

Query: 212 G--GGGSYGGGRREGGGGYGGGEGGGY--GGSGGGGG 310
           G  GGG+ GGG   GG   GG  GGG   GG+ GGGG
Sbjct: 225 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGG 261

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/107 (48%), Positives = 57/107 (53%), Gaps = 7/107 (6%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGG---GGGYSGGGGSYGGGGGRREGGGGYS 181
           G + + N     G+ G G   GG  GG  SGG   GGG SGGG S GG  G    GGG S
Sbjct: 138 GGNASGNGGSGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTS 197

Query: 182 GGG--GGYSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG  GG +S GG  GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 198 GGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 244

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/101 (49%), Positives = 54/101 (53%), Gaps = 13/101 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGG---GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 217
           G+ GGG   GG  GG  SGGG   GG SGGG S GG  G    GGG SGGG       GG
Sbjct: 200 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 259

Query: 218 GGSYGGGRREGGG-----GYGG-----GEGGGYGGSGGGGG 310
           GG  GGG  +GGG     G+G      G GGG+G  GGG G
Sbjct: 260 GGHGGGGDGDGGGHGNGGGHGDGGGGHGNGGGHGDGGGGHG 300

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 50/102 (49%), Positives = 52/102 (50%), Gaps = 6/102 (5%)
 Frame = +2

Query: 23  TVNEAQSRGSGGGGGHRGGGGGGYRSGG--GGGYSGGGGSYGGGGGRREGGGGYSGGG-- 190
           T       G GG     GG GGG    G  GGG SGGG S GG  G    GGG SGGG  
Sbjct: 128 TSGSTSGTGRGGNASGNGGSGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTS 187

Query: 191 GGYSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GG +S GG  GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 188 GGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 229

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/93 (44%), Positives = 47/93 (50%), Gaps = 1/93 (1%)
 Frame = +2

Query: 35  AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 214
           A + G+ G G  RG GG    +GG  G  GGG   GGG G   G GG+  GGG  +  G 
Sbjct: 423 AGNGGANGVGNGRGNGGNSGNAGGSNGNGGGGAGNGGGSGGANGTGGHGNGGGNGNGNGS 482

Query: 215 GGGSYGGGRREGGG-GYGGGEGGGYGGSGGGGG 310
           GG   GG    G G G G G GGG+G  G  GG
Sbjct: 483 GGAGNGGANGVGNGHGTGNGNGGGHGNGGSSGG 515

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 48/114 (42%), Positives = 54/114 (47%), Gaps = 14/114 (12%)
 Frame = +2

Query: 11  GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGG-------GYSGGGGSYGGGGGRREGG 169
           GR +    A + GSG G G+  G GGG  +G GG       G +G GG+ GG  G   G 
Sbjct: 76  GRGVGNGGAGAGGSGSGNGNGSGNGGGNGNGSGGNNGNGAVGPAGVGGTTGGTSGSTSGT 135

Query: 170 G------GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG-EGGGYGGSGGGGG 310
           G      G  G GGG S  G  GG   GG   GGG  GGG  GGG  G G  GG
Sbjct: 136 GRGGNASGNGGSGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 189

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 47/93 (50%), Positives = 50/93 (53%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYR-SGGGGGYSGGGGSYGGGGGRREGGGGYSGGG--GGYSSRGG- 214
           G  G GG  GG  G    +G GG  SG GGS GG  G    GGG SGGG  GG +S GG 
Sbjct: 117 GPAGVGGTTGGTSGSTSGTGRGGNASGNGGSGGGTSGSGTSGGGTSGGGTSGGGTSGGGT 176

Query: 215 -GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 177 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 209

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/93 (47%), Positives = 50/93 (53%), Gaps = 5/93 (5%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGG-GGRREGGGGYSGGG--GGYSSRGG- 214
           G+ G     G GG    +GG GG + G G+ GGG  G    GGG SGGG  GG +S GG 
Sbjct: 127 GTSGSTSGTGRGGNASGNGGSGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 186

