AV549289 ( RZ05h01R )

[UP]


[1][TOP]
>UniRef100_Q9SXE9 T3P18.4 n=1 Tax=Arabidopsis thaliana RepID=Q9SXE9_ARATH
          Length = 152

 Score =  289 bits (740), Expect = 9e-77
 Identities = 152/152 (100%), Positives = 152/152 (100%)
 Frame = +2

Query: 65  MATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET 244
           MATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET
Sbjct: 1   MATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET 60

Query: 245 EKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEA 424
           EKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEA
Sbjct: 61  EKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEA 120

Query: 425 PVVVEEEKKPEAEEEKPAVEASVTAPVEKADE 520
           PVVVEEEKKPEAEEEKPAVEASVTAPVEKADE
Sbjct: 121 PVVVEEEKKPEAEEEKPAVEASVTAPVEKADE 152

[2][TOP]
>UniRef100_Q8LBZ8 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8LBZ8_ARATH
          Length = 152

 Score =  289 bits (739), Expect = 1e-76
 Identities = 151/152 (99%), Positives = 152/152 (100%)
 Frame = +2

Query: 65  MATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET 244
           MAT+EVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET
Sbjct: 1   MATVEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET 60

Query: 245 EKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEA 424
           EKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEA
Sbjct: 61  EKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEA 120

Query: 425 PVVVEEEKKPEAEEEKPAVEASVTAPVEKADE 520
           PVVVEEEKKPEAEEEKPAVEASVTAPVEKADE
Sbjct: 121 PVVVEEEKKPEAEEEKPAVEASVTAPVEKADE 152

[3][TOP]
>UniRef100_C0Z2B3 AT1G62480 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2B3_ARATH
          Length = 117

 Score =  127 bits (318), Expect(2) = 7e-55
 Identities = 65/66 (98%), Positives = 66/66 (100%)
 Frame = +2

Query: 65  MATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET 244
           MATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET
Sbjct: 1   MATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET 60

Query: 245 EKPIEE 262
           EKPIE+
Sbjct: 61  EKPIEQ 66

 Score =  111 bits (278), Expect(2) = 7e-55
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 355 EQNRGSCRGEERGRSRRKEDRGSSSGCGGREEARGRGGETRRGSLRDSSSGEG 513
           EQNRGSCRGEERGRSRRKEDRGSSSGCGGREEARGRGGETRRGSLRDSSSGEG
Sbjct: 65  EQNRGSCRGEERGRSRRKEDRGSSSGCGGREEARGRGGETRRGSLRDSSSGEG 117

[4][TOP]
>UniRef100_Q9LRH2 Vacuolar calcium binding protein n=1 Tax=Raphanus sativus
           RepID=Q9LRH2_RAPSA
          Length = 248

 Score =  145 bits (365), Expect = 3e-33
 Identities = 93/173 (53%), Positives = 106/173 (61%), Gaps = 34/173 (19%)
 Frame = +2

Query: 65  MATIEVEQVTPVAAENIEVPPPKAVESEEVTT---VSESLPAPVTESQ------------ 199
           MAT +VEQVTP AAE++EV PPK V  EE      V++S PAPVTE++            
Sbjct: 1   MATADVEQVTPAAAEHVEVTPPKTVAPEETVAAAVVADSAPAPVTETETPVKETEETKTE 60

Query: 200 ---------APVEVTTKDLVVEETEKPIEETEEAQVETPEVVEIKKDEEA----PVETPV 340
                    APVEVTTKDL VEE    +EE    + +T EVVE KK+EE       ETP 
Sbjct: 61  TEEIKKEEEAPVEVTTKDLPVEEAPAAVEE----ESKTEEVVEPKKEEEVEETKTEETPA 116

Query: 341 VVEDESKTEEVVEAKKEEEVEEKKTEEAPVVVEEEKK------PEAEEEKPAV 481
           VVE+ESKTEEVVE KKEEEVEE KTEE P VVEEE K      P+ EEE PAV
Sbjct: 117 VVEEESKTEEVVEPKKEEEVEETKTEETPAVVEEESKAEDVVEPKKEEETPAV 169

[5][TOP]
>UniRef100_O65370 F12F1.4 protein n=1 Tax=Arabidopsis thaliana RepID=O65370_ARATH
          Length = 138

 Score =  103 bits (258), Expect = 7e-21
 Identities = 75/159 (47%), Positives = 89/159 (55%), Gaps = 7/159 (4%)
 Frame = +2

Query: 65  MATIEVEQVTPVAAENIEVPPPKA----VESEEVTTVSESLPAPVTE--SQAPVEVTTKD 226
           MAT+EVEQVTPVA EN+EVP        VE+E      ES+PA VTE  S+AP+  T ++
Sbjct: 1   MATVEVEQVTPVAVENVEVPTKTVEETVVETEVTQQPEESVPA-VTEQKSEAPIVETNEE 59

Query: 227 LVVEETEKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEE 406
           +VVEE EK  EETE+   E  E  E+        ETPVV E+E K EEV           
Sbjct: 60  VVVEEAEKKDEETEKKTEEKDEKTEV------ITETPVVEEEEKKAEEVT---------- 103

Query: 407 KKTEEAPVVVEEEKKPEAEEEKPA-VEASVTAPVEKADE 520
               E P VVEEEKK E  EEK   V A+    VEKA+E
Sbjct: 104 ----ETPAVVEEEKKTEVVEEKQTEVAAAEEVAVEKAEE 138

[6][TOP]
>UniRef100_Q8E473 Putative uncharacterized protein gbs1529 n=1 Tax=Streptococcus
            agalactiae serogroup III RepID=Q8E473_STRA3
          Length = 1310

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 61/161 (37%), Positives = 89/161 (55%), Gaps = 10/161 (6%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 978  STSTSTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSA 1037

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-------- 187
            +T  ST AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S         
Sbjct: 1038 STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSA 1097

Query: 186  -TGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T A   S T  ++S ST+     SM SA+T  + S SM A
Sbjct: 1098 STSASTSSSTSASTSASTSASTSASM-SASTSASTSASMSA 1137

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 55/152 (36%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+ST
Sbjct: 922  SMSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTST 981

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S +   ST AS+ +S   S+S++T + +  ST A  S + +   S 
Sbjct: 982  STSASTSASTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSA 1041

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S SM A
Sbjct: 1042 STSASTSASMSASTSASTSASTSASTSASMSA 1073

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 53/152 (34%), Positives = 86/152 (56%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1034 STSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSA 1093

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S+  S S++T + +  ST A  S + +   S 
Sbjct: 1094 STSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSA 1153

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  +S+ ++     ++  SA+T  + S S  A
Sbjct: 1154 STSSSTSASMSASTSASMSASTSASTSASTSA 1185

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 59/156 (37%), Positives = 86/156 (55%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 998  SMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSA 1057

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S  +S ++  ST AS+ +S   S S++T +    ST +  S  T A   +
Sbjct: 1058 STSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSA 1117

Query: 165  ETVVTSSDSTAFGGGTSM---FSAATGVTCSTSMVA 67
             T  + S ST+     SM    SA+T  + S SM A
Sbjct: 1118 STSASMSASTSASTSASMSASTSASTSASTSASMSA 1153

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 886  STSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASTSASMSA 945

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 946  STSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA 1005

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1006 STSASTSASMSASTSASISASTSASMSASTSA 1037

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 53/152 (34%), Positives = 87/152 (57%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST + T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S+
Sbjct: 1098 STSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSS 1157

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S  +S ++  ST AS+ +S+  S SS+T + +  ST A  S + +   S 
Sbjct: 1158 STSASMSASTSASMSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSA 1217

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T V+ S S  A
Sbjct: 1218 STSASMSASTSASMSATTSASTSVSTSASTSA 1249

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 59/161 (36%), Positives = 85/161 (52%), Gaps = 6/161 (3%)
 Frame = -1

Query: 531  LHIYSSAFSTGAVTEAST-----AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTS 367
            + + S + ST A T AST     A  S+S S   S+ST+   S+   +STS+S  AST++
Sbjct: 638  IKLLSESASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTST 697

Query: 366  SVLLSSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV 187
            S   S+S +T  ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S 
Sbjct: 698  STSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 757

Query: 186  -TGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T A   + T  ++S ST+     SM SA+T  + S S  A
Sbjct: 758  STSASTSASTSASTSASTSASMSASM-SASTSASMSASTSA 797

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 57/151 (37%), Positives = 86/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 694  STSTSTSASTSAST---SASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSAS 750

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S+  S+S++T + +  ST A    T A   + T
Sbjct: 751  TSASTSASTSASTSASTSASTSASTSASMSASMSASTSASMSASTSA---STSASTSAST 807

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              ++S ST+     S  SA+T  + S SM A
Sbjct: 808  SASTSASTSASMSAST-SASTSASTSASMSA 837

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 746  STSASTSASTSASTSASTSASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSA 805

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S+  S S++T +    ST A  S + +   S 
Sbjct: 806  STSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSA 865

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  S +T  + S S  A
Sbjct: 866  STSASTSASMSASTSASTSPSTSASTSASTSA 897

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 61/164 (37%), Positives = 85/164 (51%), Gaps = 13/164 (7%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+ST
Sbjct: 798  STSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTST 857

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-------- 187
            +T  ST AS+S   S +   ST AS+  S   S S++T +    ST A  S         
Sbjct: 858  STSASTSASTSASTSASMSASTSASTSPSTSASTSASTSASTSASTSASTSASMSASTSA 917

Query: 186  -TGAGRDSETVVTSSDSTAFGGGTSM---FSAATGVTCSTSMVA 67
             T A   + T  ++S ST+     SM    SA+T  + S SM A
Sbjct: 918  STSASMSASTSASTSASTSASTSASMSASTSASTSASTSASMSA 961

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 52/152 (34%), Positives = 87/152 (57%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 822  STSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA 881

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S+  S S++T + +  ST A  S + +   S 
Sbjct: 882  STSPSTSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASTSA 941

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 942  SMSASTSASTSASTSASMSASTSASTSASTSA 973

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 54/152 (35%), Positives = 87/152 (57%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 906  STSASMSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSA 965

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   ST++  ST AS+ +S   S+S++T +    ST A  S + +   S 
Sbjct: 966  STSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA----STSASTSASMSASTSA 1021

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S SM A
Sbjct: 1022 SISASTSASMSASTSASTSASTSASTSASMSA 1053

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 48/150 (32%), Positives = 84/150 (56%)
 Frame = -1

Query: 516  SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            SA ++ +++ +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S S +T
Sbjct: 1016 SASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSAST 1075

Query: 336  GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETV 157
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S ++
Sbjct: 1076 SASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASM 1135

Query: 156  VTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S+ ++     ++  SA+T  + S SM A
Sbjct: 1136 SASTSASTSASTSASMSASTSSSTSASMSA 1165

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 670  SMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSA 729

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 730  STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSASMSASTSA 789

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S SM A
Sbjct: 790  SMSASTSASTSASTSASTSASTSASTSASMSA 821

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 59/161 (36%), Positives = 86/161 (53%), Gaps = 10/161 (6%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 766  STSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSA 825

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-------- 187
            +T  ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S         
Sbjct: 826  STSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSP 885

Query: 186  -TGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T A   + T  ++S ST+     SM SA+T  + S SM A
Sbjct: 886  STSASTSASTSASTSASTSASTSASM-SASTSASTSASMSA 925

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1050 SMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSA 1109

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS  +S   S S++T + +  ST +  S + +   S 
Sbjct: 1110 STSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSSSTSASMSASTSA 1169

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S SM A
Sbjct: 1170 SMSASTSASTSASTSASMSASTSSSTSASMSA 1201

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 59/153 (38%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STSSS  AST++S   S+S 
Sbjct: 1062 STSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSA 1121

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S  +S ++  ST AS+ +S+  S SS+T + +  ST A  S  T A   +
Sbjct: 1122 SMSASTSASTSASMSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSA 1181

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  + S ST+     SM SA+T  + S S  A
Sbjct: 1182 STSASMSASTSSSTSASM-SASTSASMSASTSA 1213

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   SSST+   S+   +STS+S  AST++S   S S 
Sbjct: 1078 STSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASMSA 1137

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS  +S   S+S++T +    ST A  S + +   S 
Sbjct: 1138 STSASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSASTSSSTSA 1197

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 1198 SMSASTSASMSASTSASTSASTSASMSASTSA 1229

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +   S+   +STS+S  AST++S   S S 
Sbjct: 762  STSASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSA 821

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 822  STSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA 881

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S SM A
Sbjct: 882  STSPSTSASTSASTSASTSASTSASTSASMSA 913

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 52/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 698  STSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 757

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  S  AS  +S   S+S++T +    ST A  S + +   S 
Sbjct: 758  STSASTSASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSA 817

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 818  SMSASTSASTSASTSASMSASTSASTSASTSA 849

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 58/153 (37%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S S 
Sbjct: 726  STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSASMSA 785

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  S  AS+S   S ++  ST AS+ +S   S+S++T +    ST A  S  T A   +
Sbjct: 786  STSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSA 845

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+     S  SA+T  + S SM A
Sbjct: 846  STSASTSASTSTSTSAST-SASTSASTSASMSA 877

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 59/160 (36%), Positives = 85/160 (53%), Gaps = 9/160 (5%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 858  STSASTSASTSASTSASMSASTSASTSPSTSASTSASTSASTSASTSASTSASMSASTSA 917

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGA 178
            +T  S  AS+S   S ++  ST AS  +S   S S++T + +  ST A  S      T A
Sbjct: 918  STSASMSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSA 977

Query: 177  GRDSETVVTSSDSTAFGGGTSM---FSAATGVTCSTSMVA 67
               + T  ++S ST+     SM    SA+T  + S SM A
Sbjct: 978  STSTSTSASTSASTSASTSASMSASTSASTSASTSASMSA 1017

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 57/152 (37%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A T AST   S+S S   S+ST+   S    +STS+S  AST++S   S+S +
Sbjct: 854  STSTSTSASTSAST---SASTSASMSASTSASTSPSTSASTSASTSASTSASTSASTSAS 910

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S  T A   + 
Sbjct: 911  MSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSAS 970

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S  SA+T  + S SM A
Sbjct: 971  TSASTSASTSTSTSAST-SASTSASTSASMSA 1001

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 53/152 (34%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   SS   +STS+S  AST++S+  S+S 
Sbjct: 1070 SMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSA 1129

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S ++  S  AS+ SS   S+S++T + +  ST A  S + +   S 
Sbjct: 1130 STSASMSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSA 1189

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  +S+ ++     ++  SA+T  + S S  A
Sbjct: 1190 STSSSTSASMSASTSASMSASTSASTSASTSA 1221

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 942  SMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSA 1001

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  S  AS+ +S+  S S++T +    ST A  S + +   S 
Sbjct: 1002 STSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSA 1061

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1062 STSASTSASMSASTSASTSASTSASTSASTSA 1093

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 52/149 (34%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 962  STSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASMSASTSA 1021

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS S   S ++  ST AS+ +S+  S S++T +    ST A  S++ +   S 
Sbjct: 1022 SISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSA--SMSASTSAST 1079

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +   + STS
Sbjct: 1080 SASTSASTSASTSASTSASTSASTSSSTS 1108

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 51/149 (34%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1006 STSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA 1065

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S ++  ST AS+ +S   S S++T S    ST A  S + +   S 
Sbjct: 1066 STSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSA 1125

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++     ++  SA+T  + S S
Sbjct: 1126 STSASTSASMSASTSASTSASTSASMSAS 1154

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 658  SMSASTSASTSASMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSASMSA 717

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 718  STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 777

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S  ++     ++  SA+T  + S S  A
Sbjct: 778  SMSASMSASTSASMSASTSASTSASTSASTSA 809

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 662  STSASTSASMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA 721

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 722  STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSA 781

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 782  SMSASTSASMSASTSASTSASTSASTSASTSA 813

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST   T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 878  STSASTSPSTSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSA 937

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S ++  S  AS+ +S   S S++T +   TST A  S + +   S 
Sbjct: 938  STSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSA 997

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 998  SMSASTSASTSASTSASMSASTSASISASTSA 1029

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 52/149 (34%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 718  STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 777

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   S  AS+S  +S ++  ST AS+ +S   S S++T + +  ST A  S + +   S 
Sbjct: 778  SMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSA--STSASTSASM 835

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +T  + STS
Sbjct: 836  SASTSASTSASTSASTSASTSTSTSASTS 864

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 57/157 (36%), Positives = 84/157 (53%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 930  STSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSA 989

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGA 178
            +T  ST AS S   S ++  ST AS  +S   S+S++T + +  ST A  S      T A
Sbjct: 990  STSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSA 1049

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               + T  ++S ST+     SM SA+T  + S S  A
Sbjct: 1050 SMSASTSASTSASTSASTSASM-SASTSASTSASTSA 1085

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 57/152 (37%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 1030 SMSASTSASTSAST---SASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSAS 1086

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S  T A   + 
Sbjct: 1087 TSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTSASTSAS 1146

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  + S ST+     SM SA+T  + S S  A
Sbjct: 1147 TSASMSASTSSSTSASM-SASTSASMSASTSA 1177

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 58/157 (36%), Positives = 82/157 (52%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 706  STSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 765

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGA 178
            +T  ST AS+S  +S +   ST AS  +S   S S++T +    ST A  S      T A
Sbjct: 766  STSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSA 825

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               + T  + S ST+     S  SA+T  + STS  A
Sbjct: 826  STSASTSASMSASTSASTSAST-SASTSASTSTSTSA 861

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 754  STSASTSASTSASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSA 813

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S ++  S  AS+ +S   S S++T +   TST A  S + +   S 
Sbjct: 814  STSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSA 873

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 874  SMSASTSASTSPSTSASTSASTSASTSASTSA 905

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 56/153 (36%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 702  STSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 761

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S +   S  AS+ +S+  S S++T +    ST A  S  T A   +
Sbjct: 762  STSASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSA 821

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+     S  SA+T  + S S  A
Sbjct: 822  STSASTSASTSASMSAST-SASTSASTSASTSA 853

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 58/151 (38%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A T AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 794  STSASTSASTSASTSA-STSASTSASMSASTSASTS--ASTSASMSASTSASTSASTSAS 850

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST  S+S   S ++  ST AS  +S   S S +T +    ST A    T A   + T
Sbjct: 851  TSASTSTSTSASTSASTSASTSASMSASTSASTSPSTSASTSASTSA---STSASTSAST 907

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              + S ST+     SM SA+T  + S S  A
Sbjct: 908  SASMSASTSASTSASM-SASTSASTSASTSA 937

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ S  A T AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 918  STSASMSASTSASTSA-STSASTSASMSASTSASTS--ASTSASMSASTSASTSASTSAS 974

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST  S+S   S ++  ST AS  +S   S S++T + +  ST A  S  T A   + 
Sbjct: 975  TSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSAS 1034

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     SM SA+T  + S S  A
Sbjct: 1035 TSASTSASTSASTSASM-SASTSASTSASTSA 1065

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/149 (34%), Positives = 78/149 (52%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +   S+   +STS+S  AST+SS   S S 
Sbjct: 1106 STSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSSSTSASMSA 1165

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S ++  S  AS+ SS   S+S++T + +  ST A  S + +   S 
Sbjct: 1166 STSASMSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSA 1225

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S  +T     +   SA+T  + S S
Sbjct: 1226 STSASMSATTSASTSVSTSASTSASTSAS 1254

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 59/156 (37%), Positives = 85/156 (54%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 834  SMSASTSASTSASTSA-STSASTSTSTSASTSASTS--ASTSASMSASTSASTSPSTSAS 890

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGAG 175
            T  ST AS+S   S ++  S  AS+ +S   S+S++T +    ST A  S      T A 
Sbjct: 891  TSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASTSASMSASTSAS 950

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              + T  + S ST+     S  SA+T  + STS  A
Sbjct: 951  TSASTSASMSASTSASTSAST-SASTSASTSTSTSA 985

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST+   S+S S   S+ST+   S+   +STS S  AST++S   S+S 
Sbjct: 842  STSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSPSTSASTSASTSASTSA 901

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  S  AS+ +S   S S++T + +  ST A  S + +   S 
Sbjct: 902  STSASTSASMSASTSASTSASMSASTSASTSASTSASTSASMSASTSA--STSASTSASM 959

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +T  + STS
Sbjct: 960  SASTSASTSASTSASTSASTSTSTSASTS 988

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST   T AST+  S+SAS   S S +T AS+   +STS+S  AST++S+  S+S +
Sbjct: 974  STSASTSTSTSASTSA-STSASTSASMSASTSASTS--ASTSASMSASTSASISASTSAS 1030

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  S  AS+ +S   S S++T + +  ST A  S + +   S +
Sbjct: 1031 MSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSAS 1090

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     +S  SA+T  + S S  A
Sbjct: 1091 TSASTSASTSASTSSSTSASTSASTSASTSA 1121

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 51/152 (33%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1038 STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSA 1097

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST +S+S   S ++  ST AS  +S   S S++  +    ST A  S + +   S 
Sbjct: 1098 STSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSS 1157

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T  + S SM A
Sbjct: 1158 STSASMSASTSASMSASTSASTSASTSASMSA 1189

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 49/149 (32%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AST A  S+S S   S+ST+   S+   SSTS+S  AST++S+  S+S 
Sbjct: 1118 STSASMSASTSASTSASMSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASTSA 1177

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S+++  S  AS+ +S+  S S++T +    S  A  S + +   S 
Sbjct: 1178 STSASTSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSASTSASMSATTSA 1237

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++     ++  S+++ VT ++S
Sbjct: 1238 STSVSTSASTSASTSASTSSSSSVTSNSS 1266

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AST A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 654  STSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSA 713

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 714  SMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 773

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T  + S S  A
Sbjct: 774  STSASMSASMSASTSASMSASTSASTSASTSA 805

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 51/152 (33%), Positives = 79/152 (51%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 714  SMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 773

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS S   S +   ST AS+ +S   S S++T +    S  A  S + +   S 
Sbjct: 774  STSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSA 833

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 834  SMSASTSASTSASTSASTSASTSTSTSASTSA 865

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/156 (33%), Positives = 86/156 (55%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 946  STSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA 1005

Query: 342  TTGVST----GASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            +T  ST     AS+S  IS ++  S  AS+ +S   S S++T + +  ST A  S + + 
Sbjct: 1006 STSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA 1065

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 1066 STSASMSASTSASTSASTSASTSASTSASTSASTSA 1101

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 47/140 (33%), Positives = 77/140 (55%), Gaps = 1/140 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+S +   S+   +STS+S  AST++S+  S+S+
Sbjct: 1134 SMSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSASTSS 1193

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S  +S ++  ST AS+ +S+  S S++  +    ST    S + +   S 
Sbjct: 1194 STSASMSASTSASMSASTSASTSASTSASMSASTSASMSATTSASTSVSTSASTSASTSA 1253

Query: 162  TVVTSSDSTAFGGGTSMFSA 103
            +  +SS  T+      ++SA
Sbjct: 1254 STSSSSSVTSNSSKEKVYSA 1273

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/155 (34%), Positives = 86/155 (55%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS--- 349
            S + ST A T AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+   
Sbjct: 958  SMSASTSASTSASTSA-STSASTSTSTSASTSASTS--ASTSASMSASTSASTSASTSAS 1014

Query: 348  -STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGR 172
             S +T  S  AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S + +  
Sbjct: 1015 MSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSAS 1074

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             S +   S+ ++     ++  SA+T  + S+S  A
Sbjct: 1075 TSASTSASTSASTSASTSASTSASTSASTSSSTSA 1109

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/148 (34%), Positives = 83/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ S  A T AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1046 STSASMSASTSASTSA-STSASTSASMSASTSASTS--ASTSASTSASTSASTSASTSAS 1102

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  S  AS+ +S   S+S++T +    ST A  S + +   S +
Sbjct: 1103 TSSSTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSSSTSAS 1162

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  S+ ++     ++  SA+T  + S S
Sbjct: 1163 MSASTSASMSASTSASTSASTSASMSAS 1190

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 50/139 (35%), Positives = 77/139 (55%), Gaps = 6/139 (4%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   SSTS+S  AST++S+  S+S 
Sbjct: 1154 STSSSTSASMSASTSASMSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASTSA 1213

Query: 342  TTGVSTGAS-----SSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGA 178
            +T  ST AS     S+ + +TTS  ++ ++S S+   + +ST+ S  VTS  + + V  A
Sbjct: 1214 STSASTSASMSASTSASMSATTSASTSVSTSASTSASTSASTSSSSSVTSNSSKEKVYSA 1273

Query: 177  GRDSETVVTSSDSTAFGGG 121
               +     S  +TA G G
Sbjct: 1274 LPSTGDQDYSVTATALGLG 1292

[7][TOP]
>UniRef100_Q3D424 Cell wall surface anchor family protein n=1 Tax=Streptococcus
            agalactiae H36B RepID=Q3D424_STRAG
          Length = 1326

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 61/161 (37%), Positives = 89/161 (55%), Gaps = 10/161 (6%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 754  STSTSTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSA 813

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-------- 187
            +T  ST AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S         
Sbjct: 814  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSA 873

Query: 186  -TGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T A   S T  ++S ST+     SM SA+T  + S SM A
Sbjct: 874  STSASTSSSTSASTSASTSASTSASM-SASTSASTSASMSA 913

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 59/153 (38%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 774  SMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSA 833

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S  +S ++  ST AS+ +S   S S++T +    ST +  S  T A   +
Sbjct: 834  STSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSA 893

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  + S ST+     SM SA+T  + S SM A
Sbjct: 894  STSASMSASTSASTSASM-SASTSASTSASMSA 925

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 57/150 (38%), Positives = 85/150 (56%), Gaps = 1/150 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+ +S+S 
Sbjct: 1046 STSASTSASTSASTSASMSASTSASMSASTSASTSASMSASTSASTSASTSASMSVSTSA 1105

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A    T A   + 
Sbjct: 1106 SMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA---STSASTSAS 1162

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSM 73
            T  ++S ST+     SM SA+T  + S SM
Sbjct: 1163 TSASTSASTSASTSASM-SASTSASTSASM 1191

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 59/157 (37%), Positives = 87/157 (55%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 810  STSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSA 869

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGA 178
            +T  ST AS+S   S ++  ST AS+ +S+  S S++T + +  ST A  S      T A
Sbjct: 870  STSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSA 929

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               +    ++S ST+     SM SA+T  + S SM A
Sbjct: 930  STSASMSASTSASTSASTSASM-SASTSSSTSASMSA 965

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 59/156 (37%), Positives = 85/156 (54%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S++
Sbjct: 826  SMSASTSASTSAST---SASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSS 882