Query: 215 -GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 187 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 219

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/101 (49%), Positives = 53/101 (52%), Gaps = 6/101 (5%)
 Frame = +2

Query: 26  VNEAQSRGSGGG--GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG--G 193
           V  A   G+ GG  G   G G GG  SG GG  SGGG S  G  G    GGG SGGG  G
Sbjct: 116 VGPAGVGGTTGGTSGSTSGTGRGGNASGNGG--SGGGTSGSGTSGGGTSGGGTSGGGTSG 173

Query: 194 GYSSRGG--GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G +S GG  GGG+ GGG   GG   GG  GGG  G G  GG
Sbjct: 174 GGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 214

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 44/110 (40%), Positives = 51/110 (46%), Gaps = 12/110 (10%)
 Frame = +2

Query: 17  SITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGY-SGGGGSYGGGGGRREGGGGYSGG-- 187
           ++ V   +  G+GG G    G G G  SG GGG  +G GG+ G G     G GG +GG  
Sbjct: 70  AVHVYAGRGVGNGGAGAGGSGSGNGNGSGNGGGNGNGSGGNNGNGAVGPAGVGGTTGGTS 129

Query: 188 --------GGGYSSRGGGGGSYGGGRREGGGGYGGG-EGGGYGGSGGGGG 310
                   GG  S  GG GG   G    GGG  GGG  GGG  G G  GG
Sbjct: 130 GSTSGTGRGGNASGNGGSGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGG 179

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 36/79 (45%), Positives = 41/79 (51%)
 Frame = +2

Query: 50  SGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 229
           SG  GG  G GGGG  +GGG G + G G +G GGG   G G  SGG G   + G G G  
Sbjct: 441 SGNAGGSNGNGGGGAGNGGGSGGANGTGGHGNGGGNGNGNG--SGGAGNGGANGVGNGHG 498

Query: 230 GGGRREGGGGYGGGEGGGY 286
            G    GG G GG  GG +
Sbjct: 499 TGNGNGGGHGNGGSSGGNH 517

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 34/75 (45%), Positives = 40/75 (53%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           N   S G+GGGG   GGG GG    GG G  GG G+  G GG   G GG +G G G+ + 
Sbjct: 443 NAGGSNGNGGGGAGNGGGSGGANGTGGHGNGGGNGNGNGSGG--AGNGGANGVGNGHGTG 500

Query: 209 GGGGGSYGGGRREGG 253
            G GG +G G   GG
Sbjct: 501 NGNGGGHGNGGSSGG 515

[215][TOP]
>UniRef100_Q0BCI9 Putative uncharacterized protein n=1 Tax=Burkholderia ambifaria
           AMMD RepID=Q0BCI9_BURCM
          Length = 529

 Score =  112 bits (279), Expect = 2e-23
 Identities = 53/89 (59%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGG-GGRREGGGGYSGGGGGYSSRGGGGG 223
           G G GGG+ GG GGG   G GGG+ GG G +G G GG   G G  +GGGGG    GGGGG
Sbjct: 356 GGGNGGGNGGGNGGGNGGGNGGGHGGGSGGHGNGNGGHGNGNGNGNGGGGGGGGGGGGGG 415

Query: 224 SYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
             GGG   GGGG GGG GGG GG GGGGG
Sbjct: 416 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 444

 Score =  112 bits (279), Expect = 2e-23
 Identities = 56/88 (63%), Positives = 59/88 (67%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G G GGGH GGG GG+ +G GG  +G G   GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 372 GGGNGGGH-GGGSGGHGNGNGGHGNGNGNGNGGGGGGGGGGGGGGGGGGG----GGGGGG 426

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            GGG   GGGG GGG GGG GGSGGGGG
Sbjct: 427 GGGGGGGGGGGGGGGGGGGSGGSGGGGG 454

 Score =  110 bits (274), Expect = 6e-23
 Identities = 54/89 (60%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGG G  G G GG+ +G G G  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 378 GHGGGSGGHGNGNGGHGNGNGNGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 437