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGAG 175
            T  ST AS+S   S +   ST AS+ +S+  S S++T + +  ST A  S      T A 
Sbjct: 883  TSASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSAS 942

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              + T  + S ST+     SM SA+T  + S SM A
Sbjct: 943  TSASTSASMSASTSSSTSASM-SASTSASMSASMSA 977

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 49/151 (32%), Positives = 86/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+ST+
Sbjct: 699  TSASTSASMSASMSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTS 758

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S +   ST AS+ +S   S+S++T + +  ST A  S + +   S +
Sbjct: 759  TSASTSASTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSAS 818

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S SM A
Sbjct: 819  TSASTSASMSASTSASTSASTSASTSASMSA 849

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 60/161 (37%), Positives = 86/161 (53%), Gaps = 10/161 (6%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  SSS S   S+ST+   S+   +STS+S  AS ++S   S+S 
Sbjct: 862  STSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTSASTSA 921

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA---------*DS 190
            +   ST AS+S  +S ++  ST AS+ +S+  S SS+T + +  ST A           S
Sbjct: 922  SMSASTSASTSASMSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASMSASTSS 981

Query: 189  VTGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T A   + T  + S ST+     SM SA+T  + S SM A
Sbjct: 982  STSASMSASTSASMSASTSASTSASM-SASTSASTSASMSA 1021

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 48/151 (31%), Positives = 88/151 (58%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 1091 TSASTSASMSVSTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1150

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S+  S S++T + +  ST A  S + +   S +
Sbjct: 1151 TSASTSASTSASTSASTSASTSASTSASMSASTSASTSASMSVSTSASMSASTSASTSAS 1210

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S+ ++     ++  SA+T  + S SM A
Sbjct: 1211 MSASTSASTSASMSASTSASTSASTSASMSA 1241

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 58/153 (37%), Positives = 83/153 (54%), Gaps = 5/153 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 1122 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSA 1181

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS S   S +   ST AS+ +S+  S S++T + +  ST A  S  T A   +
Sbjct: 1182 STSASTSASMSVSTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSA 1241

Query: 165  ETVVTSSDSTAFGGGTSM---FSAATGVTCSTS 76
             T  + S ST+     SM    SA+T  + S+S
Sbjct: 1242 STSASMSASTSASTSASMSASMSASTSASTSSS 1274

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 58/157 (36%), Positives = 83/157 (52%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 782  STSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA 841

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-----GA 178
            +T  S  AS+S   S ++  ST AS+ +S   S S++T S    ST A  S +      A
Sbjct: 842  STSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSA 901

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               + T  + S ST+     SM SA+T  + S SM A
Sbjct: 902  STSASTSASMSASTSASTSASM-SASTSASTSASMSA 937

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 53/151 (35%), Positives = 84/151 (55%), Gaps = 1/151 (0%)
 Frame = -1

Query: 516  SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            SA ++ +++ +++A  S+S S   S+ST+   S+    STS+S  AST++S   S+S +T
Sbjct: 1064 SASTSASMSASTSASTSASMSASTSASTSASTSASMSVSTSASMSASTSASTSASTSAST 1123

Query: 336  GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + T
Sbjct: 1124 SASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSAST 1183

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              ++S S +     SM SA+T  + S SM A
Sbjct: 1184 SASTSASMSVSTSASM-SASTSASTSASMSA 1213

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 52/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1110 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1169

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  S   S+ +S+  S S++T + +  ST A  S + +   S 
Sbjct: 1170 STSASTSASMSASTSASTSASMSVSTSASMSASTSASTSASMSASTSASTSASMSASTSA 1229

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S SM A
Sbjct: 1230 STSASTSASMSASTSASMSASTSASTSASMSA 1261

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 806  SMSASTSASTSAST---SASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSAS 862

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   S +
Sbjct: 863  TSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTSASTSAS 922

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S+ ++     ++  SA+T  + S SM A
Sbjct: 923  MSASTSASTSASMSASTSASTSASTSASMSA 953

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 718  SMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSA 777

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  S  AS+ +S+  S S++T +    ST A  S + +   S 
Sbjct: 778  STSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSA 837

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 838  STSASTSASMSASTSASTSASTSASTSASTSA 869

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 52/149 (34%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 738  STSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASMSASTSA 797

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS S   S ++  ST AS+ +S+  S S++T +    ST A  S++ +   S 
Sbjct: 798  SISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSA--SMSASTSAST 855

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +   + STS
Sbjct: 856  SASTSASTSASTSASTSASTSASTSSSTS 884

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AST A  S+S S   S+ST+   S+   SSTS+S  AST++S+  S S 
Sbjct: 918  STSASMSASTSASTSASMSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASMSA 977

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S +   ST AS+ +S+  S S++T + +  ST A  S + +   S 
Sbjct: 978  STSSSTSASMSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSASMSA 1037

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1038 STSASTSASTSASTSASTSASTSASMSASTSA 1069

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 59/152 (38%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S S S   S+ST+   S+    STS+S  AST++S   S+S 
Sbjct: 1082 SMSASTSASTSASTSASMSVSTSASMSASTSASTSA----STSASTSASTSASTSASTSA 1137

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T + +  ST A    T A     
Sbjct: 1138 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSASTSA---STSASMSVS 1194

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  + S ST+     SM SA+T  + S SM A
Sbjct: 1195 TSASMSASTSASTSASM-SASTSASTSASMSA 1225

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 47/150 (31%), Positives = 82/150 (54%)
 Frame = -1

Query: 516  SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            SA ++ +++ + +A  SSS S   S+ST+   S+   +STS+S  AST++S   S S +T
Sbjct: 964  SASTSASMSASMSASTSSSTSASMSASTSASMSASTSASTSASMSASTSASTSASMSAST 1023

Query: 336  GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETV 157
              ST AS S  +S ++  ST AS+ +S   S S++T + +  ST A  S + +   S ++
Sbjct: 1024 SASTSASMSASMSASTSASTSASTSASTSASTSASTSASMSASTSASMSASTSASTSASM 1083

Query: 156  VTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S+ ++     ++  S +T  + S S  A
Sbjct: 1084 SASTSASTSASTSASMSVSTSASMSASTSA 1113

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 58/157 (36%), Positives = 85/157 (54%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 878  STSSSTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSA 937

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-----GA 178
            +T  ST AS+S  +S ++  ST AS  +S   S+S++  +   +ST A  S +      A
Sbjct: 938  STSASTSASTSASMSASTSSSTSASMSASTSASMSASMSASTSSSTSASMSASTSASMSA 997

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               + T  + S ST+     SM SA+T  + S SM A
Sbjct: 998  STSASTSASMSASTSASTSASM-SASTSASTSASMSA 1033

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 58/153 (37%), Positives = 82/153 (53%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STSSS  AST++S   S+S 
Sbjct: 838  STSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSA 897

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-GAGRDS 166
            +   ST AS+S  +S ++  ST AS  +S   S S++  +    ST A  S +  A   S
Sbjct: 898  SMSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSS 957

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  + S ST+     SM SA+T  + S SM A
Sbjct: 958  STSASMSASTSASMSASM-SASTSSSTSASMSA 989

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 52/155 (33%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + +++ +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S S +
Sbjct: 1027 TSASMSASMSASTSASTSASTSASTSASTSASTSASMSASTSASMSASTSASTSASMSAS 1086

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST AS+S  +S ++  S  AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1087 TSASTSASTSASMSVSTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1146

Query: 162  TVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S SM A
Sbjct: 1147 TSASTSASTSASTSASTSASTSASTSASTSASMSA 1181

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 52/151 (34%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST   S+S S   S+S +   S+   +STS+S  AST++S+  S+S +
Sbjct: 686  SMSASTSASMSAST---SASTSASMSASMSASTSASMSASTSASTSASTSASMSASTSAS 742

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   ST++  ST AS+ +S   S+S++T +    ST A  S + +   S +
Sbjct: 743  TSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA----STSASTSASMSASTSAS 798

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S+ ++     ++  SA+T  + S SM A
Sbjct: 799  ISASTSASMSASTSASTSASTSASTSASMSA 829

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 56/153 (36%), Positives = 82/153 (53%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AST A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 690  STSASMSASTSASTSASMSASMSASTSASMSASTSASTSASTSASMSASTSASTSASTSA 749

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST  S+S   S ++  ST AS  +S   S S++T + +  ST A  S  T A   +
Sbjct: 750  STSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSA 809

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+     SM SA+T  + S S  A
Sbjct: 810  STSASTSASTSASTSASM-SASTSASTSASTSA 841

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 50/152 (32%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 1010 STSASTSASMSASTSASTSASMSASMSASTSASTSASTSASTSASTSASTSASMSASTSA 1069

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S  +S ++  ST AS+ +S+  S S++  +    ST A  S + +   S 
Sbjct: 1070 SMSASTSASTSASMSASTSASTSASTSASMSVSTSASMSASTSASTSASTSASTSASTSA 1129

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1130 STSASTSASTSASTSASTSASTSASTSASTSA 1161

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/152 (34%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1114 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1173

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S +  VST AS  +S   S S++  +    ST A  S + +   S 
Sbjct: 1174 STSASMSASTSASTSASMSVSTSASMSASTSASTSASMSASTSASTSASMSASTSASTSA 1233

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T  + S SM A
Sbjct: 1234 STSASMSASTSASMSASTSASTSASMSASMSA 1265

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 50/150 (33%), Positives = 80/150 (53%), Gaps = 1/150 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST + T AS +A  S+S S   S+ST++  S+   +STS+S  AST++S   S S 
Sbjct: 950  SMSASTSSSTSASMSASTSASMSASMSASTSSSTSASMSASTSASMSASTSASTSASMSA 1009

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  S  AS  +S   S S++T +    ST A  S + +   S 
Sbjct: 1010 STSASTSASMSASTSASTSASMSASMSASTSASTSASTSASTSASTSASTSASMSASTSA 1069

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSM 73
            ++  S+ ++     ++  SA+T  + S SM
Sbjct: 1070 SMSASTSASTSASMSASTSASTSASTSASM 1099

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 59/156 (37%), Positives = 84/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 710  SMSASTSASMSASTSA-STSASTSASMSASTSASTS--ASTSASTSASTSTSTSASTSAS 766

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGAG 175
            T  ST AS S   S ++  ST AS  +S   S+S++T + +  ST A  S      T A 
Sbjct: 767  TSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSAS 826

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              + T  ++S ST+     SM SA+T  + S S  A
Sbjct: 827  MSASTSASTSASTSASTSASM-SASTSASTSASTSA 861

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST   T AST+  S+SAS   S S +T AS+   +STS+S  AST++S+  S+S +
Sbjct: 750  STSASTSTSTSASTSA-STSASTSASMSASTSASTS--ASTSASMSASTSASISASTSAS 806

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  S  AS+ +S   S S++T + +  ST A  S + +   S +
Sbjct: 807  MSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSAS 866

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     +S  SA+T  + S S  A
Sbjct: 867  TSASTSASTSASTSSSTSASTSASTSASTSA 897

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 49/152 (32%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S+
Sbjct: 898  SMSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSS 957

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S  +S +   ST +S+ +S+  S S++  +    ST A  S + +   S 
Sbjct: 958  STSASMSASTSASMSASMSASTSSSTSASMSASTSASMSASTSASTSASMSASTSASTSA 1017

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 1018 SMSASTSASTSASMSASMSASTSASTSASTSA 1049

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 998  STSASTSASMSASTSASTSASMSASTSASTSASMSASMSASTSASTSASTSASTSASTSA 1057

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S  +S ++  ST AS  +S   S S++T + +  ST A  S + +   S 
Sbjct: 1058 STSASMSASTSASMSASTSASTSASMSASTSASTSASTSASMSVSTSASMSASTSASTSA 1117

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1118 STSASTSASTSASTSASTSASTSASTSASTSA 1149

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 49/152 (32%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 1018 SMSASTSASTSASMSASMSASTSASTSASTSASTSASTSASTSASMSASTSASMSASTSA 1077

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S ++  S   S+ +S+  S S++T +    ST A  S + +   S 
Sbjct: 1078 STSASMSASTSASTSASTSASMSVSTSASMSASTSASTSASTSASTSASTSASTSASTSA 1137

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1138 STSASTSASTSASTSASTSASTSASTSASTSA 1169

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/156 (33%), Positives = 86/156 (55%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 722  STSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA 781

Query: 342  TTGVST----GASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            +T  ST     AS+S  IS ++  S  AS+ +S   S S++T + +  ST A  S + + 
Sbjct: 782  STSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA 841

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 842  STSASMSASTSASTSASTSASTSASTSASTSASTSA 877

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 56/151 (37%), Positives = 79/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   SSST+   S+   +S S+S  AST+SS   S S +
Sbjct: 934  SMSASTSASTSAST---SASMSASTSSSTSASMSASTSASMSASMSASTSSSTSASMSAS 990

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  S  AS+S   S +   ST AS+ +S+  S S++T + +  S  A    T A   + T
Sbjct: 991  TSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSASMSA---STSASTSAST 1047

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              ++S ST+     SM SA+T  + S S  A
Sbjct: 1048 SASTSASTSASTSASM-SASTSASMSASTSA 1077

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1098 SMSVSTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1157

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  S  AS+ +S   S+S +T + +  ST A  S + +   S 
Sbjct: 1158 STSASTSASTSASTSASTSASMSASTSASTSASMSVSTSASMSASTSASTSASMSASTSA 1217

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+   + S SM A
Sbjct: 1218 STSASMSASTSASTSASTSASMSASTSASMSA 1249

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 49/149 (32%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 1134 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSASTSASTSASMSV 1193

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S +   ST AS+ +S+  S S++T +    S  A  S + +   S 
Sbjct: 1194 STSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSASMSASTSA 1253

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S  ++     ++  S+++ VT ++S
Sbjct: 1254 STSASMSASMSASTSASTSSSSSVTSNSS 1282

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 52/156 (33%), Positives = 81/156 (51%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 650  STSASTSASMSASTSASTSASMSASTSASTSASMSASMSASTSASMSASTSASTSASMSA 709

Query: 342  TTGVSTGASSSFLISTTSGVST----*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            +   ST AS S   S ++  ST     AS+ +S   S S++T +   TST A  S + + 
Sbjct: 710  SMSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSA 769

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 770  STSASMSASTSASTSASTSASMSASTSASISASTSA 805

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AST A  S+S S   S+S +   S+   +STS+S  AST+SS   S S 
Sbjct: 906  STSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSSSTSASMSA 965

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS S   S+++  S  AS+ +S+  S S++T + +  ST A  S + +   S 
Sbjct: 966  STSASMSASMSASTSSSTSASMSASTSASMSASTSASTSASMSASTSASTSASMSASTSA 1025

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T  + S S  A
Sbjct: 1026 STSASMSASMSASTSASTSASTSASTSASTSA 1057

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AS +A  S+S S   S+S +   S+   +STS+S  AST++S   S S 
Sbjct: 1006 SMSASTSASTSASMSASTSASTSASMSASMSASTSASTSASTSASTSASTSASTSASMSA 1065

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S +   ST AS+ +S   S+S +T + +  ST A  S + +   S 
Sbjct: 1066 STSASMSASTSASTSASMSASTSASTSASTSASMSVSTSASMSASTSASTSASTSASTSA 1125

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1126 STSASTSASTSASTSASTSASTSASTSASTSA 1157

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/155 (34%), Positives = 86/155 (55%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS--- 349
            S + ST A T AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+   
Sbjct: 734  SMSASTSASTSASTSA-STSASTSTSTSASTSASTS--ASTSASMSASTSASTSASTSAS 790

Query: 348  -STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGR 172
             S +T  S  AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S + +  
Sbjct: 791  MSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSAS 850

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             S +   S+ ++     ++  SA+T  + S+S  A
Sbjct: 851  TSASTSASTSASTSASTSASTSASTSASTSSSTSA 885

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++    S+S 
Sbjct: 890  STSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSA----STSA 945

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S +   ST AS  +S+  S SS+T + +  ST A  S + +   S 
Sbjct: 946  STSASMSASTSSSTSASMSASTSASMSASMSASTSSSTSASMSASTSASMSASTSASTSA 1005

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S SM A
Sbjct: 1006 SMSASTSASTSASMSASTSASTSASMSASMSA 1037

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 52/151 (34%), Positives = 80/151 (52%), Gaps = 1/151 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AS ++S   S+S 
Sbjct: 1130 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSASTSASTSA 1189

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +  VST AS S   S ++  S  AS+ +S   S+S++T +    ST A      A   + 
Sbjct: 1190 SMSVSTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSA---SMSASTSAS 1246

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMV 70
               ++S ST+     SM ++ +  T S+S V
Sbjct: 1247 MSASTSASTSASMSASMSASTSASTSSSSSV 1277

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   SSST+   S+   +S S+S  AST++S+  S+S 
Sbjct: 954  STSSSTSASMSASTSASMSASMSASTSSSTSASMSASTSASMSASTSASTSASMSASTSA 1013

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S +   S  AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1014 STSASMSASTSASTSASMSASMSASTSASTSASTSASTSASTSASTSASMSASTSASMSA 1073

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1074 STSASTSASMSASTSASTSASTSASMSVSTSA 1105

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 54/153 (35%), Positives = 80/153 (52%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST + T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 974  SMSASTSSSTSASMSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSA 1033

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S+  S S++  +    ST A  S  T A   +
Sbjct: 1034 SMSASTSASTSASTSASTSASTSASTSASMSASTSASMSASTSASTSASMSASTSASTSA 1093

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  + S ST+     S  SA+T  + S S  A
Sbjct: 1094 STSASMSVSTSASMSAST-SASTSASTSASTSA 1125

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 54/162 (33%), Positives = 77/162 (47%), Gaps = 10/162 (6%)
 Frame = -1

Query: 522  YSSAFSTG---------AVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTT 370
            Y S +S G         A  E      S+S S   S+ST+   S+   +STS+S  AST+
Sbjct: 617  YGSKYSYGHTNISGDSDANAEIKLLSESASTSASTSASTSASMSASTSASTSASMSASTS 676

Query: 369  SSVLLSSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DS 190
            +S   S S +   ST AS S   S ++  S  AS  +S   S+S++T +    ST A  S
Sbjct: 677  ASTSASMSASMSASTSASMSASTSASTSASMSASMSASTSASMSASTSASTSASTSASMS 736

Query: 189  V-TGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              T A   + T  ++S ST+     S  SA+T  + S SM A
Sbjct: 737  ASTSASTSASTSASTSASTSTSTSAST-SASTSASTSASMSA 777

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 44/115 (38%), Positives = 66/115 (57%), Gaps = 3/115 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST   S+S S   S+ST+   S+   +STS+S  AST++S+  S+S +
Sbjct: 1190 SMSVSTSASMSAST---SASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSAS 1246

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSL--VVTSTGA*D-SVT 184
               ST AS+S  +S +   ST AS+ SS   + +S+ + +   + STG  D SVT
Sbjct: 1247 MSASTSASTSASMSASMSASTSASTSSSSSVTSNSSKEKVYSALPSTGDQDYSVT 1301

[8][TOP]
>UniRef100_Q3DFZ9 Cell wall surface anchor family protein n=1 Tax=Streptococcus
            agalactiae CJB111 RepID=Q3DFZ9_STRAG
          Length = 1130

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 54/152 (35%), Positives = 86/152 (56%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T  ST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 786  STSASTSASTSTSTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSA 845

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S + +   S 
Sbjct: 846  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSA 905

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ S+     ++  SA+T  + S SM A
Sbjct: 906  STSASTSSSTSASTSASTSASTSASTSASMSA 937

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 59/153 (38%), Positives = 90/153 (58%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST++  S+   +STS+S  AST++S+  S+S+
Sbjct: 882  STSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASTSASMSASTSS 941

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  S  AS+S  +S ++  ST AS+ +S+  S S++T + +  ST A  S  T A   +
Sbjct: 942  STSASMSASTSASMSASTSASTSASTSASMSASTSASTSASMSASTSASMSASTSASTSA 1001

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  + S ST+     SM SA+T  + S SM A
Sbjct: 1002 STSASMSASTSASTSASM-SASTSASTSASMSA 1033

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 60/152 (39%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+SAS   S+S +   S+   +STS+S  AST++S   S ST+
Sbjct: 642  SESASTSASTSAST---SASASASTSASISASTSASISASTSASTSASTSASTSASMSTS 698

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T VST AS+S  +S ++  ST AS+ +S   S S++T + +  ST A  S  T A   + 
Sbjct: 699  TSVSTSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSASTSAS 758

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  + S ST+     SM SA+T  + S S  A
Sbjct: 759  TSASMSASTSASTSASM-SASTSASTSASTSA 789

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 60/157 (38%), Positives = 85/157 (54%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+ST
Sbjct: 738  SMSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASTSASTST 797

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGA 178
            +T  ST AS S   S ++  ST AS  +S   S+S++T + +  ST A  S      T A
Sbjct: 798  STSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSA 857

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               + T  ++S ST+     SM SA+T  + S S  A
Sbjct: 858  SMSASTSASTSASTSASTSASM-SASTSASTSASTSA 893

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 53/152 (34%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 806  SMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSA 865

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S   S S++T +    ST +  S + +   S 
Sbjct: 866  STSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSA 925

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     +S  SA+   + S SM A
Sbjct: 926  STSASTSASMSASTSSSTSASMSASTSASMSA 957

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 52/151 (34%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 838  SMSASTSASTSAST---SASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSAS 894

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T + +  ST +  S + +   S +
Sbjct: 895  TSASTSASTSASTSASTSSSTSASTSASTSASTSASTSASMSASTSSSTSASMSASTSAS 954

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S+ ++     ++  SA+T  + S SM A
Sbjct: 955  MSASTSASTSASTSASMSASTSASTSASMSA 985

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 54/152 (35%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST+SS   S+S 
Sbjct: 862  STSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSA 921

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS  +S   S+S++T +    ST A  S + +   S 
Sbjct: 922  STSASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSASTSASTSA 981

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 982  SMSASTSASMSASTSASTSASTSASMSASTSA 1013

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 674  SISASTSASTSASTSASTSASMSTSTSVSTSASTSASMSASTSASTSASTSASTSASTSA 733

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S ++  ST AS+ +S+  S S++T + +  ST A  S + +   S 
Sbjct: 734  STSASMSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASTSA 793

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++     ++  SA+T  + S SM A
Sbjct: 794  STSTSTSASTSASMSASTSASTSASTSASMSA 825

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 48/150 (32%), Positives = 82/150 (54%)
 Frame = -1

Query: 516  SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            SA ++ +++ +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S S +T
Sbjct: 824  SASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSAST 883

Query: 336  GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETV 157
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S + 
Sbjct: 884  SASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASTSASMSASTSSST 943

Query: 156  VTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S  ++     ++  SA+T  + S SM A
Sbjct: 944  SASMSASTSASMSASTSASTSASTSASMSA 973

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 58/153 (37%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 846  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSA 905

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST +S+S   S ++  ST AS+ +S+  S SS+T + +  ST A  S  T A   +
Sbjct: 906  STSASTSSSTSASTSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSA 965

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  + S ST+     SM SA+T  + S S  A
Sbjct: 966  STSASMSASTSASTSASM-SASTSASMSASTSA 997

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 57/157 (36%), Positives = 87/157 (55%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 718  STSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASMSASTSASTSASMSA 777

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS-----STTKSLVVTSTGA*DSVTGA 178
            +T  ST AS+S   S ++  ST AS+ +S+  S S     ST+ S+  +++ +  + T A
Sbjct: 778  STSASTSASTSASTSASTSTSTSASTSASMSASTSASTSASTSASMSASTSASISASTSA 837

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               + T  ++S ST+     SM SA+T  + S S  A
Sbjct: 838  SMSASTSASTSASTSASTSASM-SASTSASTSASTSA 873

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 52/152 (34%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +   S+   +STS+S  AST++S+  S+S 
Sbjct: 918  STSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSASTSA 977

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S  +S ++  ST AS+ +S+  S S++T + +  ST A  S + +   S 
Sbjct: 978  STSASMSASTSASMSASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSA 1037

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T V+ S S  A
Sbjct: 1038 STSASMSASTSASMSATTSASTSVSTSASTSA 1069

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 57/152 (37%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 814  STSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA 873

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S ++  ST AS+ +S   S S++T S    ST A    T A   + 
Sbjct: 874  STSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSA---STSASTSAS 930

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  + S ST+     SM SA+T  + S S  A
Sbjct: 931  TSASMSASTSSSTSASM-SASTSASMSASTSA 961

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 58/155 (37%), Positives = 85/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S++
Sbjct: 858  SMSASTSASTSAST---SASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSS 914

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST AS+S   S ++  S  AS+ SS   S+S++T + +  ST A  S  T A   + 
Sbjct: 915  TSASTSASTSASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSAS 974

Query: 162  TVVTSSDSTAFGGGTSM---FSAATGVTCSTSMVA 67
            T  ++S S +     SM    SA+T  + S SM A
Sbjct: 975  TSASTSASMSASTSASMSASTSASTSASTSASMSA 1009

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 52/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 730  STSASTSASMSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSA 789

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST  S+S   S +   ST AS+ +S   S+S++T + +  ST A  S + +   S 
Sbjct: 790  STSASTSTSTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSA 849

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S SM A
Sbjct: 850  STSASTSASMSASTSASTSASTSASTSASMSA 881

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STSSS  AST++S   S+S 
Sbjct: 870  STSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSA 929

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S +   ST AS  +S   S S++T + +  ST A  S + +   S 
Sbjct: 930  STSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSASTSASTSASMSASTSA 989

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S SM A
Sbjct: 990  SMSASTSASTSASTSASMSASTSASTSASMSA 1021

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 46/151 (30%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ +++   S+S S   S+ST+   S+   +STS+S  AST++S+  S+S +
Sbjct: 687  TSASTSASMSTSTSVSTSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSAS 746

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S +   ST AS+ +S+  S S++T +    ST A  S + +   S +
Sbjct: 747  TSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSAS 806

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S+ ++     ++  SA+T  + S S  A
Sbjct: 807  MSASTSASTSASTSASMSASTSASISASTSA 837

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 52/152 (34%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST   T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 694  SMSTSTSVSTSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSA 753

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  S  AS+ +S   S S++T +   TST A  S + +   S 
Sbjct: 754  STSASTSASMSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASMSASTSA 813

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 814  STSASTSASMSASTSASISASTSASMSASTSA 845

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 58/157 (36%), Positives = 84/157 (53%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST+SS   S S 
Sbjct: 890  STSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASTSASMSASTSSSTSASMSA 949

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-----GA 178
            +T  S  AS+S   S ++  S  AS+ +S   S+S++T + +  ST A  S +      A
Sbjct: 950  STSASMSASTSASTSASTSASMSASTSASTSASMSASTSASMSASTSASTSASTSASMSA 1009