Query: 227 YGGGRREGGGGYGGGEG-GGYGGSGGGGG 310
            GGG   G GG GGG G GG GGSGG GG
Sbjct: 438 GGGGGGGGSGGSGGGGGSGGSGGSGGAGG 466

 Score =  109 bits (272), Expect = 1e-22
 Identities = 53/88 (60%), Positives = 56/88 (63%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGG  GGGGG   GG G SGGGGG    GG GG+
Sbjct: 405 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGGSGGSGGSGGA 464

Query: 227 YGGGRREGGGGYGGGEGGGYGGSGGGGG 310
            G G +  GGG  GG G G  G+GGG G
Sbjct: 465 GGSGGQGNGGGSTGGHGIGGHGNGGGNG 492

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/101 (56%), Positives = 58/101 (57%), Gaps = 7/101 (6%)
 Frame = +2

Query: 29  NEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 208
           N     G+G G G  GGGGGG   GGGGG  GGGG  GGGGG   GGGG  GGGGG    
Sbjct: 390 NGGHGNGNGNGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGS 449

Query: 209 GGGGGSYGGGRREGGGGYGG-GEGG------GYGGSGGGGG 310
           GGGGGS G G   G GG GG G GG      G GG G GGG
Sbjct: 450 GGGGGSGGSGGSGGAGGSGGQGNGGGSTGGHGIGGHGNGGG 490

 Score =  107 bits (268), Expect = 3e-22
 Identities = 53/100 (53%), Positives = 56/100 (56%), Gaps = 12/100 (12%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY--------- 199
           G G GGGH GG GGG   G GGG  GG G   GGG     GGG+ GG GG+         
Sbjct: 336 GGGNGGGHGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGHGGGSGGHGNGNGGHGN 395

Query: 200 ---SSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
              +  GGGGG  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 396 GNGNGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 435

 Score =  107 bits (268), Expect = 3e-22
 Identities = 53/90 (58%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGG-GGSYGGG-GGRREGGGGYSGGGGGYSSRGGGG 220
           G G GGG+ GG GGG   G GGG  GG GG +GGG GG   G GG+  G G  +  GGGG
Sbjct: 348 GGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGHGGGSGGHGNGNGGHGNGNGNGNGGGGGG 407

Query: 221 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           G  GGG   GGGG GGG GGG GG GGGGG
Sbjct: 408 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 437

 Score =  107 bits (268), Expect = 3e-22
 Identities = 54/91 (59%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           G GGGGG  GGGGGG   GGGGG  GGGGS G GGG   GG G SGG GG   +G GGGS
Sbjct: 417 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGGSGGSGGSGGAGGSGGQGNGGGS 476

Query: 227 YGG---GRREGGGGYGGGEGGGYGGSGGGGG 310
            GG   G    GGG G G G G  GSGG  G
Sbjct: 477 TGGHGIGGHGNGGGNGNGNGNGGAGSGGANG 507

 Score =  107 bits (267), Expect = 4e-22
 Identities = 53/92 (57%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSG--GGGSYGGGGGRREG--GGGYSGGGGGYSSRGG 214
           G GGGGGH GG GGG+  G GGG  G  GGGS GG GG   G  GGG+ GG GG +  G 
Sbjct: 296 GGGGGGGHGGGNGGGHGGGNGGGNGGGSGGGSGGGHGGGNGGGNGGGHGGGNGGGNGGGN 355

Query: 215 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 310
           GGG+ GG     GGG GGG GGG+GG  GG G
Sbjct: 356 GGGNGGGNGGGNGGGNGGGNGGGHGGGSGGHG 387

 Score =  107 bits (267), Expect = 4e-22
 Identities = 52/88 (59%), Positives = 54/88 (61%)
 Frame = +2

Query: 47  GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 226
           GSGG G   GG G G  +G GGG  GGGG  GGGGG   GGGG  GGGGG    GGGGG 
Sbjct: 382 GSGGHGNGNG