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               + T  + S ST+     SM SA+T  + S SM A
Sbjct: 1010 STSASTSASMSASTSASTSASM-SASTSASTSASMSA 1045

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 826  STSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSA 885

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ SS   S S++T +    ST A  S + +   S 
Sbjct: 886  STSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASTSASMSASTSSSTSA 945

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 946  SMSASTSASMSASTSASTSASTSASMSASTSA 977

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/151 (35%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A T AST+  S+SAS   S S +T AS+   +STS+S  AST++S+  S+S +
Sbjct: 714  STSASTSASTSASTSA-STSASTSASMSASTSASTS--ASTSASTSASTSASMSASTSAS 770

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  S  AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   S +
Sbjct: 771  TSASMSASTSASTSASTSASTSASTSTSTSASTSASMSASTSASTSASTSASMSASTSAS 830

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S+ ++     ++  SA+T  + S SM A
Sbjct: 831  ISASTSASMSASTSASTSASTSASTSASMSA 861

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 57/156 (36%), Positives = 82/156 (52%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 794  STSTSTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSA 853

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  S  AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   S
Sbjct: 854  STSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSS 913

Query: 165  ETVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
             T  ++S ST+     S     SA+T  + S SM A
Sbjct: 914  STSASTSASTSASTSASTSASMSASTSSSTSASMSA 949

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 50/152 (32%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 702  STSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSA 761

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S  +S ++  ST AS+ +S   S S++T +    S  A  S + +   S 
Sbjct: 762  SMSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASMSASTSASTSASTSA 821

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 822  SMSASTSASISASTSASMSASTSASTSASTSA 853

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 51/148 (34%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S+  S+S +
Sbjct: 774  SMSASTSASTSAST---SASTSASTSTSTSASTSASMSASTSASTSASTSASMSASTSAS 830

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S+  S S++T +    ST A  S++ +   S +
Sbjct: 831  ISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSA--SMSASTSASTS 888

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 889  ASTSASTSASTSASTSASTSASTSSSTS 916

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 50/152 (32%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ +++A  S+S S   S+ST+   S+   +STS S  AST++S+  S+S +
Sbjct: 659  ASASTSASISASTSASISASTSASTSASTSASTSASMSTSTSVSTSASTSASMSASTSAS 718

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST AS+S   S ++  S  AS+ +S   S S++T +    S  A  S  T A   + 
Sbjct: 719  TSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASMSASTSASTSASMSAS 778

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S  S +T  + S SM A
Sbjct: 779  TSASTSASTSASTSAST-STSTSASTSASMSA 809

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 48/149 (32%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 938  STSSSTSASMSASTSASMSASTSASTSASTSASMSASTSASTSASMSASTSASMSASTSA 997

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  S  AS+ +S   S+S++T +    S  A  S + +   S 
Sbjct: 998  STSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASMSATTSA 1057

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++     ++  S+++ VT ++S
Sbjct: 1058 STSVSTSASTSASTSASTSSSSSVTSNSS 1086

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 52/156 (33%), Positives = 85/156 (54%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 754  STSASTSASMSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASMSASTSA 813

Query: 342  TTGVST----GASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            +T  ST     AS+S  IS ++  S  AS+ +S   S S++T + +  ST A  S + + 
Sbjct: 814  STSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA 873

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 874  STSASMSASTSASTSASTSASTSASTSASTSASTSA 909

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/156 (32%), Positives = 84/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS-- 349
            S + ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+  
Sbjct: 762  SMSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASMSASTSASTSASTSA 821

Query: 348  --STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
              S +T  S  AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S + + 
Sbjct: 822  SMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSA 881

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S +   S+ ++     ++  SA+T  + S+S  A
Sbjct: 882  STSASTSASTSASTSASTSASTSASTSASTSSSTSA 917

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 49/139 (35%), Positives = 75/139 (53%), Gaps = 6/139 (4%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 974  STSASTSASMSASTSASMSASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSA 1033

Query: 342  TTGVSTGAS-----SSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGA 178
            +T  ST AS     S+ + +TTS  ++ ++S S+   + +ST+ S  VTS  + + V  A
Sbjct: 1034 STSASTSASMSASTSASMSATTSASTSVSTSASTSASTSASTSSSSSVTSNSSKEKVYSA 1093

Query: 177  GRDSETVVTSSDSTAFGGG 121
               +     S  +TA G G
Sbjct: 1094 LPSTGDQDYSVTATALGLG 1112

[9][TOP]
>UniRef100_A9V1U7 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V1U7_MONBE
          Length = 2204

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 55/148 (37%), Positives = 88/148 (59%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS+ ST + T  S++  +SS+S   SSST+T  SS   SSTS+S  +S+++S   SSST 
Sbjct: 1235 SSSTSTSSSTNTSSSTSTSSSS---SSSTSTSTSSSTSSSTSTSSSSSSSTSTSTSSSTR 1291

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            +  ST  SSS   ST++G ST +S+ +S   S SS+T +   T+T +  S + +   S +
Sbjct: 1292 SSTSTSPSSSSSTSTSTGSSTSSSTSTSSSTSTSSSTSTSSSTNTSSSTSTSSSSSSSTS 1351

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TSS +++    +S  S++T  + S+S
Sbjct: 1352 TSTSSSTSSSTSTSSSSSSSTSTSTSSS 1379

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 63/159 (39%), Positives = 83/159 (52%), Gaps = 11/159 (6%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS+ ST   T +ST   S+S S   SSST+T   S   SSTS+S   ST+SS   SSST 
Sbjct: 1277 SSSSSTSTSTSSSTRS-STSTSPSSSSSTSTSTGSSTSSSTSTSSSTSTSSSTSTSSSTN 1335

Query: 339  TGVSTGASS--------SFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV- 187
            T  ST  SS        S   ST+S  ST +SS SS   S SS+T+S   TS  +  S  
Sbjct: 1336 TSSSTSTSSSSSSSTSTSTSSSTSSSTSTSSSSSSSTSTSTSSSTRSSTSTSPSSSSSTS 1395

Query: 186  --TGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TG+   S T  +SS S++    +S+ + +T    S+S
Sbjct: 1396 TSTGSSTSSSTSTSSSSSSSTSTSSSLSTTSTSTRASSS 1434

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 55/148 (37%), Positives = 88/148 (59%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS+ S+   T +ST   S+S+S   SSST+T +SS   SSTS+S  +ST+SS   SSS++
Sbjct: 1225 SSSTSSSTSTSSST---STSSSTNTSSSTSTSSSSS--SSTSTSTSSSTSSSTSTSSSSS 1279

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            +  ST  SSS   ST++  S+ +S+ +S G S SS+T +   TST +  S + +   S +
Sbjct: 1280 SSTSTSTSSSTRSSTSTSPSSSSSTSTSTGSSTSSSTSTSSSTSTSSSTSTSSSTNTSSS 1339

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TSS S++    ++  S ++  + S+S
Sbjct: 1340 TSTSSSSSSSTSTSTSSSTSSSTSTSSS 1367

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 66/159 (41%), Positives = 84/159 (52%), Gaps = 11/159 (6%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS+ ST   T +ST   SSS+S   S+S +T  S+   SSTSSS   ST+SS   SSST 
Sbjct: 1189 SSSSSTRTSTSSST-NTSSSSSLSISTSISTSTSTSISSSTSSS--TSTSSSTSTSSSTN 1245

Query: 339  TGVSTGASS--------SFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV- 187
            T  ST  SS        S   ST+S  ST +SS SS   S SS+T+S   TS  +  S  
Sbjct: 1246 TSSSTSTSSSSSSSTSTSTSSSTSSSTSTSSSSSSSTSTSTSSSTRSSTSTSPSSSSSTS 1305

Query: 186  --TGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TG+   S T  +SS ST+    T   S++T  + STS
Sbjct: 1306 TSTGSSTSSSTSTSSSTSTSSSTST---SSSTNTSSSTS 1341

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 56/148 (37%), Positives = 83/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS  S+ + + +S+   S+S+S   SSS++   S+   +STS+S  +ST+SS   SSST+
Sbjct: 1180 SSTDSSSSSSSSSSTRTSTSSSTNTSSSSSLSISTSISTSTSTSISSSTSSSTSTSSSTS 1239

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST  SSS   S++S  ST  S+ SS   S S+++ S   TST    S T +   +  
Sbjct: 1240 TSSSTNTSSSTSTSSSSSSSTSTSTSSSTSSSTSTSSSSSSSTSTST-SSSTRSSTSTSP 1298

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              +SS ST+ G  TS  S +T  + STS
Sbjct: 1299 SSSSSTSTSTGSSTSS-STSTSSSTSTS 1325

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 55/148 (37%), Positives = 84/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS+ ST   T +ST+  S+S S   SSST+T  SS   SSTS+S  +S+++S    SST+
Sbjct: 1255 SSSSSTSTSTSSSTSS-STSTSSSSSSSTSTSTSSSTRSSTSTSPSSSSSTSTSTGSSTS 1313

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            +  ST +S+S   ST++  ST  SS +S   S SS+T +   +ST +  + T +   S T
Sbjct: 1314 SSTSTSSSTSTSSSTSTSSSTNTSSSTSTSSSSSSSTSTSTSSSTSS-STSTSSSSSSST 1372

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              ++S ST     TS  S+++  T + S
Sbjct: 1373 STSTSSSTRSSTSTSPSSSSSTSTSTGS 1400

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 59/153 (38%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS  S+ + + +S++  S+S S    SST+T  SS   SSTS+S  +ST+SS   SSST+
Sbjct: 1266 SSTSSSTSTSSSSSSSTSTSTSSSTRSSTSTSPSSS--SSTSTSTGSSTSSSTSTSSSTS 1323

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS-- 166
            T  ST  SSS   +T+S  ST +SS SS   S SS+T S   TS+ +  S + +   S  
Sbjct: 1324 TSSSTSTSSS--TNTSSSTSTSSSSSSSTSTSTSSSTSSSTSTSSSSSSSTSTSTSSSTR 1381

Query: 165  ---ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
                T  +SS ST+   G+S  S+ +  + S+S
Sbjct: 1382 SSTSTSPSSSSSTSTSTGSSTSSSTSTSSSSSS 1414

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 58/162 (35%), Positives = 89/162 (54%), Gaps = 1/162 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ S+ + T  ST G S+S+S   SSST+T +S+   SST++S   ST+SS   S+ST+
Sbjct: 1295 STSPSSSSSTSTST-GSSTSSSTSTSSSTSTSSSTSTSSSTNTSSSTSTSSSSSSSTSTS 1353

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST +S+S   S++S  ST  SS +    S S ++ S   TSTG     +     + T
Sbjct: 1354 TSSSTSSSTSTSSSSSSSTSTSTSSSTRSSTSTSPSSSSSTSTSTG-----SSTSSSTST 1408

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI*I-YVEKRVK 37
              +SS ST+     S  S +T  + STS  +  + Y E R++
Sbjct: 1409 SSSSSSSTSTSSSLSTTSTSTRASSSTSTTSADMSYEELRIR 1450

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 52/148 (35%), Positives = 87/148 (58%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS+ ST + + +ST   S+S S   SSST+T +SS   +STS+S    +++S   SSS++
Sbjct: 1247 SSSTSTSSSSSSST---STSTSSSTSSSTSTSSSSSSSTSTSTSSSTRSSTSTSPSSSSS 1303

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  STG+S+S   ST+S  ST +S+ +S   + SS+T     TS+ +  S + +   S +
Sbjct: 1304 TSTSTGSSTSSSTSTSSSTSTSSSTSTSSSTNTSSSTS----TSSSSSSSTSTSTSSSTS 1359

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ S++    ++  S++T  + STS
Sbjct: 1360 SSTSTSSSSSSSTSTSTSSSTRSSTSTS 1387

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 56/148 (37%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS+ S    T  ST+  S+S S   SSST+T +S+   SST++S   ST+SS   S+ST+
Sbjct: 1205 SSSSSLSISTSISTST-STSISSSTSSSTSTSSSTSTSSSTNTSSSTSTSSSSSSSTSTS 1263

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST +S+S   S++S  ST  SS +    S S ++ S   TSTG+  + +     S T
Sbjct: 1264 TSSSTSSSTSTSSSSSSSTSTSTSSSTRSSTSTSPSSSSSTSTSTGS-STSSSTSTSSST 1322

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              +SS ST+    TS  S +T  + S+S
Sbjct: 1323 STSSSTSTSSSTNTSS-STSTSSSSSSS 1349

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/149 (35%), Positives = 86/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST   T  ST+   S+S+S   SSST+T +S+   SSTS+S  +S+++S   SSST
Sbjct: 1209 SLSISTSISTSTSTSISSSTSSSTSTSSSTSTSSSTNTSSSTSTSSSSSSSTSTSTSSST 1268

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            ++  ST +SSS   ST++  ST  SS S+   S SST+ S   +++ +  + +     S 
Sbjct: 1269 SSSTSTSSSSSSSTSTSTSSST-RSSTSTSPSSSSSTSTSTGSSTSSSTSTSSSTSTSSS 1327

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  +SS +T+    TS  S+++  T ++S
Sbjct: 1328 TSTSSSTNTSSSTSTSSSSSSSTSTSTSS 1356

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 51/158 (32%), Positives = 82/158 (51%)
 Frame = -1

Query: 549 SKDSFFLHIYSSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTT 370
           S  SF L   SS  S+ A+  +++   S+S S   S+ST+T  S+   +STS+S   ST+
Sbjct: 540 STASFGLTTSSSVHSSTAMETSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTS 599

Query: 369 SSVLLSSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DS 190
           +S   S+ST+T  ST  S+S   ST++  ST  S+ +S   S S++  +   TST     
Sbjct: 600 TSTSTSTSTSTSTSTRTSTSTSTSTSTSTSTSTSTSTSTRTSTSASASTRTSTSTS---- 655

Query: 189 VTGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T     + T  ++S ST+    TS+ S+ +     +S
Sbjct: 656 -TRTSTSTSTSTSTSTSTSSSSSTSLSSSISSSLSDSS 692

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 54/146 (36%), Positives = 81/146 (55%), Gaps = 3/146 (2%)
 Frame = -1

Query: 516  SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            S+ ST +VT  ST   S+S S   S+ST++  SSV  +STS+S F+ T++S   S+ST+T
Sbjct: 885  SSTSTFSVTSTST---STSTSTSTSTSTSSSTSSVTSTSTSTSTFSVTSTSTSTSTSTST 941

Query: 336  GVSTGASSSFLISTT--SGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-GAGRDS 166
              ST  S+S   ST+  S  ST  S+ +S   S S++T +   TST    S T      +
Sbjct: 942  STSTSTSTSTSTSTSTFSVTSTSTSTFTSTSTSTSTSTSTSTSTSTSISSSFTHKTSTST 1001

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVT 88
             T   SS ST+    TS F++ + ++
Sbjct: 1002 STTQFSSTSTSATDPTSTFTSMSSLS 1027

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/150 (34%), Positives = 85/150 (56%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLL--SSS 346
            S++ ST + T  ST    +S S   S+S++T +SS   +STSSS   ST++S     SSS
Sbjct: 1123 STSTSTSS-TLGSTIDSRTSTSTDSSTSSSTSSSSSSSTSTSSSTRTSTSTSTNTSPSSS 1181

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
            T +  S+ +SSS   ST+S  +T +SS  SI  S+S++T + + +ST +  S + +   S
Sbjct: 1182 TDSSSSSSSSSSTRTSTSSSTNTSSSSSLSISTSISTSTSTSISSSTSSSTSTSSSTSTS 1241

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             +  TSS ++     +S  S +T  + S+S
Sbjct: 1242 SSTNTSSSTSTSSSSSSSTSTSTSSSTSSS 1271

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/158 (33%), Positives = 85/158 (53%)
 Frame = -1

Query: 549  SKDSFFLHIYSSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTT 370
            S DS      SS+ S+   T +ST   +S+++    SS+T  +SS   SS+SSS   ST+
Sbjct: 1143 STDSSTSSSTSSSSSSSTSTSSSTRTSTSTSTNTSPSSSTDSSSS---SSSSSSTRTSTS 1199

Query: 369  SSVLLSSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DS 190
            SS   SSS++  +ST  S+S   S +S  S+  S+ SS   S S+ T S   TS+ +  S
Sbjct: 1200 SSTNTSSSSSLSISTSISTSTSTSISSSTSSSTSTSSSTSTSSSTNTSSSTSTSSSSSSS 1259

Query: 189  VTGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + +   S +  TS+ S++    ++  S++T  + STS
Sbjct: 1260 TSTSTSSSTSSSTSTSSSSSSSTSTSTSSSTRSSTSTS 1297

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 59/154 (38%), Positives = 86/154 (55%), Gaps = 10/154 (6%)
 Frame = -1

Query: 507  STGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSS---SFFASTTSSVLLSSSTTT 337
            ST   T  S++  SSS+S   SS+ T+ +SS   SS+SS   S   ST++S  +SSST++
Sbjct: 1171 STSTNTSPSSSTDSSSSSSSSSSTRTSTSSSTNTSSSSSLSISTSISTSTSTSISSSTSS 1230

Query: 336  GVSTGASSSFLIS--TTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS- 166
              ST +S+S   S  T+S  ST +SS SS   S SS+T S   TS+ +  S + +   S 
Sbjct: 1231 STSTSSSTSTSSSTNTSSSTSTSSSSSSSTSTSTSSSTSSSTSTSSSSSSSTSTSTSSST 1290

Query: 165  ----ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
                 T  +SS ST+   G+S  S++T  + STS
Sbjct: 1291 RSSTSTSPSSSSSTSTSTGSST-SSSTSTSSSTS 1323

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/154 (34%), Positives = 83/154 (53%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            SS+ ST + T  ST+   ++S S    SS+++ +SS   +STSSS   S++SS+ +S+S 
Sbjct: 1157 SSSTSTSSSTRTSTSTSTNTSPSSSTDSSSSSSSSSSTRTSTSSSTNTSSSSSLSISTSI 1216

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGA 178
            +T  ST  SSS   ST++  ST  SS ++   S S+++ S   TST    S      T +
Sbjct: 1217 STSTSTSISSSTSSSTSTSSSTSTSSSTNTSSSTSTSSSSSSSTSTSTSSSTSSSTSTSS 1276

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S T  ++S ST     TS  S+++  T + S
Sbjct: 1277 SSSSSTSTSTSSSTRSSTSTSPSSSSSTSTSTGS 1310

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 47/142 (33%), Positives = 72/142 (50%), Gaps = 1/142 (0%)
 Frame = -1

Query: 486 ASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTTGVSTGASSSF 307
           ASTA F  + S    SST    S+   +STS+S   ST++S   S+ST+T  ST  S+S 
Sbjct: 539 ASTASFGLTTSSSVHSSTAMETSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTST 598

Query: 306 LISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSETVVTSSDSTAF 130
             ST++  ST  S+ +    S S++T +   TST    S  T     + T  ++S ST  
Sbjct: 599 STSTSTSTSTSTSTSTRTSTSTSTSTSTSTSTSTSTSTSTRTSTSASASTRTSTSTSTRT 658

Query: 129 GGGTSMFSAATGVTCSTSMVAI 64
              TS  ++ +  T S+S  ++
Sbjct: 659 STSTSTSTSTSTSTSSSSSTSL 680

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 63/177 (35%), Positives = 87/177 (49%), Gaps = 17/177 (9%)
 Frame = -1

Query: 552  LSKDSFFLHIYSSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFAST 373
            LS  S F  + S++ ST   T  ST+  SSS S   S+ST+T   SV  +STS+S   ST
Sbjct: 884  LSSTSTF-SVTSTSTSTSTSTSTSTST-SSSTSSVTSTSTSTSTFSVTSTSTSTSTSTST 941

Query: 372  TSSVLLSSSTTTGVS----TGASSSFLISTTSGVST*ASSVSSIGFSVSS--TTKSLVVT 211
            ++S   S+ST+T  S    T  S+S   ST++  ST  S+ +S   S+SS  T K+   T
Sbjct: 942  STSTSTSTSTSTSTSTFSVTSTSTSTFTSTSTSTSTSTSTSTSTSTSISSSFTHKTSTST 1001

Query: 210  STGA*DSVTGAGRDSETVVTSSDS--------TAFG---GGTSMFSAATGVTCSTSM 73
            ST    S + +  D  +  TS  S        T+ G    G S FS     T ST +
Sbjct: 1002 STTQFSSTSTSATDPTSTFTSMSSLSNKDPTVTSTGVQTSGPSQFSTPGLGTTSTGL 1058

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 48/147 (32%), Positives = 76/147 (51%), Gaps = 7/147 (4%)
 Frame = -1

Query: 495  VTEASTAGFSSSASGFF-------SSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            +T  ST+ F+   S          S+ T+T  SS   +STSSS  +ST++  + S+ST+T
Sbjct: 840  LTSTSTSTFTQEPSSSLLQATKSTSTLTSTATSSWTSTSTSSSPLSSTSTFSVTSTSTST 899

Query: 336  GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETV 157
              ST  S+S   ST+S  ST  S+ +    S S++T +   TST    S + +   S   
Sbjct: 900  STSTSTSTSTSSSTSSVTSTSTSTSTFSVTSTSTSTSTSTSTSTSTSTSTSTSTSTSTFS 959

Query: 156  VTSSDSTAFGGGTSMFSAATGVTCSTS 76
            VTS+ ++ F   ++  S +T  + STS
Sbjct: 960  VTSTSTSTFTSTSTSTSTSTSTSTSTS 986

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 47/148 (31%), Positives = 80/148 (54%), Gaps = 4/148 (2%)
 Frame = -1

Query: 507  STGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTTGVS 328
            ST  +T  +T+ ++S+++   SSS  +  S+   +STS+S   ST++S   SSST++  S
Sbjct: 862  STSTLTSTATSSWTSTST---SSSPLSSTSTFSVTSTSTSTSTSTSTSTSTSSSTSSVTS 918

Query: 327  TGASSSFL----ISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  S+S       ST++  ST  S+ +S   S S++T +  VTST      T     + T
Sbjct: 919  TSTSTSTFSVTSTSTSTSTSTSTSTSTSTSTSTSTSTSTFSVTSTS-----TSTFTSTST 973

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              ++S ST+    TS+ S+ T  T +++
Sbjct: 974  STSTSTSTSTSTSTSISSSFTHKTSTST 1001

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 51/151 (33%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST   T  ST    S+S S   S+S+T G++    +STS+    S+++S   SSST
Sbjct: 1101 STSTSTPTPTSTSTPTSTSTSTSTSTSTSSTLGSTIDSRTSTSTDSSTSSSTSSSSSSST 1160

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST  S+S   +T+   ST +SS SS   S  ++T S   TS+ +  S+ T     +
Sbjct: 1161 STSSSTRTSTSTSTNTSPSSSTDSSSSSSSSSSTRTSTSSSTNTSSSSSLSISTSISTST 1220

Query: 165  ETVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
             T ++SS S++    +S   S++T  + STS
Sbjct: 1221 STSISSSTSSSTSTSSSTSTSSSTNTSSSTS 1251

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 43/146 (29%), Positives = 73/146 (50%)
 Frame = -1

Query: 513 AFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTTG 334
           A  T AV  AST    +  S    ++ T   S+   +++++SF  +T+SSV  S++  T 
Sbjct: 502 ALVTTAVHAASTTATPTFTSSSRMATLTPLISNSSSTASTASFGLTTSSSVHSSTAMETS 561

Query: 333 VSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETVV 154
            ST  S+S   ST++  ST  S+ +S   S S++T +   TST    S + + R S +  
Sbjct: 562 TSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTRTSTSTS 621

Query: 153 TSSDSTAFGGGTSMFSAATGVTCSTS 76
           TS+ ++     ++  S  T  + S S
Sbjct: 622 TSTSTSTSTSTSTSTSTRTSTSASAS 647

 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 47/153 (30%), Positives = 85/153 (55%), Gaps = 9/153 (5%)
 Frame = -1

Query: 507  STGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT---- 340
            +T + T  ST+    S++  FS ++T+ ++S   +STS+S   S+++S + S+ST+    
Sbjct: 870  ATSSWTSTSTSSSPLSSTSTFSVTSTSTSTS---TSTSTSTSTSSSTSSVTSTSTSTSTF 926

Query: 339  --TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
              T  ST  S+S   ST++  ST ++S S+  FSV+ST+ S   +++ +  + T     +
Sbjct: 927  SVTSTSTSTSTSTSTSTSTSTST-STSTSTSTFSVTSTSTSTFTSTSTSTSTSTSTSTST 985

Query: 165  ETVVTSS--DSTAFGGGTSMFSA-ATGVTCSTS 76
             T ++SS    T+    T+ FS+ +T  T  TS
Sbjct: 986  STSISSSFTHKTSTSTSTTQFSSTSTSATDPTS 1018

[10][TOP]
>UniRef100_Q8LC93 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8LC93_ARATH
          Length = 104

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 58/126 (46%), Positives = 67/126 (53%), Gaps = 7/126 (5%)
 Frame = +2

Query: 65  MATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET 244
           MAT+EVEQVTPVA EN+EVP           TV E++          VE   KD   EET
Sbjct: 1   MATVEVEQVTPVAVENVEVP---------TKTVEETV----------VETEKKD---EET 38

Query: 245 EKPIEETEEAQ---VETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKE----EEVE 403
           EK  EE +E      ETP V E +K  E   ETP VVE+E KTE V E + E    EEV 
Sbjct: 39  EKKTEEKDEKTEVITETPVVEEEEKKAEEVTETPAVVEEEKKTEVVEEKQTEVAAAEEVA 98

Query: 404 EKKTEE 421
            +K EE
Sbjct: 99  VEKAEE 104

[11][TOP]
>UniRef100_B2ISC7 Cell wall surface anchor family protein n=1 Tax=Streptococcus
            pneumoniae CGSP14 RepID=B2ISC7_STRPS
          Length = 4695

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 55/152 (36%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+  AS+   +STS+S  AST++S   S+S 
Sbjct: 1903 STSASTSASTSASTSASTSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSA 1962

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  ST AS+ +SI  S S++T +    ST A  S + +  +S 
Sbjct: 1963 STSASTSASESASTSASTSASTSASASASISASESASTSASASASTSASASASTSASESA 2022

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+   + STS  A
Sbjct: 2023 STSASASASTSASASASTSASASASASTSASA 2054

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 55/152 (36%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+  AS+   +STS+S  AST++S   S+S 
Sbjct: 3233 STSASTSASTSASTSASTSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSA 3292

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  ST AS+ +SI  S S++T +    ST A  S + +  +S 
Sbjct: 3293 STSASTSASESASTSASTSASTSASASASISASESASTSASASASTSASASASTSASESA 3352

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+   + STS  A
Sbjct: 3353 STSASASASTSASASASTSASASASASTSASA 3384

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1843 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1902

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +   TST A  S + +   S 
Sbjct: 1903 STSASTSASTSASTSASTSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSA 1962

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S+ A
Sbjct: 1963 STSASTSASESASTSASTSASTSASASASISA 1994

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3173 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3232

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +   TST A  S + +   S 
Sbjct: 3233 STSASTSASTSASTSASTSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSA 3292

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S+ A
Sbjct: 3293 STSASTSASESASTSASTSASTSASASASISA 3324

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1823 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1882

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1883 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSA 1942

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++     ++  SA+T  + S S
Sbjct: 1943 STSTSTSASTSASTSASTSASTSASTSAS 1971

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3153 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3212

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3213 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSA 3272

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++     ++  SA+T  + S S
Sbjct: 3273 STSTSTSASTSASTSASTSASTSASTSAS 3301

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1799 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1858

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1859 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1918

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + STS  A
Sbjct: 1919 STSASTSASTSASTSASASASTSASTSTSTSA 1950

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3129 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3188

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3189 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3248

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + STS  A
Sbjct: 3249 STSASTSASTSASTSASASASTSASTSTSTSA 3280

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 59/153 (38%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1811 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1870

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1871 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1930

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+    TS  SA+T  + S S  A
Sbjct: 1931 STSASASASTSASTSTST-SASTSASTSASTSA 1962

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 59/153 (38%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3141 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3200

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3201 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3260

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+    TS  SA+T  + S S  A
Sbjct: 3261 STSASASASTSASTSTST-SASTSASTSASTSA 3292

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1807 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1866

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1867 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA--STSASTSAST 1924

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +T  + STS
Sbjct: 1925 SASTSASTSASASASTSASTSTSTSASTS 1953

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3137 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3196

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3197 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA--STSASTSAST 3254

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +T  + STS
Sbjct: 3255 SASTSASTSASASASTSASTSTSTSASTS 3283

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1803 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1862

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1863 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1922

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1923 STSASTSASTSASASASTSASTSTSTSASTSA 1954

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1859 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1918

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1919 STSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSA 1978

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 1979 STSASTSASASASISASESASTSASASASTSA 2010

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3133 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3192

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3193 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3252

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3253 STSASTSASTSASASASTSASTSTSTSASTSA 3284

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3189 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3248

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3249 STSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSA 3308

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 3309 STSASTSASASASISASESASTSASASASTSA 3340

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1791 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1850

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1851 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1910

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1911 STSASTSASTSASTSASTSASTSASASASTSA 1942

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3121 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3180

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3181 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3240

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3241 STSASTSASTSASTSASTSASTSASASASTSA 3272

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1627 SASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1686

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1687 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1746

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1747 STSASTSASTSASTSASTSASTSASTSASTSA 1778

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1631 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1690

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1691 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1750

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1751 STSASTSASTSASTSASTSASTSASTSASTSA 1782

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1635 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1694

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1695 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1754

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1755 STSASTSASTSASTSASTSASTSASTSASTSA 1786

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1639 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1698

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1699 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1758

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1759 STSASTSASTSASTSASTSASTSASTSASTSA 1790

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1643 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1702

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1703 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1762

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1763 STSASTSASTSASTSASTSASTSASTSASTSA 1794

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1647 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1706

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1707 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1766

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1767 STSASTSASTSASTSASTSASTSASTSASTSA 1798

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1651 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1710

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1711 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1770

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1771 STSASTSASTSASTSASTSASTSASTSASTSA 1802

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1655 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1714

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1715 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1774

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1775 STSASTSASTSASTSASTSASTSASTSASTSA 1806

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1659 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1718

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1719 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1778

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1779 STSASTSASTSASTSASTSASTSASTSASTSA 1810

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1663 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1722

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1723 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1782

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1783 STSASTSASTSASTSASTSASTSASTSASTSA 1814

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1667 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1726

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1727 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1786

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1787 STSASTSASTSASTSASTSASTSASTSASTSA 1818

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1671 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1730

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1731 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1790

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1791 STSASTSASTSASTSASTSASTSASTSASTSA 1822

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1675 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1734

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1735 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1794

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1795 STSASTSASTSASTSASTSASTSASTSASTSA 1826

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1679 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1738

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1739 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1798

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1799 STSASTSASTSASTSASTSASTSASTSASTSA 1830

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1683 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1742

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1743 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1802

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1803 STSASTSASTSASTSASTSASTSASTSASTSA 1834

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1687 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1746

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1747 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1806

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1807 STSASTSASTSASTSASTSASTSASTSASTSA 1838

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1691 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1750

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1751 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1810

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1811 STSASTSASTSASTSASTSASTSASTSASTSA 1842

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1695 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1754

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1755 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1814

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1815 STSASTSASTSASTSASTSASTSASTSASTSA 1846

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1699 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1758

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1759 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1818

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1819 STSASTSASTSASTSASTSASTSASTSASTSA 1850

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1703 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1762

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1763 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1822

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1823 STSASTSASTSASTSASTSASTSASTSASTSA 1854

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1707 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1766

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1767 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1826

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1827 STSASTSASTSASTSASTSASTSASTSASTSA 1858

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1711 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1770

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1771 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1830

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1831 STSASTSASTSASTSASTSASTSASTSASTSA 1862

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1715 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1774

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1775 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1834

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1835 STSASTSASTSASTSASTSASTSASTSASTSA 1866

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1719 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1778

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1779 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1838

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1839 STSASTSASTSASTSASTSASTSASTSASTSA 1870

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1723 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1782

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1783 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1842

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1843 STSASTSASTSASTSASTSASTSASTSASTSA 1874

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1727 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1786

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1787 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1846

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1847 STSASTSASTSASTSASTSASTSASTSASTSA 1878

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1731 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1790

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1791 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1850

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1851 STSASTSASTSASTSASTSASTSASTSASTSA 1882

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1735 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1794

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1795 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1854

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1855 STSASTSASTSASTSASTSASTSASTSASTSA 1886

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1739 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1798

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1799 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1858

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1859 STSASTSASTSASTSASTSASTSASTSASTSA 1890

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1743 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1802

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1803 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1862

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1863 STSASTSASTSASTSASTSASTSASTSASTSA 1894

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1747 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1806

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1807 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1866

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1867 STSASTSASTSASTSASTSASTSASTSASTSA 1898

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1751 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1810

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1811 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1870

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1871 STSASTSASTSASTSASTSASTSASTSASTSA 1902

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1755 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1814

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1815 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1874

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1875 STSASTSASTSASTSASTSASTSASTSASTSA 1906

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1759 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1818

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1819 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1878

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1879 STSASTSASTSASTSASTSASTSASTSASTSA 1910

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1763 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1822

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1823 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1882

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1883 STSASTSASTSASTSASTSASTSASTSASTSA 1914

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1767 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1826

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1827 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1886

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1887 STSASTSASTSASTSASTSASTSASTSASTSA 1918

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1771 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1830

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1831 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1890

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1891 STSASTSASTSASTSASTSASTSASTSASTSA 1922

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1775 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1834

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1835 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1894

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1895 STSASTSASTSASTSASTSASTSASTSASTSA 1926

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1779 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1838

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1839 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1898

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1899 STSASTSASTSASTSASTSASTSASTSASTSA 1930

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1783 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1842

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1843 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1902

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1903 STSASTSASTSASTSASTSASTSASTSASTSA 1934

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1787 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1846

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1847 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1906

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1907 STSASTSASTSASTSASTSASTSASTSASASA 1938

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 58/153 (37%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1819 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1878

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1879 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASA 1938

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+     S  SA+T  + S S  A
Sbjct: 1939 STSASTSTSTSASTSAST-SASTSASTSASTSA 1970

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 2997 SASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3056

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3057 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3116

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3117 STSASTSASTSASTSASTSASTSASTSASTSA 3148

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3001 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3060

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3061 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3120

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3121 STSASTSASTSASTSASTSASTSASTSASTSA 3152

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3005 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3064

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3065 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3124

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3125 STSASTSASTSASTSASTSASTSASTSASTSA 3156

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3009 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3068

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3069 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3128

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3129 STSASTSASTSASTSASTSASTSASTSASTSA 3160

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3013 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3072

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3073 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3132

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3133 STSASTSASTSASTSASTSASTSASTSASTSA 3164

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3017 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3076

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3077 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3136

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3137 STSASTSASTSASTSASTSASTSASTSASTSA 3168

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3021 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3080

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3081 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3140

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3141 STSASTSASTSASTSASTSASTSASTSASTSA 3172

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3025 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3084

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3085 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3144

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3145 STSASTSASTSASTSASTSASTSASTSASTSA 3176

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3029 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3088

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3089 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3148

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3149 STSASTSASTSASTSASTSASTSASTSASTSA 3180

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3033 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3092

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3093 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3152

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3153 STSASTSASTSASTSASTSASTSASTSASTSA 3184

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3037 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3096

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3097 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3156

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3157 STSASTSASTSASTSASTSASTSASTSASTSA 3188

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3041 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3100

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3101 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3160

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3161 STSASTSASTSASTSASTSASTSASTSASTSA 3192

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3045 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3104

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3105 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3164

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3165 STSASTSASTSASTSASTSASTSASTSASTSA 3196

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3049 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3108

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3109 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3168

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3169 STSASTSASTSASTSASTSASTSASTSASTSA 3200

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3053 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3112

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3113 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3172

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3173 STSASTSASTSASTSASTSASTSASTSASTSA 3204

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3057 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3116

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3117 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3176

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3177 STSASTSASTSASTSASTSASTSASTSASTSA 3208

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3061 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3120

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3121 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3180

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3181 STSASTSASTSASTSASTSASTSASTSASTSA 3212

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3065 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3124

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3125 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3184

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3185 STSASTSASTSASTSASTSASTSASTSASTSA 3216

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3069 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3128

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3129 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3188

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3189 STSASTSASTSASTSASTSASTSASTSASTSA 3220

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3073 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3132

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3133 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3192

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3193 STSASTSASTSASTSASTSASTSASTSASTSA 3224

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3077 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3136

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3137 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3196

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3197 STSASTSASTSASTSASTSASTSASTSASTSA 3228

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3081 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3140

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3141 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3200

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3201 STSASTSASTSASTSASTSASTSASTSASTSA 3232

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3085 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3144

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3145 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3204

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3205 STSASTSASTSASTSASTSASTSASTSASTSA 3236

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3089 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3148

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3149 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3208

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3209 STSASTSASTSASTSASTSASTSASTSASTSA 3240

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3093 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3152

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3153 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3212

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3213 STSASTSASTSASTSASTSASTSASTSASTSA 3244

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3097 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3156

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3157 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3216

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3217 STSASTSASTSASTSASTSASTSASTSASTSA 3248

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3101 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3160

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3161 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3220

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3221 STSASTSASTSASTSASTSASTSASTSASTSA 3252

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3105 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3164

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3165 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3224

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3225 STSASTSASTSASTSASTSASTSASTSASTSA 3256

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3109 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3168

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3169 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3228

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3229 STSASTSASTSASTSASTSASTSASTSASTSA 3260

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3113 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3172

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3173 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3232

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3233 STSASTSASTSASTSASTSASTSASTSASTSA 3264

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3117 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3176

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3177 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3236

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3237 STSASTSASTSASTSASTSASTSASTSASASA 3268

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 58/153 (37%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3149 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3208

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3209 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASA 3268

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+     S  SA+T  + S S  A
Sbjct: 3269 STSASTSTSTSASTSAST-SASTSASTSASTSA 3300

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1835 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1894

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1895 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSASTSTSTSASTSA 1954

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1955 STSASTSASTSASTSASESASTSASTSASTSA 1986

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3165 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3224

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3225 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSASTSTSTSASTSA 3284

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3285 STSASTSASTSASTSASESASTSASTSASTSA 3316

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 54/151 (35%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3965 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4021

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 4022 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASTSAS 4081

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +  V+ STS  A
Sbjct: 4082 ASTSASASASTSASASASTSASVSASTSASA 4112

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 55/148 (37%), Positives = 85/148 (57%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4495 SASASTSASASASTSA-SESASTSASESASTSASAS--ASTSASESASTSASESASTSAS 4551

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   SE+
Sbjct: 4552 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASVSASTSASES 4611

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  SA+T V+ S +
Sbjct: 4612 ASTSASASALASTSASASASTSVSNSAN 4639

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 56/152 (36%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1919 STSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSA 1978

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1979 STSASTSASASASISASESASTSASASASTSASASASTSASESASTSA--SASASTSASA 2036

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  SA+T  + S S  A
Sbjct: 2037 SASTSASASASASTSASASASTSASESASTSA 2068

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 56/152 (36%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3249 STSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSA 3308

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3309 STSASTSASASASISASESASTSASASASTSASASASTSASESASTSA--SASASTSASA 3366

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  SA+T  + S S  A
Sbjct: 3367 SASTSASASASASTSASASASTSASESASTSA 3398

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++SV  S+S 
Sbjct: 4323 STSASVSASTSASESASTSASASASTSASESASTSASASASTSASESASTSASVSASTSA 4382

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS  +S   SVS++T +    ST A +S + +   SE
Sbjct: 4383 SASASTSASASASTSASASASTSASESASTSASVSASTSASASASTSASESASTSA--SE 4440

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +  V+ STS
Sbjct: 4441 SASTSASASASTSASASASTSASVSASTS 4469

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+  AS+   +STS+S  AST++S   S+S 
Sbjct: 1595 SVSASTSASASASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSA 1654

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1655 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1714

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1715 STSASTSASTSASTSASTSASTSASTSASTSA 1746

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 48/151 (31%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 1608 TSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1667

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1668 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1727

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1728 TSASTSASTSASTSASTSASTSASTSASTSA 1758

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1827 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1886

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1887 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSASTST 1946

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1947 STSASTSASTSASTSASTSASTSASESASTSA 1978

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1855 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1914

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  S  AS+ +S   S S++T +    ST A  S + +  +S 
Sbjct: 1915 STSASTSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESA 1974

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+   + S S  A
Sbjct: 1975 STSASTSASTSASASASISASESASTSASASA 2006

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+  AS+   +STS+S  AST++S   S+S 
Sbjct: 2965 SVSASTSASASASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSA 3024

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3025 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3084

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3085 STSASTSASTSASTSASTSASTSASTSASTSA 3116

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 48/151 (31%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 2978 TSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 3037

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3038 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 3097

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3098 TSASTSASTSASTSASTSASTSASTSASTSA 3128

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3157 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3216

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3217 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSASTST 3276

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3277 STSASTSASTSASTSASTSASTSASESASTSA 3308

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3185 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3244

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  S  AS+ +S   S S++T +    ST A  S + +  +S 
Sbjct: 3245 STSASTSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESA 3304

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+   + S S  A
Sbjct: 3305 STSASTSASTSASASASISASESASTSASASA 3336

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1603 SASASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSA 1662

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1663 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1722

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1723 STSASTSASTSASTSASTSASTSASTSASTSA 1754

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1611 SASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1670

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1671 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1730

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1731 STSASTSASTSASTSASTSASTSASTSASTSA 1762

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1619 SASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1678

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1679 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1738

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1739 STSASTSASTSASTSASTSASTSASTSASTSA 1770

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 51/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1871 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1930

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   ST++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1931 STSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASA 1990

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            ++  S  ++     ++  SA+   + S S
Sbjct: 1991 SISASESASTSASASASTSASASASTSAS 2019

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1883 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSA 1942

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S + +   S 
Sbjct: 1943 STSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISASESASTSA 2002

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 2003 SASASTSASASASTSASESASTSASASASTSA 2034

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 2973 SASASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSA 3032

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3033 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3092

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3093 STSASTSASTSASTSASTSASTSASTSASTSA 3124

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 2981 SASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3040

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3041 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3100

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3101 STSASTSASTSASTSASTSASTSASTSASTSA 3132

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 2989 SASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3048

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3049 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3108

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3109 STSASTSASTSASTSASTSASTSASTSASTSA 3140

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 51/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3201 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3260

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   ST++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3261 STSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASA 3320

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            ++  S  ++     ++  SA+   + S S
Sbjct: 3321 SISASESASTSASASASTSASASASTSAS 3349

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3213 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSA 3272

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S + +   S 
Sbjct: 3273 STSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISASESASTSA 3332

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 3333 SASASTSASASASTSASESASTSASASASTSA 3364

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 54/150 (36%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            SS+ ST A   AST A  S+S S   S+ST+  AS+   +STS+S  AST++S   S+S 
Sbjct: 3511 SSSASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSA 3570

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  S  AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   +
Sbjct: 3571 STSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSASESASTSASASA 3630

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 3631 STSASASASTSASASASTSASASASTSASA 3660

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 54/149 (36%), Positives = 82/149 (55%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 3551 STSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSA 3610

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3611 SASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 3670

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 3671 STSASASASTSASASASTSASASASTSAS 3699

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/153 (35%), Positives = 87/153 (56%), Gaps = 1/153 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 775  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 831

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 832  VSASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 891

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
            T  ++S ST+     S  ++A+  T +++  +I
Sbjct: 892  TSASASASTSASASASTSASASASTSASASASI 924

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1863 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1922

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST  S+ +S   S S++T +    ST A +S + +   S 
Sbjct: 1923 STSASTSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSA 1982

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+   + S S  A
Sbjct: 1983 STSASASASISASESASTSASASASTSASASA 2014

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1879 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASA 1938

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST  S+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE
Sbjct: 1939 STSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSA--SASASISASE 1996

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 1997 SASTSASASASTSASASASTSASESASTSASA 2028

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3193 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3252

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST  S+ +S   S S++T +    ST A +S + +   S 
Sbjct: 3253 STSASTSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSA 3312

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+   + S S  A
Sbjct: 3313 STSASASASISASESASTSASASASTSASASA 3344

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3209 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASA 3268

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST  S+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE
Sbjct: 3269 STSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSA--SASASISASE 3326

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 3327 SASTSASASASTSASASASTSASESASTSASA 3358

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 59/150 (39%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  SSSAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3447 SASASTSASASASTSA-SSSASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3503

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST ASSS   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3504 ASASTSASSSASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSAS 3563

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
            T  ++S ST+     S   SA+  V+ STS
Sbjct: 3564 TSASTSASTSTSASASASTSASASVSASTS 3593

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/151 (35%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A + AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3455 SASASTSASSSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3511

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            +  ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3512 SSASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSAS 3571

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 3572 TSTSASASASTSASASVSASTSASESASTSA 3602

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3627 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3683

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3684 ASASTSASASASTSASESASTSASASASTSASASASTSASESASTSASTSASASTSASES 3743

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 3744 ASTSASASASTSASESASTSASASASTSASA 3774

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/153 (35%), Positives = 85/153 (55%), Gaps = 1/153 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 855  SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 911

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 912  ASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 971

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
            T  ++S ST+     S  ++A+  T +++  +I
Sbjct: 972  TSASASASTSASASASTSASASASTSASASASI 1004

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/148 (37%), Positives = 85/148 (57%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 935  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 991

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  SV+ +   SE+
Sbjct: 992  ASASTSASASASISASESASTSASASASTSASESASTSASASASTSA--SVSASTSASES 1049

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 1050 ASTSASASASTSASASASTSASESASTS 1077

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/151 (36%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1095 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1151

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   SE+
Sbjct: 1152 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA--SASASTSASES 1209

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1210 ASTSASASASTSASASASTSASASASTSASA 1240

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1103 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1159

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A +S  T A   + 
Sbjct: 1160 ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASAS 1219

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1220 TSASASASTSASASASTSASASASTSASA 1248

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 47/151 (31%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 1616 TSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1675

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1676 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1735

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1736 TSASTSASTSASTSASTSASTSASTSASTSA 1766

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/153 (35%), Positives = 85/153 (55%), Gaps = 1/153 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2225 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2281

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2282 ASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 2341

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
            T  ++S ST+     S  ++A+  T +++  +I
Sbjct: 2342 TSASASASTSASASASTSASASASTSASASASI 2374

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/148 (37%), Positives = 85/148 (57%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2305 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2361

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  SV+ +   SE+
Sbjct: 2362 ASASTSASASASISASESASTSASASASTSASESASTSASASASTSA--SVSASTSASES 2419

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 2420 ASTSASASASTSASASASTSASESASTS 2447

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/151 (36%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2465 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2521

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   SE+
Sbjct: 2522 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA--SASASTSASES 2579

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2580 ASTSASASASTSASASASTSASASASTSASA 2610

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2473 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2529

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A +S  T A   + 
Sbjct: 2530 ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASAS 2589

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2590 TSASASASTSASASASTSASASASTSASA 2618

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 47/151 (31%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 2986 TSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 3045

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3046 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 3105

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3106 TSASTSASTSASTSASTSASTSASTSASTSA 3136

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/151 (36%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T ASS   +STS+S  AST++S   S+S +
Sbjct: 3431 SASASTSASASASTSA-SASASTSASASASTSASSS--ASTSASESASTSASASASTSAS 3487

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST ASS +S   S S++T +    ST A  S + +   S +
Sbjct: 3488 ASASTSASASASTSASASASTSASSSASTSASESASTSASASASTSASASASTSASASAS 3547

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + STS  A
Sbjct: 3548 TSASTSASTSASTSASTSASTSASTSTSASA 3578

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/151 (36%), Positives = 86/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3957 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4013

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 4014 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 4071

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 4072 ASTSASTSASASTSASASASTSASASASTSA 4102

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 56/151 (37%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4239 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4295

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS  +S   SVS++T +    ST A  S + +   SE+
Sbjct: 4296 ASASTSASESASTSASASASTSASESASTSASVSASTSASESASTSA--SASASTSASES 4353

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +  V+ STS  A
Sbjct: 4354 ASTSASASASTSASESASTSASVSASTSASA 4384

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/148 (37%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 4367 SESASTSASVSASTSA-SASASTSASASASTSASAS--ASTSASESASTSASVSASTSAS 4423

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T + V  ST A +S  T A   + 
Sbjct: 4424 ASASTSASESASTSASESASTSASASASTSASASASTSASVSASTSASESASTSASASAS 4483

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 4484 TSASASASTSASASASTSASASASTSAS 4511

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1183 SASASTSASVSASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1239

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A +S  T A   + 
Sbjct: 1240 ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASAS 1299

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1300 TSASESASTSASASASTSASASASTSASA 1328

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1587 SASASTSASVSASTSA-SASASTSASASASTSASAS--ASTSASASASTSASTSASTSAS 1643

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1644 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1703

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1704 TSASTSASTSASTSASTSASTSASTSASTSA 1734

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1867 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1926

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S + +   S 
Sbjct: 1927 STSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSA 1986

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T  + S S  A
Sbjct: 1987 SASASISASESASTSASASASTSASASASTSA 2018

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 54/153 (35%), Positives = 86/153 (56%), Gaps = 1/153 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+ST+  AS+    STS+S  AST++S   S+S +
Sbjct: 2147 SASASTSASVSASTSA-SASASTSASASTSASASA----STSASASASTSASASASTSAS 2201

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2202 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 2261

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
            T  ++S ST+     S  ++A+  T +++  +I
Sbjct: 2262 TSASASASTSASASASTSASASASTSASASASI 2294

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2553 SASASTSASVSASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2609

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A +S  T A   + 
Sbjct: 2610 ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASAS 2669

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2670 TSASESASTSASASASTSASASASTSASA 2698

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2957 SASASTSASVSASTSA-SASASTSASASASTSASAS--ASTSASASASTSASTSASTSAS 3013

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3014 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 3073

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3074 TSASTSASTSASTSASTSASTSASTSASTSA 3104

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3197 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3256

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S + +   S 
Sbjct: 3257 STSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSA 3316

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T  + S S  A
Sbjct: 3317 SASASISASESASTSASASASTSASASASTSA 3348

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 54/149 (36%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3341 SASASTSASESASTSA-SASASTSASASASTSASASASASTSASASASTSASESASTSAS 3399

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3400 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3459

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  +SS ST+     S  ++A+  T +++
Sbjct: 3460 TSASSSASTSASESASTSASASASTSASA 3488

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 52/148 (35%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3595 SESASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3651

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 3652 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 3711

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++     ++  SA+T  + STS
Sbjct: 3712 TSASASASTSASESASTSASTSASASTS 3739

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 55/151 (36%), Positives = 83/151 (54%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 411 SASASTSASASASTSA-SESASTSASASASTSASES--ASTSASASASTSASASASTSAS 467

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   SE+
Sbjct: 468 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA--SASASTSASES 525

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             TS+ ++A    +   S +   + STS  A
Sbjct: 526 ASTSASASASTSASESASTSASASASTSASA 556

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 419 SASASTSASESASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 475

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A +S  T A   + 
Sbjct: 476 ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASAS 535

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
           T  + S ST+     S  ++A+  T +++
Sbjct: 536 TSASESASTSASASASTSASASASTSASA 564

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 58/153 (37%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 539 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 595

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 596 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESAS 655

Query: 162 TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
           T  ++S ST+    TS   SA+T  + S S  A
Sbjct: 656 TSASASASTSASASTSASVSASTSASESASTSA 688

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 58/153 (37%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1303 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1359

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1360 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESAS 1419

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            T  ++S ST+    TS   SA+T  + S S  A
Sbjct: 1420 TSASASASTSASASTSASVSASTSASESASTSA 1452

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 1547 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 1603

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1604 ASASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSAS 1663

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1664 TSASTSASTSASTSASTSASTSASTSASTSA 1694

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 1579 SASASTSASASASTSASVSASTSASASASTSASASA----STSASASASTSASASASTSA 1634

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1635 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1694

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1695 STSASTSASTSASTSASTSASTSASTSASTSA 1726

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1591 STSASVSASTSASASASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSA 1650

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1651 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1710

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1711 STSASTSASTSASTSASTSASTSASTSASTSA 1742

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 54/154 (35%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 2131 SASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASAST 2190

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   
Sbjct: 2191 SASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSA 2248

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            SE+  TS+ ++A    ++  S +   + STS  A
Sbjct: 2249 SESASTSASASASTSASASASTSASASASTSASA 2282

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 58/153 (37%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2673 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 2729

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2730 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESAS 2789

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            T  ++S ST+    TS   SA+T  + S S  A
Sbjct: 2790 TSASASASTSASASTSASVSASTSASESASTSA 2822

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 2917 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 2973

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2974 ASASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSAS 3033

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3034 TSASTSASTSASTSASTSASTSASTSASTSA 3064

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 2949 SASASTSASASASTSASVSASTSASASASTSASASA----STSASASASTSASASASTSA 3004

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3005 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3064

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3065 STSASTSASTSASTSASTSASTSASTSASTSA 3096

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 2961 STSASVSASTSASASASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSA 3020

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3021 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3080

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3081 STSASTSASTSASTSASTSASTSASTSASTSA 3112

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3619 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3675

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A +S + +   S +
Sbjct: 3676 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASESASTSASTSAS 3735

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 3736 ASTSASESASTSASASASTSASESASTSASA 3766

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4141 SASASTSASASASTSA-SASASTSASESASTSASTSASASTSASASASTSASASASTSAS 4199

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 4200 ESASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASAS 4259

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4260 TSASASASTSASASASTSASASASTSASA 4288

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 48/149 (32%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 916  TSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSAS 975

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +SI  S S++T +    ST A +S  T A   + 
Sbjct: 976  ASASTSASASASTSASASASTSASASASISASESASTSASASASTSASESASTSASASAS 1035

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1036 TSASVSASTSASESASTSASASASTSASA 1064

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1499 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 1555

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   S +
Sbjct: 1556 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASAS 1615

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1616 TSASASASTSASASASTSASTSASTSASTSA 1646

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1911 STSASTSASTSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSA 1970

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  S  AS  +S   S S++T +    ST A +S + +   S 
Sbjct: 1971 SESASTSASTSASTSASASASISASESASTSASASASTSASASASTSASESASTSA--SA 2028

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  SA+T  + S S  A
Sbjct: 2029 SASTSASASASTSASASASASTSASASASTSA 2060

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 48/149 (32%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2286 TSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSAS 2345

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +SI  S S++T +    ST A +S  T A   + 
Sbjct: 2346 ASASTSASASASTSASASASTSASASASISASESASTSASASASTSASESASTSASASAS 2405

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2406 TSASVSASTSASESASTSASASASTSASA 2434

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2869 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 2925

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   S +
Sbjct: 2926 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASAS 2985

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 2986 TSASASASTSASASASTSASTSASTSASTSA 3016

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3241 STSASTSASTSASTSASTSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSA 3300

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  S  AS  +S   S S++T +    ST A +S + +   S 
Sbjct: 3301 SESASTSASTSASTSASASASISASESASTSASASASTSASASASTSASESASTSA--SA 3358

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  SA+T  + S S  A
Sbjct: 3359 SASTSASASASTSASASASASTSASASASTSA 3390

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 55/151 (36%), Positives = 86/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3611 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3667

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3668 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSA--SASASTSASES 3725

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 3726 ASTSASTSASASTSASESASTSASASASTSA 3756

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3699 SESASTSASASASTSA-SASASTSASESASTSASTSASASTSASESASTSASASASTSAS 3757

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 3758 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASAS 3817

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 3818 TSASESASTSASESASTSASASASTSASA 3846

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+ST+
Sbjct: 4061 SASASTSASESASTSA-STSASASTSASASASTSASASASTSASVSASTSASA--SASTS 4117

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 4118 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASTSAS 4177

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 4178 ASTSASASASTSASASASTSASESASTSASA 4208

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 467 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASASASTSAS 523

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 524 ESASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 581

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             TS+ ++A    ++  S +   + STS  A
Sbjct: 582 ASTSASASASTSASASASTSASASASTSASA 612

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 57/153 (37%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 547 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 603

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 604 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASAS 663

Query: 162 TVVTSSDSTAFGGGTSMF-SAATGVTCSTSMVA 67
           T  ++S S +    TS   SA+T  + S S  A
Sbjct: 664 TSASASTSASVSASTSASESASTSASASASTSA 696

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/151 (34%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +S S+S  AST++SV  S+
Sbjct: 619  SASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASTSASVSAST 678

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   
Sbjct: 679  SASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASA 738

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 739  STSASASASTSASASASTSASASASTSASES 769

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 55/151 (36%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1175 SASASTSASASASTSA-SVSASTSASASASTSASES--ASTSASASASTSASASASTSAS 1231

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   SE+
Sbjct: 1232 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA--SASASTSASES 1289

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 1290 ASTSASASASTSASESASTSASASASTSASA 1320

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1231 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASASASTSAS 1287

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1288 ESASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 1345

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1346 ASTSASASASTSASASASTSASASASTSASA 1376

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 57/153 (37%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1311 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 1367

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1368 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASAS 1427

Query: 162  TVVTSSDSTAFGGGTSMF-SAATGVTCSTSMVA 67
            T  ++S S +    TS   SA+T  + S S  A
Sbjct: 1428 TSASASTSASVSASTSASESASTSASASASTSA 1460

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/151 (34%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +S S+S  AST++SV  S+
Sbjct: 1383 SASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASTSASVSAST 1442

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   
Sbjct: 1443 SASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASA 1502

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 1503 STSASASASTSASASASTSASASASTSASES 1533

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1875 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1934

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   S 
Sbjct: 1935 SASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISA 1994

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 1995 SESASTSASASASTSASASASTSASESASTSA 2026

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 50/152 (32%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1891 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSASTSTSTSA 1950

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  S  AS+ +S   S S++  + +  S  A  S + +   S 
Sbjct: 1951 STSASTSASTSASTSASTSASESASTSASTSASTSASASASISASESASTSASASASTSA 2010

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 2011 SASASTSASESASTSASASASTSASASASTSA 2042

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 55/151 (36%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2545 SASASTSASASASTSA-SVSASTSASASASTSASES--ASTSASASASTSASASASTSAS 2601

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   SE+
Sbjct: 2602 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA--SASASTSASES 2659

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 2660 ASTSASASASTSASESASTSASASASTSASA 2690

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2601 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASASASTSAS 2657

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 2658 ESASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 2715

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2716 ASTSASASASTSASASASTSASASASTSASA 2746

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 57/153 (37%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2681 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 2737

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2738 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASAS 2797

Query: 162  TVVTSSDSTAFGGGTSMF-SAATGVTCSTSMVA 67
            T  ++S S +    TS   SA+T  + S S  A
Sbjct: 2798 TSASASTSASVSASTSASESASTSASASASTSA 2830

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/151 (34%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +S S+S  AST++SV  S+
Sbjct: 2753 SASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASTSASVSAST 2812

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   
Sbjct: 2813 SASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASA 2872

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 2873 STSASASASTSASASASTSASASASTSASES 2903

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3205 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 3264

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   S 
Sbjct: 3265 SASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISA 3324

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 3325 SESASTSASASASTSASASASTSASESASTSA 3356

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 50/152 (32%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3221 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSASTSTSTSA 3280

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  S  AS+ +S   S S++  + +  S  A  S + +   S 
Sbjct: 3281 STSASTSASTSASTSASTSASESASTSASTSASTSASASASISASESASTSASASASTSA 3340

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 3341 SASASTSASESASTSASASASTSASASASTSA 3372

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 53/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3941 SESASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3997

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3998 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4057

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + STS  A
Sbjct: 4058 TSASASASTSASESASTSASTSASASTSASA 4088

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 55/151 (36%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4045 SASASTSASASASTSA-SASASTSASESASTSASTSASASTSASASASTSASASASTSAS 4103

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   ST++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 4104 VSASTSASAS--ASTSASASTSASASASTSASESASTSASASASTSA--SASASTSASAS 4159

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  SA+T  + S S  A
Sbjct: 4160 ASTSASESASTSASTSASASTSASASASTSA 4190

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 54/148 (36%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4191 SASASTSASESASTSA-SASASTSASESASTSASES--ASTSASASASTSASASASTSAS 4247

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 4248 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 4305

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    +   S +  V+ STS
Sbjct: 4306 ASTSASASASTSASESASTSASVSASTS 4333

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 56/151 (37%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 4279 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASESASTSASVSASTSAS 4335

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T + V  ST A  S + +   S +
Sbjct: 4336 ESASTSASASASTSASESASTSASASASTSASESASTSASVSASTSA--SASASTSASAS 4393

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +  V+ STS  A
Sbjct: 4394 ASTSASASASTSASESASTSASVSASTSASA 4424

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 47/149 (31%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 472 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSAS 531

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 532 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 591

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
           T  ++S ST+     S  ++A+  T +++
Sbjct: 592 TSASASASTSASASASTSASASASTSASA 620

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 56/157 (35%), Positives = 84/157 (53%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGF---SSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST+     S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 627  SASASTSASASASTSASESASTSASESASTSASASASTSASASTSASVSASTSASESAST 686

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  + T A   
Sbjct: 687  SASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSA-SASTSASAS 745

Query: 168  SETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            + T  ++S ST+     S     SA+T  + S S  A
Sbjct: 746  ASTSASASASTSASASASTSASESASTSASASASTSA 782

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/148 (36%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 735  SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 791

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S  T A   + 
Sbjct: 792  ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASAS 851

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 852  TSASASASTSASASASTSASASASTSAS 879

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 839  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 895

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +SI  S S++T +    ST A  S  T A   + 
Sbjct: 896  ASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASAS 955

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 956  TSASASASTSASASASTSASASASTSASA 984

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 47/149 (31%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1236 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSAS 1295

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1296 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1355

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1356 TSASASASTSASASASTSASASASTSASA 1384

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 56/157 (35%), Positives = 84/157 (53%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGF---SSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST+     S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 1391 SASASTSASASASTSASESASTSASESASTSASASASTSASASTSASVSASTSASESAST 1450

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  + T A   
Sbjct: 1451 SASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSA-SASTSASAS 1509

Query: 168  SETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            + T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1510 ASTSASASASTSASASASTSASESASTSASASASTSA 1546

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1507 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1563

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  S + +   S +
Sbjct: 1564 ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASAS 1623

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1624 TSASASASTSASTSASTSASTSASTSASTSA 1654

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1555 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASASASTSAS 1611

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1612 ASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1671

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1672 TSASTSASTSASTSASTSASTSASTSASTSA 1702

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 46/151 (30%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1560 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSAS 1619

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1620 ASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1679

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1680 TSASTSASTSASTSASTSASTSASTSASTSA 1710

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/151 (35%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +S S+S  AST++S   S+S +
Sbjct: 2003 SASASTSASASASTSA-SESASTSASASASTSASASASTSASASASASTSASASASTSAS 2061

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +   TS     SV+ +   SE+
Sbjct: 2062 ESASTSASASASTSASESASTSASESASTSASASASTSASASTSA----SVSASTSASES 2117

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2118 ASTSASASASTSASASASTSASASASTSASA 2148

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 52/151 (34%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +S S+S  AST++SV  S+
Sbjct: 2053 SASASTSASESASTSASASASTSASESASTSASESASTSASASASTSASASTSASVSAST 2112

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   
Sbjct: 2113 SASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASA 2172

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 2173 STSASASASTSASASASTSASASASTSASES 2203

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2209 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 2265

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +SI  S S++T +    ST A  S  T A   + 
Sbjct: 2266 ASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASAS 2325

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2326 TSASASASTSASASASTSASASASTSASA 2354

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 47/149 (31%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2606 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSAS 2665

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2666 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 2725

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2726 TSASASASTSASASASTSASASASTSASA 2754

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 56/157 (35%), Positives = 84/157 (53%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGF---SSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST+     S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 2761 SASASTSASASASTSASESASTSASESASTSASASASTSASASTSASVSASTSASESAST 2820

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  + T A   
Sbjct: 2821 SASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSA-SASTSASAS 2879

Query: 168  SETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            + T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2880 ASTSASASASTSASASASTSASESASTSASASASTSA 2916

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2877 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2933

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  S + +   S +
Sbjct: 2934 ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASAS 2993

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 2994 TSASASASTSASTSASTSASTSASTSASTSA 3024

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2925 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASASASTSAS 2981

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2982 ASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 3041

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3042 TSASTSASTSASTSASTSASTSASTSASTSA 3072

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 46/151 (30%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2930 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSAS 2989

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2990 ASASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 3049

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3050 TSASTSASTSASTSASTSASTSASTSASTSA 3080

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3357 SASASTSASASASTSA-SASASASTSASASASTSASESASTSASASASTSASESASTSAS 3415

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3416 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASSSASTSASESAS 3475

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3476 TSASASASTSASASASTSASASASTSASA 3504

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3407 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3463

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            +  ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3464 SSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASSSASTSASESAS 3523

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3524 TSASASASTSASASASTSASASASTSAST 3552

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 59/154 (38%), Positives = 82/154 (53%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   SSS +T AS    +STS+S  AST++S   S+S +
Sbjct: 3439 SASASTSASASASTSA-SASASTSASSSASTSASES--ASTSASASASTSASASASTSAS 3495

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGAG 175
               ST AS+S   S +S  ST AS  +S   S S++T +    ST A  S      T A 
Sbjct: 3496 ASASTSASASASTSASSSASTSASESASTSASASASTSASASASTSASASASTSASTSAS 3555

Query: 174  RDSETVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
              + T  ++S ST+    TS   SA+T  + S S
Sbjct: 3556 TSASTSASTSASTSASTSTSASASASTSASASVS 3589

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS+ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3463 SSSASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASSSASTSAS 3519

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3520 ESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASAS 3579

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++     ++  SA+T  + S S  A
Sbjct: 3580 ASTSASASVSASTSASESASTSASASASTSA 3610

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 56/153 (36%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T ASS   +STS+S  AST++S   S+S +
Sbjct: 3479 SASASTSASASASTSA-SASASTSASASASTSASS--SASTSASESASTSASASASTSAS 3535

Query: 339  TGVSTGASSSFLISTTSGVST*A--SSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST AS+S   S ++  ST A  S+ +S   S S++T +    ST A  SV+ +   S
Sbjct: 3536 ASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSAS 3595

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            E+  TS+ ++A    ++  S +   + STS  A
Sbjct: 3596 ESASTSASASASTSASASASTSASESASTSASA 3628

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 85/151 (56%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S  +S+ST+
Sbjct: 3535 SASASTSASASASTSA-STSASTSASTSASTSASTSASTSTSASASASTSASASVSASTS 3593

Query: 339  T--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
                 ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   
Sbjct: 3594 ASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASAS 3653

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 3654 ASTSASASASTSASASASTSASASASTSASA 3684

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3861 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3917

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 3918 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASESASTSASASAS 3977

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3978 TSASASASTSASASASTSASASASTSASA 4006

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/148 (36%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4223 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4279

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  SV+ +   SE+
Sbjct: 4280 ASASTSASASASTSASASASTSASESASTSASASASTSASESASTSA--SVSASTSASES 4337

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    +   S +   + STS
Sbjct: 4338 ASTSASASASTSASESASTSASASASTS 4365

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 55/152 (36%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 4359 SASASTSASESASTSASVSASTSASASASTSASASA----STSASASASTSASESASTSA 4414

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S +   ST AS  +S   S S++T +    ST A  SV+ +   SE
Sbjct: 4415 SVSASTSASASASTSASESASTSASESASTSASASASTSASASASTSA--SVSASTSASE 4472

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 4473 SASTSASASASTSASASASTSASASASTSASA 4504

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/149 (36%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 459 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 515

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 516 ASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 575

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
           T  + S ST+     S  ++A+  T +++
Sbjct: 576 TSASESASTSASASASTSASASASTSASA 604

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/154 (34%), Positives = 82/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +S S+S  AST++S   S+
Sbjct: 689  SASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASAST 748

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   
Sbjct: 749  SASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSA 806

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            S +  TS+ ++A    ++  S +  V+ STS  A
Sbjct: 807  SASASTSASASASTSASASASTSASVSASTSASA 840

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 58/155 (37%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 743  SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 799

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  S  T A   + 
Sbjct: 800  ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASAS 859

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 860  TSASASASTSASASASTSASESASTSASASASTSA 894

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1135 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1191

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1192 VSASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASAS 1249

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +  V+ STS  A
Sbjct: 1250 ASTSASASASTSASASASTSASVSASTSASA 1280

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/149 (36%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 1223 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 1279

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1280 ASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1339

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1340 TSASESASTSASASASTSASASASTSASA 1368

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/154 (34%), Positives = 82/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +S S+S  AST++S   S+
Sbjct: 1453 SASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASAST 1512

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   
Sbjct: 1513 SASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSA 1570

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            S +  TS+ ++A    ++  S +  V+ STS  A
Sbjct: 1571 SASASTSASASASTSASASASTSASVSASTSASA 1604

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1539 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1595

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1596 VSASTSASASASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSAS 1655

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1656 TSASTSASTSASTSASTSASTSASTSASTSA 1686

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 46/151 (30%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1568 TSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSAS 1627

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1628 ASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1687

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1688 TSASTSASTSASTSASTSASTSASTSASTSA 1718

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 56/157 (35%), Positives = 83/157 (52%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGF---SSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST+     S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 2061 SESASTSASASASTSASESASTSASESASTSASASASTSASASTSASVSASTSASESAST 2120

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  + T A   
Sbjct: 2121 SASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSA-SASTSASAS 2179

Query: 168  SETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            + T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2180 ASTSASASASTSASASASTSASESASTSASASASTSA 2216

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2505 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2561

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2562 VSASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASAS 2619

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +  V+ STS  A
Sbjct: 2620 ASTSASASASTSASASASTSASVSASTSASA 2650

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/149 (36%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 2593 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 2649

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2650 ASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 2709

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2710 TSASESASTSASASASTSASASASTSASA 2738

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/154 (34%), Positives = 82/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +S S+S  AST++S   S+
Sbjct: 2823 SASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASAST 2882

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   
Sbjct: 2883 SASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSA 2940

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            S +  TS+ ++A    ++  S +  V+ STS  A
Sbjct: 2941 SASASTSASASASTSASASASTSASVSASTSASA 2974

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2909 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2965

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2966 VSASTSASASASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSAS 3025

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3026 TSASTSASTSASTSASTSASTSASTSASTSA 3056

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 46/151 (30%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2938 TSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSAS 2997

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2998 ASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 3057

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3058 TSASTSASTSASTSASTSASTSASTSASTSA 3088

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 52/152 (34%), Positives = 79/152 (51%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T  ST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 3265 SASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISA 3324

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S 
Sbjct: 3325 SESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASASTSASA 3384

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+  +A    ++  S +   + STS  A
Sbjct: 3385 SASTSASESASTSASASASTSASESASTSASA 3416

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3365 SASASTSASASAS-ASTSASASASTSASESASTSASASASTSASESASTSASASASTSAS 3423

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 3424 ASASTSASASASTSASASASTSASASASTSASASASTSASSSASTSASESASTSASASAS 3483

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T ++S
Sbjct: 3484 TSASASASTSASASASTSASASASTSASS 3512

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 55/149 (36%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3391 SESASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3447

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +S  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3448 ASASTSASASASTSASSSASTSASESASTSASASASTSASASASTSASASASTSASASAS 3507

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  +SS ST+     S  ++A+  T +++
Sbjct: 3508 TSASSSASTSASESASTSASASASTSASA 3536

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +S S+S  AST++S   S+S +
Sbjct: 3691 SASASTSASESASTSA-SASASTSASASASTSASESASTSASTSASASTSASESASTSAS 3749

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S + +   SE+
Sbjct: 3750 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSA--SES 3807

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 3808 ASTSASASASTSASESASTSASESASTSASA 3838

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3715 SASASTSASESASTSA-STSASASTSASESASTSASASASTSASESASTSASASASTSAS 3773

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 3774 ASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASESASTSASESAS 3833

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3834 TSASASASTSASASASTSASASASTSASA 3862

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3837 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 3893

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 3894 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 3953

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3954 TSASASASTSASESASTSASASASTSASA 3982

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3853 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3909

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3910 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSA--SASASTSASES 3967

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 3968 ASTSASASASTSASASASTSASASASTSASA 3998

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3973 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4029

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 4030 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASTSASASTSASAS 4089

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 4090 ASTSASASASTSASVSASTSASASASTSASA 4120

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +   S+   +STS+S  AST++SV  S+S +
Sbjct: 4053 SASASTSASASASTSA-SESASTSASTSASASTSASASASTSASASASTSASVSASTSAS 4111

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 4112 ASASTSASAS--TSASASASTSASESASTSASASASTSASASASTSA--SASASTSASES 4167

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 4168 ASTSASTSASASTSASASASTSASASASTSA 4198

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 767  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 823

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 824  ASASTSASVSASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 881

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 882  ASTSASASASTSASASASTSASASASTSASA 912

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/152 (35%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 815  SASASTSASASASTSASVSASTSASASASTSASASA----STSASASASTSASASASTSA 870

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE
Sbjct: 871  SASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASISASE 928

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 929  SASTSASASASTSASASASTSASASASTSASA 960

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1012 TSASASASTSASESASTSASASASTSASVSASTSASESASTSASASASTSASASASTSAS 1071

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1072 ESASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1131

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1132 TSASASASTSASASASTSASASASTSASA 1160

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1087 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 1143

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 1144 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASAS 1201

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 1202 ASTSASESASTSASASASTSASASASTSASA 1232

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T  ST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 1935 SASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISA 1994

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S 
Sbjct: 1995 SESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASASTSASA 2054

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+  +A    ++  S +   + STS
Sbjct: 2055 SASTSASESASTSASASASTSASESASTS 2083

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/148 (36%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2011 SASASTSASESASTSA-SASASTSASASASTSASASASASTSASASASTSASESASTSAS 2069

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T + V  ST A +S  T A   + 
Sbjct: 2070 ASASTSASESASTSASESASTSASASAST--SASASTSASVSASTSASESASTSASASAS 2127

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2128 TSASASASTSASASASTSASASASTSAS 2155

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2185 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2241

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 2242 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASISASES 2299

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2300 ASTSASASASTSASASASTSASASASTSASA 2330

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2382 TSASASASTSASESASTSASASASTSASVSASTSASESASTSASASASTSASASASTSAS 2441

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2442 ESASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 2501

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2502 TSASASASTSASASASTSASASASTSASA 2530

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2457 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 2513

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 2514 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASAS 2571

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 2572 ASTSASESASTSASASASTSASASASTSASA 2602

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/151 (35%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +S S+S  AST++S   S+S +
Sbjct: 3333 SASASTSASASASTSA-SESASTSASASASTSASASASTSASASASASTSASASASTSAS 3391

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3392 ESASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASAS 3449

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +S  S +   + STS  A
Sbjct: 3450 ASTSASASASTSASSSASTSASESASTSASA 3480

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/149 (36%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3399 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3455

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST ASSS   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3456 ASASTSASSSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASSSAS 3515

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 3516 TSASESASTSASASASTSASASASTSASA 3544

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 52/151 (34%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3415 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASSSASTSAS 3471

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 3472 ESASTSASASASTSASASASTSASASASTSASASASTSASSSASTSASESASTSASASAS 3531

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3532 TSASASASTSASASASTSASTSASTSASTSA 3562

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 51/151 (33%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A + AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3503 SASASTSASSSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASTSASTSAS 3559

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   ST++  S   S+ +S+  S S++  +    S  A  S + +   S +
Sbjct: 3560 TSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSAS 3619

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 3620 ESASTSASASASTSASASASTSASASASTSA 3650

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3765 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASESASTSASASASTSAS 3821

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 3822 ESASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 3881

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3882 TSASASASTSASASASTSASASASTSASA 3910

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3829 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3885

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3886 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 3943

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 3944 ASTSASASASTSASASASTSASESASTSASA 3974

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3949 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4005

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 4006 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 4063

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  SA+T  + S S  A
Sbjct: 4064 ASTSASESASTSASTSASASTSASASASTSA 4094

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 55/151 (36%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +S S+S  AST++S   S+S +
Sbjct: 4037 SASASTSASASASTSA-SASASTSASASASTSASESASTSASTSASASTSASASASTSAS 4095

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++      TS  A  + T A   + T
Sbjct: 4096 ASASTSASVSASTSASASASTSASASTSASASASTSASESASTSASA-SASTSASASAST 4154

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              ++S ST+     S  SA+T  + STS  A
Sbjct: 4155 SASASASTSASESAST-SASTSASASTSASA 4184

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 47/149 (31%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4428 TSASESASTSASESASTSASASASTSASASASTSASVSASTSASESASTSASASASTSAS 4487

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 4488 ASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASESASTSASESAS 4547

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4548 TSASASASTSASASASTSASASASTSASA 4576

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 571  SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 627

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +   TS     SV+ +   SE+
Sbjct: 628  ASASTSASASASTSASESASTSASESASTSASASASTSASASTSA----SVSASTSASES 683

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 684  ASTSASASASTSASASASTSASASASTSASA 714

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 665  SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 721

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 722  VSASTSASAS--ASTSASASTSASASASTSASASASTSASASASTSASESASTSASASAS 779

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 780  TSASASASTSASASASTSASASASTSASA 808

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ S  A T AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 725  STSASASASTSAS-ASTSASASASTSASASASTSASASASTSASESASTSASASASTSAS 783

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 784  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASAS 841

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 842  ASTSASASASTSASASASTSASASASTSASA 872

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 56/150 (37%), Positives = 85/150 (56%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 783  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 839

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 840  ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 899

Query: 162  TVVTSSDST-AFGGGTSMFSAATGVTCSTS 76
            T  ++S ST A    ++  SA+  ++ S S
Sbjct: 900  TSASASASTSASASASTSASASASISASES 929

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 57/155 (36%), Positives = 85/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 791  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASASASTSAS 847

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 848  ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 907

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S+    SA+T  + S S  A
Sbjct: 908  TSASASASTSASASASISASESASTSASASASTSA 942

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1055 SASASTSASASASTSA-SESASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1111

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1112 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 1169

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +  V+ STS  A
Sbjct: 1170 ASTSASASASTSASASASTSASVSASTSASA 1200

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/148 (36%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 1143 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 1199

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1200 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1259

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1260 TSASASASTSASVSASTSASASASTSAS 1287

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1335 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1391

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +   TS     SV+ +   SE+
Sbjct: 1392 ASASTSASASASTSASESASTSASESASTSASASASTSASASTSA----SVSASTSASES 1447

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1448 ASTSASASASTSASASASTSASASASTSASA 1478

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1429 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1485

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1486 VSASTSASAS--ASTSASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1543

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1544 TSASASASTSASASASTSASASASTSASA 1572

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2099 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2155

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2156 VSASTSASAS--ASTSASASTSASASASTSASASASTSASASASTSASESASTSASASAS 2213

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2214 TSASASASTSASASASTSASASASTSASA 2242

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2425 SASASTSASASASTSA-SESASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2481

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2482 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 2539

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +  V+ STS  A
Sbjct: 2540 ASTSASASASTSASASASTSASVSASTSASA 2570

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/148 (36%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 2513 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 2569

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2570 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2629

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2630 TSASASASTSASVSASTSASASASTSAS 2657

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2705 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2761

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +   TS     SV+ +   SE+
Sbjct: 2762 ASASTSASASASTSASESASTSASESASTSASASASTSASASTSA----SVSASTSASES 2817

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2818 ASTSASASASTSASASASTSASASASTSASA 2848

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2799 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2855

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2856 VSASTSASAS--ASTSASASTSASASASTSASASASTSASASASTSASESASTSASASAS 2913

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2914 TSASASASTSASASASTSASASASTSASA 2942

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASG--FFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSS 346
            S++ ST A T AST+  S+SAS     S+ST+T AS+   +S S+S  AST++S   S+S
Sbjct: 3543 SASASTSASTSASTSA-STSASTSASTSASTSTSASASASTSASASVSASTSASESASTS 3601

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 3602 ASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASAS 3661

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 3662 ASTSASASASTSASASASTSASASASTSASA 3692

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 56/156 (35%), Positives = 83/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST+   S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 3559 STSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSA 3618

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3619 SESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 3678

Query: 165  ETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
             T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3679 STSASASASTSASASASTSASESASTSASASASTSA 3714

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 3583 SASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSA 3642

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE
Sbjct: 3643 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASE 3700

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +   + STS
Sbjct: 3701 SASTSASASASTSASASASTSASESASTS 3729

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/148 (36%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4319 SESASTSASVSASTSA-SESASTSASASASTSASES--ASTSASASASTSASESASTSAS 4375

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   SE+
Sbjct: 4376 VSASTSASASASTSASASASTSASASASTSASESASTSASVSASTSA--SASASTSASES 4433

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 4434 ASTSASESASTSASASASTSASASASTS 4461

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/149 (33%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 4459 STSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSA 4518

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S +   ST AS  +S   S S++T +    ST A  S + +   S 
Sbjct: 4519 SESASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASA 4578

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++     ++  SA+  V+ STS
Sbjct: 4579 STSASASASTSASASASTSASASVSASTS 4607

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 55/148 (37%), Positives = 85/148 (57%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 531 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 587

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 588 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 645

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TS+  +A    ++  SA+T  + STS
Sbjct: 646 ASTSASESASTSASA--SASTSASASTS 671

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 697  SASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASAST 756

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 757  SASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA 816

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 817  SASTSASASASTSASVSASTSASASASTSASA 848

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 47/148 (31%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 892  TSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSAS 951

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 952  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASISASES 1009

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    +   S +   + STS
Sbjct: 1010 ASTSASASASTSASESASTSASASASTS 1037

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 48/151 (31%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1164 TSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSAS 1223

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 1224 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASAS 1281

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 1282 ASTSASESASTSASASASTSASESASTSASA 1312

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 55/148 (37%), Positives = 85/148 (57%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1295 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1351

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1352 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 1409

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  SA+T  + STS
Sbjct: 1410 ASTSASESASTSASA--SASTSASASTS 1435

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 1461 SASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASAST 1520

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 1521 SASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA 1580

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 1581 SASTSASASASTSASVSASTSASASASTSASA 1612

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 51/148 (34%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ S  A T AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1489 STSASASASTSAS-ASTSASASASTSASASASTSASASASTSASESASTSASASASTSAS 1547

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 1548 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASAS 1605

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 1606 ASTSASASASTSASASASTSASASASTS 1633

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/152 (34%), Positives = 80/152 (52%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +S S+S  AST++S   S+
Sbjct: 2123 SASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASAST 2182

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 2183 SASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASA 2242

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  + S ST+     S  ++A+  T +++
Sbjct: 2243 SASTSASESASTSASASASTSASASASTSASA 2274

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 47/148 (31%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2262 TSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSAS 2321

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 2322 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASISASES 2379

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    +   S +   + STS
Sbjct: 2380 ASTSASASASTSASESASTSASASASTS 2407

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 48/151 (31%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2534 TSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSAS 2593

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 2594 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASAS 2651

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 2652 ASTSASESASTSASASASTSASESASTSASA 2682

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 55/148 (37%), Positives = 85/148 (57%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2665 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 2721

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 2722 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 2779

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  SA+T  + STS
Sbjct: 2780 ASTSASESASTSASA--SASTSASASTS 2805

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 2831 SASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASAST 2890

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 2891 SASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA 2950

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 2951 SASTSASASASTSASVSASTSASASASTSASA 2982

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 51/148 (34%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ S  A T AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2859 STSASASASTSAS-ASTSASASASTSASASASTSASASASTSASESASTSASASASTSAS 2917

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 2918 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASAS 2975

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 2976 ASTSASASASTSASASASTSASASASTS 3003

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 55/151 (36%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3383 SASASTSASESASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3439

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST ASS +S   S S++T +    ST A  S + +   S +
Sbjct: 3440 ASASTSASASASTSASASASTSASSSASTSASESASTSASASASTSA--SASASTSASAS 3497

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +S  S +   + STS  A
Sbjct: 3498 ASTSASASASTSASSSASTSASESASTSASA 3528

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3757 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASESASTSAS 3813

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3814 ASASTSASESASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 3871

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 3872 ASTSASASASTSASASASTSASASASTSASA 3902

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3885 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3941

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3942 ESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 4001

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4002 TSASASASTSASASASTSASASASTSASA 4030

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3901 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3957

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3958 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4017

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4018 TSASASASTSASASASTSASASASTSASA 4046

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3909 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 3965

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3966 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4025

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4026 TSASASASTSASASASTSASASASTSASA 4054

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/149 (34%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS    +S S+S  AST++S   S+S +
Sbjct: 4133 SESASTSASASASTSA-SASASTSASASASTSASESASTSASTSASASTSASASASTSAS 4191

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 4192 ASASTSASESASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASAS 4251

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4252 TSASASASTSASASASTSASASASTSASA 4280

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4407 SESASTSASVSASTSA-SASASTSASESASTSASES--ASTSASASASTSASASASTSAS 4463

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S + +   SE+
Sbjct: 4464 VSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSA--SES 4521

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 4522 ASTSASASASTSASESASTSASESASTSASA 4552

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 47/149 (31%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4436 TSASESASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSAS 4495

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 4496 ASASTSASASASTSASESASTSASESASTSASASASTSASESASTSASESASTSASASAS 4555

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4556 TSASASASTSASASASTSASASASTSASA 4584

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 54/152 (35%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4455 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4511

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 4512 ESASTSASESASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASAS 4571

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S  ++A+  T +++ V+
Sbjct: 4572 TSASASASTSASASASTSASASASTSASASVS 4603

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S + ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 427 SESASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 483

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 484 ASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSA--SASASTSASES 541

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             TS+ ++A    ++  S +   + STS  A
Sbjct: 542 ASTSASASASTSASASASTSASASASTSASA 572

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 435 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 491

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS+S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 492 ASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASESASTSASASAS 551

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCST 79
           T  ++S ST+     S  ++A+  T ++
Sbjct: 552 TSASASASTSASASASTSASASASTSAS 579

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 713  SASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASASASTSASESAST 772

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 773  SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASV 832

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 833  SASTSASASASTSASASASTSASASASTSASA 864

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 45/151 (29%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 804  TSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSAS 863

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 864  ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 923

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S  ++     ++  SA+   + S S  A
Sbjct: 924  ISASESASTSASASASTSASASASTSASASA 954

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/149 (34%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 823  SASASTSASVSASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 879

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    S  A +S  T A   + 
Sbjct: 880  ESASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSASASAS 939

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 940  TSASASASTSASASASTSASASASTSASA 968

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 47/149 (31%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 996  TSASASASISASESASTSASASASTSASESASTSASASASTSASVSASTSASESASTSAS 1055

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1056 ASASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASAS 1115

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1116 TSASESASTSASASASTSASASASTSASA 1144

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 54/151 (35%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1007 SESASTSASASASTSA-SESASTSASASASTSAS--VSASTSASESASTSASASASTSAS 1063

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1064 ASASTSASESASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 1121

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1122 ASTSASASASTSASASASTSASASASTSASA 1152

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1199 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1255

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1256 ASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASESASTSASASAS 1315

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1316 TSASASASTSASASASTSASASASTSAS 1343

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 1477 SASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASASASTSASESAST 1536

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 1537 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASV 1596

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 1597 SASTSASASASTSASASASTSASASASTSASA 1628

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1531 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1587

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1588 ASASTSASVSASTSASASASTSASASASTSASASASTSASASASTSASTSASTSASTSAS 1647

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1648 TSASTSASTSASTSASTSASTSASTSASTSA 1678

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/149 (33%), Positives = 78/149 (52%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1927 STSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSA 1986

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   S  AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1987 SASASISASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASA 2046

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    +   S +   + STS
Sbjct: 2047 SASTSASASASTSASESASTSASASASTS 2075

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 47/149 (31%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2366 TSASASASISASESASTSASASASTSASESASTSASASASTSASVSASTSASESASTSAS 2425

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2426 ASASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASAS 2485

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2486 TSASESASTSASASASTSASASASTSASA 2514

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 54/151 (35%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2377 SESASTSASASASTSA-SESASTSASASASTSAS--VSASTSASESASTSASASASTSAS 2433

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 2434 ASASTSASESASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 2491

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2492 ASTSASASASTSASASASTSASASASTSASA 2522

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2569 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2625

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2626 ASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASESASTSASASAS 2685

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2686 TSASASASTSASASASTSASASASTSAS 2713

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 2847 SASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASASASTSASESAST 2906

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 2907 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASV 2966

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 2967 SASTSASASASTSASASASTSASASASTSASA 2998

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2901 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2957

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2958 ASASTSASVSASTSASASASTSASASASTSASASASTSASASASTSASTSASTSASTSAS 3017

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3018 TSASTSASTSASTSASTSASTSASTSASTSA 3048

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/149 (33%), Positives = 78/149 (52%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3257 STSASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSA 3316

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   S  AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3317 SASASISASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASA 3376

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    +   S +   + STS
Sbjct: 3377 SASTSASASASTSASESASTSASASASTS 3405

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 48/156 (30%), Positives = 83/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFS-----STSSSFFASTTSSVLL 355
            S++ ST A T AST+   S+++   +S++T+ ++S   S     STS+S  AST++S   
Sbjct: 3285 STSASTSASTSASTSASESASTSASTSASTSASASASISASESASTSASASASTSASASA 3344

Query: 354  SSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            S+S +   ST AS+S   S ++  ST AS+ +S   S S++  +    S     S + + 
Sbjct: 3345 STSASESASTSASASASTSASASASTSASASASASTSASASASTSASESASTSASASAST 3404

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              SE+  TS+ ++A    ++  S +   + STS  A
Sbjct: 3405 SASESASTSASASASTSASASASTSASASASTSASA 3440

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3877 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3933

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3934 ASASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 3993

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3994 TSASASASTSASASASTSASASASTSASA 4022

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3893 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3949

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3950 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 4009

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4010 TSASASASTSASASASTSASASASTSASA 4038

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3917 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASESASTSAS 3973

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3974 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4033

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4034 TSASASASTSASASASTSASASASTSASA 4062

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3925 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3981

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3982 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4041

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 4042 TSASASASTSASASASTSASASASTSAS 4069

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/148 (34%), Positives = 80/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4157 SASASTSASESASTSA-STSASASTSASASASTSASASASTSASESASTSASASASTSAS 4215

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 4216 ESASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4275

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 4276 TSASASASTSASASASTSASASASTSAS 4303

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 54/149 (36%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 4415 SVSASTSASASASTSA-SESASTSASESASTSASAS--ASTSASASASTSASVSASTSAS 4471

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 4472 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASAS 4531

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 4532 TSASESASTSASESASTSASASASTSASA 4560

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 47/149 (31%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 480 TSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSAS 539

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 540 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 599

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
           T  ++S ST+     S  ++A+  T +++
Sbjct: 600 TSASASASTSASASASTSASASASTSASA 628

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 499 SASASTSASVSASTSA-SASASTSASESASTSASAS--ASTSASESASTSASASASTSAS 555

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 556 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 615

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCST 79
           T  ++S ST+     S  ++A+  T ++
Sbjct: 616 TSASASASTSASASASTSASASASTSAS 643

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 46/148 (31%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 900  TSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSAS 959

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    S  A +S + +   S +
Sbjct: 960  ASASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSA--SAS 1017

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +  V+ STS
Sbjct: 1018 ASTSASESASTSASASASTSASVSASTS 1045

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 57/155 (36%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 943  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 999

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS S   S ++  ST AS  +S   S S++T + V  ST A +S  T A   + 
Sbjct: 1000 ASASISASESASTSASASASTSASESASTSASASASTSASVSASTSASESASTSASASAS 1059

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1060 TSASASASTSASESASTSASESASTSASASASTSA 1094

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/150 (34%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1035 STSASVSASTSASESASTSASASASTSASASASTSASESASTSASESASTSASASASTSA 1094

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   +
Sbjct: 1095 SASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASA 1154

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 1155 STSASASASTSASASASTSASASASTSASA 1184

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 47/151 (31%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1156 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSAS 1215

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 1216 ASASTSASASASTSASASASTSASASASTSASASASTSASASAST----SASASASTSAS 1271

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            V  S+ ++A    ++  SA+T  + S S  A
Sbjct: 1272 VSASTSASASASTSASESASTSASASASTSA 1302

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 47/149 (31%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1244 TSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSAS 1303

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1304 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 1363

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1364 TSASASASTSASASASTSASASASTSASA 1392

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1263 SASASTSASVSASTSA-SASASTSASESASTSASAS--ASTSASESASTSASASASTSAS 1319

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1320 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1379

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1380 TSASASASTSASASASTSASASASTSAS 1407

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1523 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1579

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1580 ASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSASASASTSASTSAS 1639

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1640 TSASTSASTSASTSASTSASTSASTSASTSA 1670

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2177 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2233

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2234 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 2293

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S  ++     ++  SA+   + S S  A
Sbjct: 2294 ISASESASTSASASASTSASASASTSASASA 2324

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/149 (34%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2193 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2249

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    S  A +S  T A   + 
Sbjct: 2250 ESASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSASASAS 2309

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2310 TSASASASTSASASASTSASASASTSASA 2338

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 46/148 (31%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2270 TSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSAS 2329

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    S  A +S + +   S +
Sbjct: 2330 ASASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSA--SAS 2387

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +  V+ STS
Sbjct: 2388 ASTSASESASTSASASASTSASVSASTS 2415

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 57/155 (36%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2313 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2369

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS S   S ++  ST AS  +S   S S++T + V  ST A +S  T A   + 
Sbjct: 2370 ASASISASESASTSASASASTSASESASTSASASASTSASVSASTSASESASTSASASAS 2429

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2430 TSASASASTSASESASTSASESASTSASASASTSA 2464

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/150 (34%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 2405 STSASVSASTSASESASTSASASASTSASASASTSASESASTSASESASTSASASASTSA 2464

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   +
Sbjct: 2465 SASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASA 2524

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 2525 STSASASASTSASASASTSASASASTSASA 2554

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 47/151 (31%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2526 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSAS 2585

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 2586 ASASTSASASASTSASASASTSASASASTSASASASTSASASAST----SASASASTSAS 2641

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            V  S+ ++A    ++  SA+T  + S S  A
Sbjct: 2642 VSASTSASASASTSASESASTSASASASTSA 2672

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 47/149 (31%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2614 TSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSAS 2673

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2674 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 2733

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2734 TSASASASTSASASASTSASASASTSASA 2762

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2633 SASASTSASVSASTSA-SASASTSASESASTSASAS--ASTSASESASTSASASASTSAS 2689

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2690 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 2749

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2750 TSASASASTSASASASTSASASASTSAS 2777

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2893 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2949

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2950 ASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSASASASTSASTSAS 3009

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3010 TSASTSASTSASTSASTSASTSASTSASTSA 3040

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/149 (34%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3349 SESASTSASASASTSA-SASASTSASASASASTSASASASTSASESASTSASASASTSAS 3407

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3408 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASSSAS 3467

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 3468 TSASESASTSASASASTSASASASTSASA 3496

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3471 SESASTSASASASTSA-SASASTSASASASTSASA--SASTSASSSASTSASESASTSAS 3527

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 3528 ASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASAS 3587

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            V  S+ ++     ++  SA+T  + S S  A
Sbjct: 3588 VSASTSASESASTSASASASTSASASASTSA 3618

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3845 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3901

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3902 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 3961

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 3962 TSASESASTSASASASTSASASASTSASA 3990

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3869 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3925

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3926 ASASTSASASASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASAS 3985

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3986 TSASASASTSASASASTSASASASTSASA 4014

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3981 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4037

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +   TS  A  S + +   S +
Sbjct: 4038 ASASTSASASASTSASASASTSASASASTSASESASTSA--STSASASTSASASASTSAS 4095

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + STS  A
Sbjct: 4096 ASASTSASVSASTSASASASTSASASTSASA 4126

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/150 (35%), Positives = 84/150 (56%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4013 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4069

Query: 339  TGVSTGASSSFLIST--TSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST AS+S   ST  ++  ST AS+ +S   SVS++T +    ST A  S + +   S
Sbjct: 4070 ESASTSASTSASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASAS 4129

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             +   S+ ++A    ++  SA+   + S S
Sbjct: 4130 TSASESASTSASASASTSASASASTSASAS 4159

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 56/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4165 SESASTSASTSAS-ASTSASASASTSASASASTSASESASTSASASASTSASESASTSAS 4223

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 4224 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4283

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 4284 TSASASASTSASASASTSASESASTSASASASTSA 4318

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4423 SASASTSASESASTSA-SESASTSASASASTSASAS--ASTSASVSASTSASESASTSAS 4479

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 4480 ASASTSASASASTSASASASTSASASASTSASESASTSASESASTSA--SASASTSASES 4537

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 4538 ASTSASESASTSASASASTSASASASTSASA 4568

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 451 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 507

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 508 VSASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASAS 567

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
           T  ++S ST+     S  ++A+  T +++
Sbjct: 568 TSASASASTSASESASTSASASASTSASA 596

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 759  SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 815

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 816  ASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSASASASTSASASAS 875

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 876  TSASESASTSASASASTSASASASTSASA 904

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 47/151 (31%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 796  TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSAS 855

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 856  ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSA--SASASTSASAS 913

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 914  ASTSASASASISASESASTSASASASTSASA 944

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S S +
Sbjct: 871  SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASISAS 927

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 928  ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 987

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S+    SA+T  + S S  A
Sbjct: 988  TSASASASTSASASASISASESASTSASASASTSA 1022

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/148 (35%), Positives = 79/148 (53%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1047 SESASTSASASASTSA-SASASTSASESASTSASES--ASTSASASASTSASASASTSAS 1103

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1104 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 1163

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1164 TSASASASTSASASASTSASASASTSAS 1191

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1079 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1135

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 1136 ASASTSASASASTSASASASTSASASASTSASASASTSASASAST----SASASASTSAS 1191

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            V  S+ ++A    ++  SA+T  + S S  A
Sbjct: 1192 VSASTSASASASTSASESASTSASASASTSA 1222

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1127 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1183

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1184 ASASTSASVSASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1243

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1244 TSASASASTSASASASTSASASASTSAS 1271

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1191 SVSASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1247

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 1248 ASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSA--SASASTSASES 1305

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1306 ASTSASASASTSASASASTSASASASTSASA 1336

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1215 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1271

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1272 VSASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASAS 1331

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1332 TSASASASTSASESASTSASASASTSASA 1360

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 52/151 (34%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1515 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1571

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 1572 ASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSASASAS 1631

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1632 TSASTSASTSASTSASTSASTSASTSASTSA 1662

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 56/156 (35%), Positives = 83/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1975 STSASTSASTSASASASISASESASTSASASASTSASASASTSASESASTSASASASTSA 2034

Query: 342  TTGVSTGASSSFLIST--TSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            +   ST AS+S   ST  ++  ST AS  +S   S S++T +    ST A +S  T A  
Sbjct: 2035 SASASTSASASASASTSASASASTSASESASTSASASASTSASESASTSASESASTSASA 2094

Query: 171  DSETVVTSSDSTAFGGGTSMF-SAATGVTCSTSMVA 67
             + T  ++S S +    TS   SA+T  + S S  A
Sbjct: 2095 SASTSASASTSASVSASTSASESASTSASASASTSA 2130

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 55/155 (35%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ S  A T AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2159 STSASASASTSAS-ASTSASASASTSASASASTSASASASTSASESASTSASASASTSAS 2217

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2218 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 2277

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S+    SA+T  + S S  A
Sbjct: 2278 TSASASASTSASASASISASESASTSASASASTSA 2312

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S S +
Sbjct: 2241 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASISAS 2297

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2298 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2357

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S+    SA+T  + S S  A
Sbjct: 2358 TSASASASTSASASASISASESASTSASASASTSA 2392

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/148 (35%), Positives = 79/148 (53%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2417 SESASTSASASASTSA-SASASTSASESASTSASES--ASTSASASASTSASASASTSAS 2473

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2474 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 2533

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2534 TSASASASTSASASASTSASASASTSAS 2561

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2449 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 2505

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 2506 ASASTSASASASTSASASASTSASASASTSASASASTSASASAST----SASASASTSAS 2561

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            V  S+ ++A    ++  SA+T  + S S  A
Sbjct: 2562 VSASTSASASASTSASESASTSASASASTSA 2592

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2497 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2553

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2554 ASASTSASVSASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 2613

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2614 TSASASASTSASASASTSASASASTSAS 2641

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2561 SVSASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2617

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 2618 ASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSA--SASASTSASES 2675

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2676 ASTSASASASTSASASASTSASASASTSASA 2706

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2585 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2641

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2642 VSASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASAS 2701

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2702 TSASASASTSASESASTSASASASTSASA 2730

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 52/151 (34%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2885 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2941

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 2942 ASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSASASAS 3001

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3002 TSASTSASTSASTSASTSASTSASTSASTSA 3032

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 51/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  SSSAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3495 SASASTSASASASTSA-SSSASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3551

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST  S+ +S   S S++  +    S  A  S + +   S +
Sbjct: 3552 TSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSAS 3611

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3612 ASASTSASESASTSASASASTSASASASTSA 3642

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 45/151 (29%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+ST+
Sbjct: 3524 TSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTS 3583

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               S  AS+S   S ++  S  AS+ +S   S S++  +    S  A  S + +   S +
Sbjct: 3584 ASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSAS 3643

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 3644 ASASTSASASASTSASASASTSASASASTSA 3674

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 52/151 (34%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3707 SASASTSASASASTSA-SESASTSASTSASASTSASESASTSASASASTSASESASTSAS 3765

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3766 ASASTSASASASTSASASASTSASASASTSASESASTSASESASTSA--SASASTSASES 3823

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 3824 ASTSASESASTSASASASTSASASASTSASA 3854

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 51/148 (34%), Positives = 78/148 (52%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AS A  S+S S   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3723 SESASTSASTSAS-ASTSASESASTSASASASTSASESASTSASASASTSASASASTSAS 3781

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 3782 ASASTSASASASTSASESASTSASESASTSASASASTSASESASTSASESASTSASASAS 3841

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 3842 TSASASASTSASASASTSASASASTSAS 3869

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3789 SASASTSASESASTSA-SESASTSASASASTSASES--ASTSASESASTSASASASTSAS 3845

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3846 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 3905

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3906 TSASASASTSASASASTSASASASTSASA 3934

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3813 SASASTSASESASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3869

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3870 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3929

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3930 TSASASASTSASESASTSASASASTSASA 3958

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 51/149 (34%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4149 SASASTSASASASTSA-SESASTSASTSASASTSASASASTSASASASTSASESASTSAS 4207

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 4208 ASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 4267

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4268 TSASASASTSASASASTSASASASTSASA 4296

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4199 SESASTSASASASTSA-SESASTSASESASTSASAS--ASTSASASASTSASASASTSAS 4255

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 4256 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 4315

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  + S ST+     S     SA+T  + S S  A
Sbjct: 4316 TSASESASTSASVSASTSASESASTSASASASTSA 4350

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 52/148 (35%), Positives = 80/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4487 SASASTSASASASTSA-SASASTSASESASTSASES--ASTSASASASTSASESASTSAS 4543

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 4544 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASVS 4603

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++   A+T  + S S
Sbjct: 4604 ASTSASESASTSASASALASTSASASAS 4631

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 57/153 (37%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 555  SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 611

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 612  ASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASTS 671

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
              V++S S +    TS   SA+T  + S S  A
Sbjct: 672  ASVSASTSASESASTSASASASTSASASASTSA 704

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGF---SSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST+     S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 635  SASASTSASESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASASAST 694

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS  +S   S S++T +   TS  A  S + +   
Sbjct: 695  SASASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASA 754

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 755  STSASASASTSASESASTSASASASTSASAS 785

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++SV  S+S 
Sbjct: 669  STSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA 728

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  S  AS+ +S   S S++      TS  A  S + +   S 
Sbjct: 729  SASASTSASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAST 788

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++A    ++  SA+   + S S
Sbjct: 789  SASASASTSASASASTSASASASTSASAS 817

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 751  SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 807

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 808  ASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSASASAS 867

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 868  TSASASASTSASESASTSASASASTSASA 896

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 54/149 (36%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S S +
Sbjct: 951  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASISAS 1007

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   SVS++T +    ST A  S  T A   + 
Sbjct: 1008 ESASTSASASASTSASESASTSASASASTSASVSASTSASESASTSASASASTSASASAS 1067

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1068 TSASESASTSASESASTSASASASTSASA 1096

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+S S   S+S +   S+   +STS+S  AST++SV  S+S +
Sbjct: 988  TSASASASTSASASASISASESASTSASASASTSASESASTSASASASTSASVSASTSAS 1047

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1048 ESASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASAS 1107

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1108 TSASASASTSASESASTSASASASTSASA 1136

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1031 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASESASTSASESASTSAS 1087

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1088 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1147

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1148 TSASASASTSASASASTSASASASTSASA 1176

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1111 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1167

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1168 ASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASASAS 1227

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1228 TSASASASTSASASASTSASASASTSASA 1256

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1119 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1175

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1176 ASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASASASTSASASAS 1235

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1236 TSASASASTSASASASTSASASASTSASA 1264

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 57/153 (37%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1319 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1375

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1376 ASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASTS 1435

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
              V++S S +    TS   SA+T  + S S  A
Sbjct: 1436 ASVSASTSASESASTSASASASTSASASASTSA 1468

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGF---SSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST+     S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 1399 SASASTSASESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASASAST 1458

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS  +S   S S++T +   TS  A  S + +   
Sbjct: 1459 SASASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASA 1518

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 1519 STSASASASTSASESASTSASASASTSASAS 1549

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++SV  S+S 
Sbjct: 1433 STSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA 1492

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  S  AS+ +S   S S++      TS  A  S + +   S 
Sbjct: 1493 SASASTSASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAST 1552

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++A    ++  SA+   + S S
Sbjct: 1553 SASASASTSASASASTSASASASTSASAS 1581

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 49/153 (32%), Positives = 83/153 (54%), Gaps = 5/153 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFS-----STSSSFFASTTSSVLL 355
            S++ ST A T AST+   S+++   +S++T+ ++S   S     STS+S  AST++S   
Sbjct: 1955 STSASTSASTSASTSASESASTSASTSASTSASASASISASESASTSASASASTSASASA 2014

Query: 354  SSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            S+S +   ST AS+S   S ++  ST AS+ +S   S S++  +    S     S + + 
Sbjct: 2015 STSASESASTSASASASTSASASASTSASASASASTSASASASTSASESASTSASASAST 2074

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              SE+  TS+  +A    ++  SA+T  + STS
Sbjct: 2075 SASESASTSASESASTSASA--SASTSASASTS 2105

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 57/155 (36%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1971 SESASTSASTSAST---SASASASISASESASTSASASASTSASASASTSASESASTSAS 2027

Query: 339  TGVST--GASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
               ST   AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   
Sbjct: 2028 ASASTSASASASTSASASASASTSASASASTSASESASTSASASASTSASESASTSASES 2087

Query: 168  SETVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            + T  ++S ST+    TS   SA+T  + S S  A
Sbjct: 2088 ASTSASASASTSASASTSASVSASTSASESASTSA 2122

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGF---SSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST+     S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 2069 SASASTSASESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASASAST 2128

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS  +S   S S++T +   TS  A  S + +   
Sbjct: 2129 SASASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASA 2188

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 2189 STSASASASTSASESASTSASASASTSASAS 2219

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 54/149 (36%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S S +
Sbjct: 2321 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASISAS 2377

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   SVS++T +    ST A  S  T A   + 
Sbjct: 2378 ESASTSASASASTSASESASTSASASASTSASVSASTSASESASTSASASASTSASASAS 2437

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2438 TSASESASTSASESASTSASASASTSASA 2466

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+S S   S+S +   S+   +STS+S  AST++SV  S+S +
Sbjct: 2358 TSASASASTSASASASISASESASTSASASASTSASESASTSASASASTSASVSASTSAS 2417

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2418 ESASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASAS 2477

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2478 TSASASASTSASESASTSASASASTSASA 2506

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2401 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASESASTSASESASTSAS 2457

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2458 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 2517

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2518 TSASASASTSASASASTSASASASTSASA 2546

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2481 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2537

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2538 ASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASASAS 2597

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2598 TSASASASTSASASASTSASASASTSASA 2626

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2489 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2545

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2546 ASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASASASTSASASAS 2605

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2606 TSASASASTSASASASTSASASASTSASA 2634

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 57/153 (37%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2689 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2745

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2746 ASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASTS 2805

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
              V++S S +    TS   SA+T  + S S  A
Sbjct: 2806 ASVSASTSASESASTSASASASTSASASASTSA 2838

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGF---SSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST+     S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 2769 SASASTSASESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASASAST 2828

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS  +S   S S++T +   TS  A  S + +   
Sbjct: 2829 SASASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASA 2888

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 2889 STSASASASTSASESASTSASASASTSASAS 2919

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++SV  S+S 
Sbjct: 2803 STSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA 2862

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  S  AS+ +S   S S++      TS  A  S + +   S 
Sbjct: 2863 SASASTSASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAST 2922

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++A    ++  SA+   + S S
Sbjct: 2923 SASASASTSASASASTSASASASTSASAS 2951

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3603 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3659

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3660 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSA--SASASTSASAS 3717

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  SA+T  + S S  A
Sbjct: 3718 ASTSASESASTSASTSASASTSASESASTSA 3748

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 51/151 (33%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3643 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3699

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++  +    S     S + +   SE+
Sbjct: 3700 ESASTSASASASTSASASASTSASESASTSASTSASASTSASESASTSASASASTSASES 3759

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 3760 ASTSASASASTSASASASTSASASASTSASA 3790

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/148 (35%), Positives = 79/148 (53%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3797 SESASTSASESASTSA-SASASTSASESASTSASES--ASTSASASASTSASASASTSAS 3853

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3854 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 3913

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 3914 TSASASASTSASASASTSASASASTSAS 3941

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 57/155 (36%), Positives = 80/155 (51%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3805 SESASTSASASASTSA-SESASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3861

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3862 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3921

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3922 TSASASASTSASASASTSASESASTSASASASTSA 3956

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3821 SESASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3877

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3878 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3937

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  + S ST+     S  ++A+  T ++
Sbjct: 3938 TSASESASTSASASASTSASASASTSAS 3965

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/150 (35%), Positives = 84/150 (56%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4005 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4061

Query: 339  TGVSTGA--SSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST A  S+S   ST++  ST AS+ +S   S S++T + V  ST A  S + +   S
Sbjct: 4062 ASASTSASESASTSASTSASASTSASASASTSASASASTSASVSASTSASASASTSASAS 4121

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             +   S+ ++A    ++  SA+   + S S
Sbjct: 4122 TSASASASTSASESASTSASASASTSASAS 4151

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 51/148 (34%), Positives = 78/148 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4069 SESASTSASTSAS-ASTSASASASTSASASASTSASVSASTSASASASTSASA--STSAS 4125

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 4126 ASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASTSASASTSASAS 4185

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    +   S +   + STS
Sbjct: 4186 ASTSASASASTSASESASTSASASASTS 4213

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 54/148 (36%), Positives = 79/148 (53%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4287 SASASTSASASASTSA-SESASTSASASASTSASES--ASTSASVSASTSASESASTSAS 4343

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   SVS++T +    ST A  S  T A   + 
Sbjct: 4344 ASASTSASESASTSASASASTSASESASTSASVSASTSASASASTSASASASTSASASAS 4403

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  + S ST+     S  ++A+  T ++
Sbjct: 4404 TSASESASTSASVSASTSASASASTSAS 4431

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 51/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 4371 STSASVSASTSASASASTSASASASTSASASASTSASESASTSASVSASTSASASASTSA 4430

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS S   S ++  ST AS+ +S   SVS++T +    ST A  S + +   S 
Sbjct: 4431 SESASTSASESASTSASASASTSASASASTSASVSASTSASESASTSA--SASASTSASA 4488

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +   + STS
Sbjct: 4489 SASTSASASASTSASASASTSASESASTS 4517

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 57/155 (36%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 515 SASASTSASESASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 571

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 572 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 631

Query: 162 TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
           T  ++S ST+     S     SA+T  + S S  A
Sbjct: 632 TSASASASTSASESASTSASESASTSASASASTSA 666

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 54/148 (36%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 579  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 635

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T + V  ST A +S  T A   + 
Sbjct: 636  ASASTSASESASTSASESASTSASASAST--SASASTSASVSASTSASESASTSASASAS 693

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 694  TSASASASTSASASASTSASASASTSAS 721

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 55/154 (35%), Positives = 81/154 (52%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 587  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 643

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++      TS  A  + T A   + T
Sbjct: 644  ESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASA-SASTSASASAST 702

Query: 159  VVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
              ++S ST+     S     SA+T  + S S  A
Sbjct: 703  SASASASTSASASASTSASVSASTSASASASTSA 736

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 681  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASA--SASTS 735

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 736  ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 795

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 796  TSASASASTSASASASTSASASASTSASA 824

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +S S+S  AST++S   S+S +
Sbjct: 967  SASASTSASASASTSA-SASASTSASASASTSASAS--ASISASESASTSASASASTSAS 1023

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 1024 ESASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASESASTSASESAS 1083

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1084 TSASASASTSASASASTSASASASTSASA 1112

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 47/148 (31%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 972  TSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASESASTSAS 1031

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1032 ASASTSASVSASTSASESASTSASASASTSASASASTSASESASTSASESASTSASASAS 1091

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1092 TSASASASTSASASASTSASASASTSAS 1119

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/155 (32%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 980  TSASASASTSASASASTSASASASISASESASTSASASASTSASESASTSASASASTSAS 1039

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1040 VSASTSASESASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASAS 1099

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1100 TSASASASTSASASASTSASESASTSASASASTSA 1134

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1063 SASASTSASESASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1119

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1120 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1179

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1180 TSASASASTSASVSASTSASASASTSAS 1207

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 57/155 (36%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1279 SASASTSASESASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1335

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1336 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1395

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1396 TSASASASTSASESASTSASESASTSASASASTSA 1430

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 54/148 (36%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1343 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1399

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T + V  ST A +S  T A   + 
Sbjct: 1400 ASASTSASESASTSASESASTSASASAST--SASASTSASVSASTSASESASTSASASAS 1457

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1458 TSASASASTSASASASTSASASASTSAS 1485

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 55/154 (35%), Positives = 81/154 (52%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1351 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1407

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++      TS  A  + T A   + T
Sbjct: 1408 ESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASA-SASTSASASAST 1466

Query: 159  VVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
              ++S ST+     S     SA+T  + S S  A
Sbjct: 1467 SASASASTSASASASTSASVSASTSASASASTSA 1500

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 1445 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASA--SASTS 1499

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1500 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1559

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1560 TSASASASTSASASASTSASASASTSASA 1588

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++SV  S+S 
Sbjct: 2103 STSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA 2162

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  S  AS+ +S   S S++      TS  A  S + +   S 
Sbjct: 2163 SASASTSASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAST 2222

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++A    ++  SA+   + S S
Sbjct: 2223 SASASASTSASASASTSASASASTSASES 2251

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/151 (35%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2169 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 2225

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 2226 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSA--SASASTSASAS 2283

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 2284 ASTSASASASISASESASTSASASASTSASA 2314

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +S S+S  AST++S   S+S +
Sbjct: 2337 SASASTSASASASTSA-SASASTSASASASTSASAS--ASISASESASTSASASASTSAS 2393

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 2394 ESASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASESASTSASESAS 2453

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2454 TSASASASTSASASASTSASASASTSASA 2482

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 47/148 (31%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2342 TSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASESASTSAS 2401

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2402 ASASTSASVSASTSASESASTSASASASTSASASASTSASESASTSASESASTSASASAS 2461

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2462 TSASASASTSASASASTSASASASTSAS 2489

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/155 (32%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2350 TSASASASTSASASASTSASASASISASESASTSASASASTSASESASTSASASASTSAS 2409

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2410 VSASTSASESASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASAS 2469

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2470 TSASASASTSASASASTSASESASTSASASASTSA 2504

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2433 SASASTSASESASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2489

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2490 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2549

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2550 TSASASASTSASVSASTSASASASTSAS 2577

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 57/155 (36%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2649 SASASTSASESASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2705

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2706 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2765

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2766 TSASASASTSASESASTSASESASTSASASASTSA 2800

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 54/148 (36%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2713 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2769

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T + V  ST A +S  T A   + 
Sbjct: 2770 ASASTSASESASTSASESASTSASASAST--SASASTSASVSASTSASESASTSASASAS 2827

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2828 TSASASASTSASASASTSASASASTSAS 2855

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 55/154 (35%), Positives = 81/154 (52%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2721 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2777

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++      TS  A  + T A   + T
Sbjct: 2778 ESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASA-SASTSASASAST 2836

Query: 159  VVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
              ++S ST+     S     SA+T  + S S  A
Sbjct: 2837 SASASASTSASASASTSASVSASTSASASASTSA 2870

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 2815 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASA--SASTS 2869

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2870 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 2929

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2930 TSASASASTSASASASTSASASASTSASA 2958

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/150 (35%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSS-SASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST+  +S SAS   S S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 3569 SASTSTSASASASTSASASVSASTSASESASTSASAS--ASTSASASASTSASESASTSA 3626

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3627 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 3686

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 3687 STSASASASTSASESASTSASASASTSASA 3716

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3749 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3805

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3806 ESASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASAS 3865

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 3866 TSASESASTSASASASTSASASASTSASA 3894

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3773 SASASTSASASASTSA-SASASTSASESASTSASES--ASTSASASASTSASESASTSAS 3829

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3830 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 3889

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3890 TSASASASTSASASASTSASASASTSASA 3918

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3781 SASASTSASASASTSA-SESASTSASESASTSASAS--ASTSASESASTSASESASTSAS 3837

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3838 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 3897

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3898 TSASASASTSASASASTSASASASTSASA 3926

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/154 (33%), Positives = 79/154 (51%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 4079 SASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASESAST 4138

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS  +S   S S++  +    S     S + +   
Sbjct: 4139 SASASASTSASASASTSASASASTSASESASTSASTSASASTSASASASTSASASASTSA 4198

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            SE+  TS+ ++A    +   S +   + STS  A
Sbjct: 4199 SESASTSASASASTSASESASTSASESASTSASA 4232

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 54/156 (34%), Positives = 83/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 4095 SASASTSASVSASTSASASASTSASASTSASASASTSASESASTSASASASTSASASAST 4154

Query: 348  STTTGVSTGA--SSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            S +   ST A  S+S   ST++  ST AS+ +S   S S++T +    ST A  S + + 
Sbjct: 4155 SASASASTSASESASTSASTSASASTSASASASTSASASASTSASESASTSA--SASAST 4212

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              SE+  TS+  +A    ++  S +   + STS  A
Sbjct: 4213 SASESASTSASESASTSASASASTSASASASTSASA 4248

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4175 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASESASTSASESASTSAS 4231

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 4232 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4291

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 4292 TSASASASTSASESASTSASASASTSAS 4319

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4247 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4303

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 4304 ESASTSASASASTSASESASTSASVSASTSASESASTSASASASTSASESASTSASASAS 4363

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 4364 TSASESASTSASVSASTSASASASTSASA 4392

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4263 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 4319

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 4320 ESASTSASVSASTSASESASTSASASASTSASESASTSASASASTSASESASTSASVSAS 4379

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 4380 TSASASASTSASASASTSASASASTSAS 4407

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4471 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASESASTSAS 4527

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 4528 ASASTSASESASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASAS 4585

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 4586 ASTSASASASTSASASVSASTSASESASTSA 4616

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 491 SASASTSASASASTSA-SVSASTSASASASTSASES--ASTSASASASTSASESASTSAS 547

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 548 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 607

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
           T  ++S ST+     S  ++A+  T +++
Sbjct: 608 TSASASASTSASASASTSASASASTSASA 636

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 59/153 (38%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+ST+
Sbjct: 611  SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASESASTSASA--SASTS 665

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 666  ASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSAS 725

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            T  ++S ST+    TS   SA+T  + S S  A
Sbjct: 726  TSASASASTSASASTSASASASTSASASASTSA 758

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 52/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 847  SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 903

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  S  AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 904  ASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASAS 963

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 964  TSASASASTSASASASTSASASASTSASA 992

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/150 (35%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 1023 SESASTSASASASTSASVSASTSASESASTSASASA----STSASASASTSASESASTSA 1078

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1079 SESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASA 1138

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 1139 STSASASASTSASASASTSASASASTSASA 1168

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1255 SASASTSASASASTSA-SVSASTSASASASTSASES--ASTSASASASTSASESASTSAS 1311

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1312 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1371

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1372 TSASASASTSASASASTSASASASTSASA 1400

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 59/153 (38%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+ST+
Sbjct: 1375 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASESASTSASA--SASTS 1429

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1430 ASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSAS 1489

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            T  ++S ST+    TS   SA+T  + S S  A
Sbjct: 1490 TSASASASTSASASTSASASASTSASASASTSA 1522

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 52/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2217 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 2273

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  S  AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2274 ASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASAS 2333

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2334 TSASASASTSASASASTSASASASTSASA 2362

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/150 (35%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 2393 SESASTSASASASTSASVSASTSASESASTSASASA----STSASASASTSASESASTSA 2448

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 2449 SESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASA 2508

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 2509 STSASASASTSASASASTSASASASTSASA 2538

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2625 SASASTSASASASTSA-SVSASTSASASASTSASES--ASTSASASASTSASESASTSAS 2681

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2682 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 2741

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2742 TSASASASTSASASASTSASASASTSASA 2770

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 59/153 (38%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+ST+
Sbjct: 2745 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASESASTSASA--SASTS 2799

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2800 ASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSAS 2859

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            T  ++S ST+    TS   SA+T  + S S  A
Sbjct: 2860 TSASASASTSASASTSASASASTSASASASTSA 2892

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3519 SESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASA 3578

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   S  AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3579 SASTSASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASA 3638

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 3639 STSASASASTSASASASTSASASASTSASA 3668

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 55/155 (35%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3997 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4053

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               ST AS+S   S +   ST AS+ +S   S S   ST+ S   +++ +  + T A   
Sbjct: 4054 ASASTSASASASTSASESASTSASTSASASTSASASASTSASASASTSASVSASTSASAS 4113

Query: 168  SETVVTSSDSTAFGGGTSMF-SAATGVTCSTSMVA 67
            + T  ++S S +    TS   SA+T  + S S  A
Sbjct: 4114 ASTSASASTSASASASTSASESASTSASASASTSA 4148

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTS--SVLLSSS 346
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++  S   S+S
Sbjct: 4117 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASESASTSAS 4173

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
            T+   ST AS+S   S ++  ST AS  +S   S S++T +    ST A +S  T A   
Sbjct: 4174 TSASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASESASTSASAS 4233

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 4234 ASTSASASASTSASASASTSASASASTSASA 4264

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 54/151 (35%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4255 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 4311

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S +   ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 4312 ASASTSASESASTSASVSASTSASESASTSASASASTSASESASTSA--SASASTSASES 4369

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 4370 ASTSASVSASTSASASASTSASASASTSASA 4400

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4271 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASESASTSAS 4327

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  SV+ +   S +
Sbjct: 4328 VSASTSASESASTSASASASTSASESASTSASASASTSASESASTSA--SVSASTSASAS 4385

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 4386 ASTSASASASTSASASASTSASESASTS 4413

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 4447 SASASTSASASASTSASVSASTSASESASTSASASA----STSASASASTSASASASTSA 4502

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 4503 SASASTSASESASTSASESASTSASASASTSASESASTSASESASTSASASASTSASASA 4562

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 4563 STSASASASTSASASASTSASASASTSASA 4592

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 443 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 499

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 500 ASASTSASVSASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASAS 559

Query: 162 TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
           T  ++S ST+     S     SA+T  + S S  A
Sbjct: 560 TSASASASTSASASASTSASESASTSASASASTSA 594

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 49/151 (32%), Positives = 77/151 (50%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 643  SESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASASASTSASASAST 702

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S +   ST AS+ +S   S S++  +   TS  A  S + +   
Sbjct: 703  SASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASASA 762

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 763  STSASESASTSASASASTSASASASTSASAS 793

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1207 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1263

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1264 ASASTSASVSASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASAS 1323

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1324 TSASASASTSASASASTSASESASTSASASASTSA 1358

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 49/151 (32%), Positives = 77/151 (50%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 1407 SESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASASASTSASASAST 1466

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S +   ST AS+ +S   S S++  +   TS  A  S + +   
Sbjct: 1467 SASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASASA 1526

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 1527 STSASESASTSASASASTSASASASTSASAS 1557

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 53/154 (34%), Positives = 78/154 (50%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2019 SESASTSASASASTSA-SASASTSASASASASTSASASASTSASESASTSASASASTSAS 2077

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++      TS  A  + T A   + T
Sbjct: 2078 ESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASA-SASTSASASAST 2136

Query: 159  VVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
              ++S ST+     S     SA+T  + S S  A
Sbjct: 2137 SASASASTSASASASTSASVSASTSASASASTSA 2170

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 59/153 (38%), Positives = 82/153 (53%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+ST+
Sbjct: 2045 SASASTSASASASTSA-SESASTSASASASTSASES--ASTSASESASTSASA--SASTS 2099

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2100 ASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSAS 2159

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            T  ++S ST+    TS   SA+T  + S S  A
Sbjct: 2160 TSASASASTSASASTSASASASTSASASASTSA 2192

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 49/151 (32%), Positives = 77/151 (50%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 2077 SESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASASASTSASASAST 2136

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S +   ST AS+ +S   S S++  +   TS  A  S + +   
Sbjct: 2137 SASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASASA 2196

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 2197 STSASESASTSASASASTSASASASTSASAS 2227

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 58/155 (37%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 2115 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASA--SASTS 2169

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2170 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 2229

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2230 TSASASASTSASASASTSASESASTSASASASTSA 2264

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2577 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2633

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2634 ASASTSASVSASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASAS 2693

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2694 TSASASASTSASASASTSASESASTSASASASTSA 2728

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 49/151 (32%), Positives = 77/151 (50%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 2777 SESASTSASESASTSASASASTSASASTSASVSASTSASESASTSASASASTSASASAST 2836

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S +   ST AS+ +S   S S++  +   TS  A  S + +   
Sbjct: 2837 SASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASASA 2896

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 2897 STSASESASTSASASASTSASASASTSASAS 2927

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3301 SESASTSASTSAST---SASASASISASESASTSASASASTSASASASTSASESASTSAS 3357

Query: 339  TGVST--GASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
               ST   AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   
Sbjct: 3358 ASASTSASASASTSASASASASTSASASASTSASESASTSASASASTSASESASTSASAS 3417

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 3418 ASTSASASASTSASASASTSASASASTSASA 3448

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 48/148 (32%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +S  ++ +V+ +++A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S +
Sbjct: 3580 ASTSASASVSASTSASESASTSASASASTSASASA----STSASESASTSASASASTSAS 3635

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3636 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3695

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  + S ST+     S  ++A+  T ++
Sbjct: 3696 TSASESASTSASASASTSASASASTSAS 3723

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 53/149 (35%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3741 SESASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3797

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3798 ESASTSASESASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASAS 3857

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3858 TSASASASTSASESASTSASASASTSASA 3886

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3989 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4045

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +    S S++T +   TS  A  S + +   S +
Sbjct: 4046 ASASTSASASASTSASASASTSASESA----STSASTSASASTSASASASTSASASASTS 4101

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 4102 ASVSASTSASASASTSASASTSASASASTSA 4132

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/151 (34%), Positives = 83/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ S  A T AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4107 STSASASASTSAS-ASTSASASASTSASESASTSASASASTSASASASTSASASASTSAS 4165

Query: 339  TGVSTGASSSFLIST--TSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
               ST AS+S   ST  ++  ST AS+ +S   S S++T +    ST A +S  T A   
Sbjct: 4166 ESASTSASTSASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASES 4225

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 4226 ASTSASASASTSASASASTSASASASTSASA 4256

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 47/148 (31%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4292 TSASASASTSASESASTSASASASTSASESASTSASVSASTSASESASTSASASASTSAS 4351

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 4352 ESASTSASASASTSASESASTSASVSASTSASASASTSASASASTSA--SASASTSASES 4409

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 4410 ASTSASVSASTSASASASTSASESASTS 4437

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 57/155 (36%), Positives = 80/155 (51%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4335 SESASTSASASASTSA-SESASTSASASASTSASES--ASTSASVSASTSASASASTSAS 4391

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 4392 ASASTSASASASTSASESASTSASVSASTSASASASTSASESASTSASESASTSASASAS 4451

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 4452 TSASASASTSASVSASTSASESASTSASASASTSA 4486

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/151 (33%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 603  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASESASTSAS 659

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  S   S+ +S   S S++  +   TS  A  S + +   S +
Sbjct: 660  ASASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTS 719

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 720  ASVSASTSASASASTSASASTSASASASTSA 750

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/151 (33%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +S S+S  AST++S   S+S +
Sbjct: 887  SASASTSASASASTSA-SASASTSASASASTSASAS--ASISASESASTSASASASTSAS 943

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 944  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1003

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S  ++     ++  SA+   + S S  A
Sbjct: 1004 ISASESASTSASASASTSASESASTSASASA 1034

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/151 (33%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1367 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASESASTSAS 1423

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  S   S+ +S   S S++  +   TS  A  S + +   S +
Sbjct: 1424 ASASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTS 1483

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 1484 ASVSASTSASASASTSASASTSASASASTSA 1514

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/151 (33%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +S S+S  AST++S   S+S +
Sbjct: 2257 SASASTSASASASTSA-SASASTSASASASTSASAS--ASISASESASTSASASASTSAS 2313

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2314 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2373

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S  ++     ++  SA+   + S S  A
Sbjct: 2374 ISASESASTSASASASTSASESASTSASASA 2404

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/151 (33%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2737 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASESASTSAS 2793

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  S   S+ +S   S S++  +   TS  A  S + +   S +
Sbjct: 2794 ASASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTS 2853

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 2854 ASVSASTSASASASTSASASTSASASASTSA 2884

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3375 SASASTSASASASTSA-SESASTSASASASTSASES--ASTSASASASTSASASASTSAS 3431

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3432 ASASTSASASASTSASASASTSASASASTSASSSASTSASESASTSASASASTSASASAS 3491

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++++  T ++
Sbjct: 3492 TSASASASTSASASASTSASSSASTSAS 3519

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 51/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3635 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3691

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    S     S + +   S +
Sbjct: 3692 ASASTSASESASTSASASASTSASASASTSASESASTSASTSASASTSASESASTSASAS 3751

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 3752 ASTSASESASTSASASASTSASASASTSASA 3782

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3733 SASASTSASESASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3789

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3790 ASASTSASESASTSASESASTSASASASTSASESASTSASESASTSASASASTSASASAS 3849

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3850 TSASASASTSASASASTSASESASTSASASASTSA 3884

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTS--SVLLSSS 346
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++  S   S+S
Sbjct: 4021 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 4077

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
            T+   ST AS+S   S ++  ST AS  +S   S S++T +   TS  A  + T A   +
Sbjct: 4078 TSASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASA-SASTSASESA 4136

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 4137 STSASASASTSASASASTSASASASTSAS 4165

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 54/152 (35%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 4311 SASASTSASESASTSASVSASTSASESASTSASASA----STSASESASTSASASASTSA 4366

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S 
Sbjct: 4367 SESASTSASVSASTSASASASTSASASASTSASASASTSASESASTSA--SVSASTSASA 4424

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+  +A    +   S +   + STS  A
Sbjct: 4425 SASTSASESASTSASESASTSASASASTSASA 4456

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 53/148 (35%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4399 SASASTSASESASTSA-SVSASTSASASASTSASES--ASTSASESASTSASASASTSAS 4455

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 4456 ASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 4513

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 4514 ASTSASESASTSASASASTSASESASTS 4541

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 52/148 (35%), Positives = 79/148 (53%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S + ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 507 SVSASTSASASASTSA-SESASTSASASASTSASES--ASTSASASASTSASASASTSAS 563

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 564 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASAS 621

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TS+ ++A    ++  S +   + STS
Sbjct: 622 ASTSASASASTSASASASTSASESASTS 649

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 49/151 (32%), Positives = 78/151 (51%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+S S   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 651  SESASTSASASASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASAST 710

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS S   S ++  ST AS+ +S   S S++  +   TS  A  + T A   
Sbjct: 711  SASASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASA-SASTSASES 769

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 770  ASTSASASASTSASASASTSASASASTSASA 800

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 47/148 (31%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 686  TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASA--STSAS 743

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 744  ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 803

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 804  TSASASASTSASASASTSASASASTSAS 831

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 50/150 (33%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 827  STSASVSASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSA 886

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S  T A   +
Sbjct: 887  SASASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASA 946

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 947  STSASASASTSASASASTSASASASTSASA 976

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 54/150 (36%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 863  SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 919

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 920  ASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 979

Query: 162  TVVTSSDST-AFGGGTSMFSAATGVTCSTS 76
            T  ++S ST A    ++  SA+  ++ S S
Sbjct: 980  TSASASASTSASASASTSASASASISASES 1009

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 47/151 (31%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AS ++S   S+S +
Sbjct: 956  TSASASASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSAS 1015

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 1016 ASASTSASESASTSASASASTSASVSASTSASESASTSASASASTSA--SASASTSASES 1073

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 1074 ASTSASESASTSASASASTSASASASTSASA 1104

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 52/148 (35%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1271 SVSASTSASASASTSA-SESASTSASASASTSASES--ASTSASASASTSASASASTSAS 1327

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1328 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASAS 1385

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 1386 ASTSASASASTSASASASTSASESASTS 1413

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 49/151 (32%), Positives = 78/151 (51%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+S S   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 1415 SESASTSASASASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASAST 1474

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS S   S ++  ST AS+ +S   S S++  +   TS  A  + T A   
Sbjct: 1475 SASASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASA-SASTSASES 1533

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 1534 ASTSASASASTSASASASTSASASASTSASA 1564

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 47/148 (31%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1450 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASA--STSAS 1507

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1508 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1567

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1568 TSASASASTSASASASTSASASASTSAS 1595

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 57/155 (36%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2027 SASASTSASASASTSA-SASASASTSASASASTSASESASTSASASASTSASESASTSAS 2085

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2086 ESASTSASAS--ASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASAS 2143

Query: 162  TVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + STS  A
Sbjct: 2144 TSASASASTSASVSASTSASASASTSASASTSASA 2178

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 49/151 (32%), Positives = 78/151 (51%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+S S   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 2085 SESASTSASASASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASAST 2144

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS S   S ++  ST AS+ +S   S S++  +   TS  A  + T A   
Sbjct: 2145 SASASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASA-SASTSASES 2203

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 2204 ASTSASASASTSASASASTSASASASTSASA 2234

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2201 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 2257

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S  T A   + 
Sbjct: 2258 ASASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASAS 2317

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2318 TSASASASTSASASASTSASASASTSASA 2346

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 54/150 (36%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2233 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2289

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2290 ASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2349

Query: 162  TVVTSSDST-AFGGGTSMFSAATGVTCSTS 76
            T  ++S ST A    ++  SA+  ++ S S
Sbjct: 2350 TSASASASTSASASASTSASASASISASES 2379

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 47/151 (31%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AS ++S   S+S +
Sbjct: 2326 TSASASASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSAS 2385

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 2386 ASASTSASESASTSASASASTSASVSASTSASESASTSASASASTSA--SASASTSASES 2443

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 2444 ASTSASESASTSASASASTSASASASTSASA 2474

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 52/148 (35%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2641 SVSASTSASASASTSA-SESASTSASASASTSASES--ASTSASASASTSASASASTSAS 2697

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2698 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASAS 2755

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 2756 ASTSASASASTSASASASTSASESASTS 2783

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 49/151 (32%), Positives = 78/151 (51%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+S S   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 2785 SESASTSASASASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASAST 2844

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS S   S ++  ST AS+ +S   S S++  +   TS  A  + T A   
Sbjct: 2845 SASASASTSASVSASTSASASASTSASASTSASASASTSASASASTSASA-SASTSASES 2903

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 2904 ASTSASASASTSASASASTSASASASTSASA 2934

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 47/148 (31%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2820 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASA--STSAS 2877

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2878 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 2937

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2938 TSASASASTSASASASTSASASASTSAS 2965

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 3305 STSASTSASTSASASASISASESASTSASASASTSASASASTSASESASTSASASASTSA 3364

Query: 342  TTGVSTGASSSFLIST--TSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            +   ST AS+S   ST  ++  ST AS  +S   S S++T +    ST A  S  T A  
Sbjct: 3365 SASASTSASASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASA 3424

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 3425 SASTSASASASTSASASASTSASASASTSASA 3456

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 54/150 (36%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 3683 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASESASTSASTSASASTS 3739

Query: 339  T--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
                 ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S
Sbjct: 3740 ASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSAS 3797

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            E+  TS+  +A    ++  S +   + STS
Sbjct: 3798 ESASTSASESASTSASASASTSASESASTS 3827

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 59/155 (38%), Positives = 85/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 595  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 651

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 652  ESASTSASAS--ASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASAS 709

Query: 162  TVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + STS  A
Sbjct: 710  TSASASASTSASVSASTSASASASTSASASTSASA 744

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 46/151 (30%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+S S   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 908  TSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSAS 967

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   SE+
Sbjct: 968  ASASTSASASASTSASASASTSASASASTSASASASISASESASTSA--SASASTSASES 1025

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 1026 ASTSASASASTSASVSASTSASESASTSASA 1056

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 59/155 (38%), Positives = 85/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1359 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1415

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1416 ESASTSASAS--ASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASAS 1473

Query: 162  TVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + STS  A
Sbjct: 1474 TSASASASTSASVSASTSASASASTSASASTSASA 1508

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2120 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASA--STSAS 2177

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2178 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 2237

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2238 TSASASASTSASESASTSASASASTSASA 2266

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 46/151 (30%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+S S   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2278 TSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSAS 2337

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   SE+
Sbjct: 2338 ASASTSASASASTSASASASTSASASASTSASASASISASESASTSA--SASASTSASES 2395

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 2396 ASTSASASASTSASVSASTSASESASTSASA 2426

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 59/155 (38%), Positives = 85/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2729 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 2785

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2786 ESASTSASAS--ASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASAS 2843

Query: 162  TVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + STS  A
Sbjct: 2844 TSASASASTSASVSASTSASASASTSASASTSASA 2878

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/151 (31%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFAST--TSSVLLSSS 346
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST  ++S   S+S
Sbjct: 3314 TSASASASISASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSAS 3373

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 3374 ASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASAS 3433

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T ++S
Sbjct: 3434 ASTSASASASTSASASASTSASASASTSASS 3464

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 51/150 (34%), Positives = 83/150 (55%), Gaps = 3/150 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3651 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3707

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               ST AS+S   S +   ST AS+ +S   S S   ST+ S   +++ +  + T A   
Sbjct: 3708 ASASTSASASASTSASESASTSASTSASASTSASESASTSASASASTSASESASTSASAS 3767

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCST 79
            + T  ++S ST+     S  ++A+  T ++
Sbjct: 3768 ASTSASASASTSASASASTSASASASTSAS 3797

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 44/148 (29%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +  AS+   +S S+S  AST++S   S+S +
Sbjct: 4074 TSASTSASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSAS 4133

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    S     S + +   S +
Sbjct: 4134 ESASTSASASASTSASASASTSASASASTSASESASTSASTSASASTSASASASTSASAS 4193

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 4194 ASTSASESASTSASASASTSASESASTS 4221

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 51/155 (32%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4380 TSASASASTSASASASTSASASASTSASESASTSASVSASTSASASASTSASESASTSAS 4439

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 4440 ESASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASAS 4499

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 4500 TSASASASTSASESASTSASESASTSASASASTSA 4534

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 48/151 (31%), Positives = 78/151 (51%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2035 SASASTSASASAS-ASTSASASASTSASESASTSASASASTSASESASTSASESASTSAS 2093

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  S   S+ +S   S S++  +   TS  A  S + +   S +
Sbjct: 2094 ASASTSASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTS 2153

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 2154 ASVSASTSASASASTSASASTSASASASTSA 2184

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 53/149 (35%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 4391 SASASTSASASASTSASESASTSASVSASTSASASA----STSASESASTSASESASTSA 4446

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   +
Sbjct: 4447 SASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASA 4506

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  + S ST+     S  ++A+  T ++
Sbjct: 4507 STSASESASTSASESASTSASASASTSAS 4535

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 57/155 (36%), Positives = 79/155 (50%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4303 SESASTSASASASTSA-SESASTSASVSASTSASES--ASTSASASASTSASESASTSAS 4359

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 4360 ASASTSASESASTSASVSASTSASASASTSASASASTSASASASTSASESASTSASVSAS 4419

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 4420 TSASASASTSASESASTSASESASTSASASASTSA 4454

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 47/149 (31%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4340 TSASASASTSASESASTSASASASTSASESASTSASVSASTSASASASTSASASASTSAS 4399

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 4400 ASASTSASESASTSASVSASTSASASASTSASESASTSASESASTSASASASTSASASAS 4459

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 4460 TSASVSASTSASESASTSASASASTSASA 4488

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 54/151 (35%), Positives = 84/151 (55%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST- 343
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+ST 
Sbjct: 4125 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASESASTSASTSASASTS 4181

Query: 342  -TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 4182 ASASASTSASASASTSASESASTSASASASTSASESASTSASESASTSASASASTSASAS 4241

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 4242 ASTSASASASTSASASASTSASASASTSASA 4272

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 3/150 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST- 343
            S + ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+ST 
Sbjct: 3325 SESASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASASTS 3381

Query: 342  -TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   
Sbjct: 3382 ASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASAS 3441

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCST 79
            + T  ++S ST+     S  ++++  T ++
Sbjct: 3442 ASTSASASASTSASASASTSASSSASTSAS 3471

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 58/157 (36%), Positives = 84/157 (53%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3667 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 3723

Query: 339  TGVSTGASSSFLISTTS--GVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
               ST AS+S   ST++    ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 3724 ESASTSASTSASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASAS 3783

Query: 168  SETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            + T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3784 ASTSASASASTSASESASTSASESASTSASASASTSA 3820

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 47/157 (29%), Positives = 84/157 (53%), Gaps = 4/157 (2%)
 Frame = -1

Query: 525 IYSSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSS 346
           +  S+ ++ +++++ +   S+S S   S+ST+  AS+    STS+S  AST++S   S+S
Sbjct: 386 VVESSTTSQSLSQSKSLSVSASQSASASASTSASASA----STSASESASTSASASASTS 441

Query: 345 TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTST----GA*DSVTGA 178
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST     A  S + +
Sbjct: 442 ASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASAS 501

Query: 177 GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S +V  S+ ++A    ++  SA+T  + S S  A
Sbjct: 502 ASTSASVSASTSASASASTSASESASTSASASASTSA 538

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 53/150 (35%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3659 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3715

Query: 339  TGVSTGA--SSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST A  S+S   ST++  ST AS  +S   S S++T +    ST A  S + +   S
Sbjct: 3716 ASASTSASESASTSASTSASASTSASESASTSASASASTSASESASTSA--SASASTSAS 3773

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             +  TS+ ++A    ++  S +   + STS
Sbjct: 3774 ASASTSASASASTSASASASTSASESASTS 3803

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 51/155 (32%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFAST--TSSVLLSSS 346
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST  ++S   S+S
Sbjct: 1984 TSASASASISASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSAS 2043

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 2044 ASASASTSASASASTSASESASTSASASASTSASESASTSASESASTSASASASTSASAS 2103

Query: 168  SETVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            +   V++S S +    TS   SA+T  + S S  A
Sbjct: 2104 TSASVSASTSASESASTSASASASTSASASASTSA 2138

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 58/174 (33%), Positives = 88/174 (50%), Gaps = 9/174 (5%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4527 SASASTSASESASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4583

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++ VS   S+  S   S S++  +    S  A  SV+ +   S +
Sbjct: 4584 ASASTSASASASTSASASVSASTSASESASTSASASALASTSASASASTSVSNSANHSNS 4643

Query: 159  VV-TSSDSTA--------FGGGTSMFSAATGVTCSTSMVAI*IYVEKRVKRTEK 25
             V  +S ST          G  +S+ S   GV  + + + +   V KR KR E+
Sbjct: 4644 QVGNTSGSTGKSQKELPNTGTESSIGSVLLGVLAAVTGIGL---VAKRRKRDEE 4694

[12][TOP]
>UniRef100_Q3K052 Cell wall surface anchor family protein n=1 Tax=Streptococcus
            agalactiae serogroup Ia RepID=Q3K052_STRA1
          Length = 1258

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 60/153 (39%), Positives = 88/153 (57%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  SSS S   S+ST+   S+   +STS+S  AST++S+  S+S+
Sbjct: 1010 STSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASTSASMSASTSS 1069

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  S  AS+S   S ++  ST AS+ +S+  S S++T + +  ST A  S  T A   +
Sbjct: 1070 STSASMSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASMSASTSASTSA 1129

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  + S ST+     SM SA+T  + S SM A
Sbjct: 1130 STSASMSASTSASTSASM-SASTSASKSASMSA 1161

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 902  SMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSA 961

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S + +   S 
Sbjct: 962  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSA 1021

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ S+     ++  SA+T  + S S  A
Sbjct: 1022 STSASTSSSTSASTSASTSASTSASMSASTSA 1053

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 60/153 (39%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 974  SMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSA 1033

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S  +S ++  ST AS+ +S+  S SS+T + +  ST A  S  T A   +
Sbjct: 1034 STSASTSASTSASMSASTSASTSASTSASMSASTSSSTSASMSASTSASTSASTSASTSA 1093

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  + S ST+     SM SA+T  + S S  A
Sbjct: 1094 STSASMSASTSASTSASM-SASTSASMSASTSA 1125

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 58/153 (37%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 758  SMSASTSASTSASTSASMSASTSASTSASTSASTSASISASTSASMSASTSASTSASTSA 817

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S+  S+S++T + +  ST A  S  T A   +
Sbjct: 818  SMSASTSASTSASTSASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSA 877

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+    TS  SA+T  + S S  A
Sbjct: 878  STSASTSASTSASTSTST-SASTSASMSASTSA 909

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 59/157 (37%), Positives = 86/157 (54%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+ST
Sbjct: 834  STSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTST 893

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGA 178
            +T  ST AS S   S ++  ST AS  +S   S+S++T + +  ST A  S      T A
Sbjct: 894  STSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSA 953

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               + T  ++S ST+     SM SA+T  + S S  A
Sbjct: 954  SMSASTSASTSASTSASTSASM-SASTSASTSASTSA 989

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+SAS   S+S +   S+   +STS+S  AST++S   S ST+
Sbjct: 642  SESASTSASTSAST---SASASASTSASISASTSASISASTSASTSASTSASTSASMSTS 698

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T VST AS+S  +S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 699  TSVSTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASMSASTSASTSAS 758

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S+ ++     ++  SA+T  + S S  A
Sbjct: 759  MSASTSASTSASTSASMSASTSASTSASTSA 789

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 58/153 (37%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 702  STSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASMSASTSASTSASMSA 761

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S  +S ++  ST AS+ +S   S+S++T + +  ST A  S  T A   +
Sbjct: 762  STSASTSASTSASMSASTSASTSASTSASTSASISASTSASMSASTSASTSASTSASMSA 821

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+     S  SA+T  + S SM A
Sbjct: 822  STSASTSASTSASTSAST-SASTSASMSASMSA 853

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 52/152 (34%), Positives = 86/152 (56%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T  ST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 882  STSASTSASTSTSTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSA 941

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S + +   S 
Sbjct: 942  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSA 1001

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S+S  A
Sbjct: 1002 STSASTSASTSASTSASTSASTSASTSSSTSA 1033

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 59/153 (38%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 938  STSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSA 997

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 998  STSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSA 1057

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  + S ST+     SM SA+T  + S S  A
Sbjct: 1058 STSASMSASTSSSTSASM-SASTSASTSASTSA 1089

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 58/156 (37%), Positives = 86/156 (55%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 958  STSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSA 1017

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS-STTKSLVVTSTGA*DSVTGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S+  S S ST+ S   + + +  S T A   +
Sbjct: 1018 STSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASTSASMSASTSSSTSASMSA 1077

Query: 165  ETVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
             T  ++S ST+     S     SA+T  + S SM A
Sbjct: 1078 STSASTSASTSASTSASTSASMSASTSASTSASMSA 1113

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 59/156 (37%), Positives = 83/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 910  STSASTSASMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA 969

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  S  AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   S
Sbjct: 970  STSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSS 1029

Query: 165  ETVVTSSDSTAFGGGTSM---FSAATGVTCSTSMVA 67
             T  ++S ST+     SM    SA+T  + S SM A
Sbjct: 1030 STSASTSASTSASTSASMSASTSASTSASTSASMSA 1065

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 52/152 (34%), Positives = 88/152 (57%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ +++A  S+S S   S+ST+   S+   +STS S  AST++S+  S+S +
Sbjct: 659  ASASTSASISASTSASISASTSASTSASTSASTSASMSTSTSVSTSASTSASMSASTSAS 718

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST AS+S   S ++  ST AS+ +S+  S S++T + +  ST A  S  T A   + 
Sbjct: 719  TSASTSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSAS 778

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S+ SA+T  + S S  A
Sbjct: 779  TSASTSASTSASTSASI-SASTSASMSASTSA 809

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 53/152 (34%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 826  STSASTSASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSA 885

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST  S+S   S +   ST AS+ +S   S+S++T + +  ST A  S + +   S 
Sbjct: 886  STSASTSTSTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSA 945

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S SM A
Sbjct: 946  STSASTSASMSASTSASTSASTSASTSASMSA 977

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 722  STSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSA 781

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  IS ++  S  AS+ +S   S S++  +    ST A  S + +   S 
Sbjct: 782  STSASTSASTSASISASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSA 841

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T  + S S  A
Sbjct: 842  STSASMSASMSASTSASMSASTSASTSASTSA 873

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 674  SISASTSASTSASTSASTSASMSTSTSVSTSASTSASMSASTSASTSASTSASTSASTSA 733

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS  +S   S S++T + +  ST A  S + +   S 
Sbjct: 734  STSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSA 793

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 794  SISASTSASMSASTSASTSASTSASMSASTSA 825

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 56/156 (35%), Positives = 86/156 (55%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 818  SMSASTSASTSAST---SASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSAS 874

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS-----STTKSLVVTSTGA*DSVTGAG 175
            T  ST AS+S   S ++  ST AS+ +S+  S S     ST+ S+  +++ +  + T A 
Sbjct: 875  TSASTSASTSASTSASTSTSTSASTSASMSASTSASTSASTSASMSASTSASISASTSAS 934

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              + T  ++S ST+     SM SA+T  + S S  A
Sbjct: 935  MSASTSASTSASTSASTSASM-SASTSASTSASTSA 969

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/152 (34%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 942  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSA 1001

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ SS   S S++T +    S  A  S + +   S 
Sbjct: 1002 STSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASTSA 1061

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ S+     ++  SA+T  + S S  A
Sbjct: 1062 SMSASTSSSTSASMSASTSASTSASTSASTSA 1093

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 58/152 (38%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+    STS+S  AST++S   S+S 
Sbjct: 778  STSASTSASTSASTSASISASTSASMSASTSASTSA----STSASMSASTSASTSASTSA 833

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S +   ST AS  +S   S S++T +    ST A    T A   + 
Sbjct: 834  STSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSA---STSASTSAS 890

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S  SA+T  + S SM A
Sbjct: 891  TSTSTSASTSASMSAST-SASTSASTSASMSA 921

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 57/152 (37%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 934  SMSASTSASTSAST---SASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSAS 990

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  S  AS+S   S ++  ST AS+ +S   S S++T S    ST A  S  T A   + 
Sbjct: 991  TSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSAS 1050

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST     ++  SA+T  + S SM A
Sbjct: 1051 TSASTSAST-----SASMSASTSSSTSASMSA 1077

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 55/156 (35%), Positives = 86/156 (55%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   SS   +STS+S  AST++S+  S+S 
Sbjct: 994  SMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSA 1053

Query: 342  TTGVSTGASSSFLISTTS----GVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            +T  ST AS S   S+++      ST AS+ +S   S S++T + +  ST A  S + + 
Sbjct: 1054 STSASTSASMSASTSSSTSASMSASTSASTSASTSASTSASTSASMSASTSASTSASMSA 1113

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S ++  S+ ++     ++  SA+T  + S SM A
Sbjct: 1114 STSASMSASTSASTSASTSASMSASTSASTSASMSA 1149

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 51/152 (33%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 730  STSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSA 789

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S  +S ++  ST AS+ +S+  S S++T +    ST A  S + +   S 
Sbjct: 790  STSASISASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASMSA 849

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 850  SMSASTSASMSASTSASTSASTSASTSASTSA 881

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 52/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 866  STSASTSASTSASTSASTSASTSASTSTSTSASTSASMSASTSASTSASTSASMSASTSA 925

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS S   S ++  ST AS+ +S+  S S++T +    ST A  S + +   S 
Sbjct: 926  SISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSA 985

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 986  STSASTSASMSASTSASTSASTSASTSASTSA 1017

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 52/151 (34%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 954  SMSASTSASTSAST---SASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSAS 1010

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   S +
Sbjct: 1011 TSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASTSASMSASTSSS 1070

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S  ++     ++  SA+T  + S SM A
Sbjct: 1071 TSASMSASTSASTSASTSASTSASTSASMSA 1101

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+S +   S+   +STS+S  AST++S+  S+S 
Sbjct: 1046 SMSASTSASTSASTSASMSASTSSSTSASMSASTSASTSASTSASTSASTSASMSASTSA 1105

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S  +S ++  ST AS+ +S+  S S++T + +  ST A  S + +   S 
Sbjct: 1106 STSASMSASTSASMSASTSASTSASTSASMSASTSASTSASMSASTSASKSASMSASTSA 1165

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T V+ S S  A
Sbjct: 1166 STSASMSASTSASMSATTSASTSVSTSASTSA 1197

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 58/152 (38%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   SSTS+S  AST++    S+S 
Sbjct: 1030 STSASTSASTSASTSASMSASTSASTSASTSASMSASTSSSTSASMSASTSA----STSA 1085

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS  +S   S+S++T +    ST A      A   + 
Sbjct: 1086 STSASTSASTSASMSASTSASTSASMSASTSASMSASTSASTSASTSA---SMSASTSAS 1142

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  + S ST+     SM SA+T  + S SM A
Sbjct: 1143 TSASMSASTSASKSASM-SASTSASTSASMSA 1173

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 750  STSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASISASTSASMSASTSA 809

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  ST AS+ +S   S S++  + +  ST A  S + +   S 
Sbjct: 810  STSASTSASMSASTSASTSASTSASTSASTSASTSASMSASMSASTSASMSASTSASTSA 869

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 870  STSASTSASTSASTSASTSASTSTSTSASTSA 901

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 51/152 (33%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 782  STSASTSASTSASISASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSA 841

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS S   S +   ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 842  STSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSTSTSASTSA 901

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 902  SMSASTSASTSASTSASMSASTSASISASTSA 933

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STSSS  AST++S   S+S 
Sbjct: 986  STSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSA 1045

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S +   ST +S+ +S+  S S++T +    ST A  S + +   S 
Sbjct: 1046 SMSASTSASTSASTSASMSASTSSSTSASMSASTSASTSASTSASTSASTSASMSASTSA 1105

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T  + S SM A
Sbjct: 1106 STSASMSASTSASMSASTSASTSASTSASMSA 1137

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 56/153 (36%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 714  STSASTSASTSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSA 773

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  S  AS+ +S+  S S++T +    S  A  S  T A   +
Sbjct: 774  SMSASTSASTSASTSASTSASISASTSASMSASTSASTSASTSASMSASTSASTSASTSA 833

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+     SM SA+T  + S S  A
Sbjct: 834  STSASTSASTSASMSASM-SASTSASMSASTSA 865

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 50/152 (32%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +   S+   +STS+S  AST++S+  S+S 
Sbjct: 874  STSASTSASTSASTSASTSTSTSASTSASMSASTSASTSASTSASMSASTSASISASTSA 933

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  S  AS+ +S   S S++T + +  ST A  S + +   S 
Sbjct: 934  SMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSA 993

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 994  SMSASTSASTSASTSASTSASTSASTSASTSA 1025

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 57/153 (37%), Positives = 80/153 (52%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 858  SMSASTSASTSASTSASTSASTSASTSASTSASTSTSTSASTSASMSASTSASTSASTSA 917

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS S   S +   ST AS+ +S   S S++  +    ST A  S  T A   +
Sbjct: 918  SMSASTSASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSA 977

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+     SM SA+T  + S S  A
Sbjct: 978  STSASTSASTSASTSASM-SASTSASTSASTSA 1009

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 46/150 (30%), Positives = 82/150 (54%)
 Frame = -1

Query: 516  SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            SA ++ +++ +++A  S+S S   S+S +T  S    +STS+S  AST++S   S+S +T
Sbjct: 668  SASTSASISASTSASTSASTSASTSASMSTSTSVSTSASTSASMSASTSASTSASTSAST 727

Query: 336  GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETV 157
              ST AS+S   S ++  S  AS+ +S   S+S++T +    ST A  S + +   S + 
Sbjct: 728  SASTSASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSASTSAST 787

Query: 156  VTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S+ ++     ++  SA+T  + S S  A
Sbjct: 788  SASTSASISASTSASMSASTSASTSASTSA 817

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 45/148 (30%), Positives = 84/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ +++   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 687  TSASTSASMSTSTSVSTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSAS 746

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S  +S ++  ST AS+ +S+  S S++T +    ST A  S++ +   S +
Sbjct: 747  MSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSA--SISASTSASMS 804

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    +   S +   + STS
Sbjct: 805  ASTSASTSASTSASMSASTSASTSASTS 832

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 52/156 (33%), Positives = 85/156 (54%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS-- 349
            S++ S  A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+  
Sbjct: 742  STSASMSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASISASTSA 801

Query: 348  --STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
              S +T  ST AS+S  +S ++  ST AS+ +S   S S++T + +  S  A  S + + 
Sbjct: 802  SMSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASMSASMSASTSASMSA 861

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S +   S+ ++     ++  SA+T  + STS  A
Sbjct: 862  STSASTSASTSASTSASTSASTSASTSASTSTSTSA 897

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 49/156 (31%), Positives = 84/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFS-----STSSSFFASTTSSVLL 355
            S++ ST A T AST+   S+++   +S++T+ + S   S     STS+S  AST++S   
Sbjct: 678  STSASTSASTSASTSASMSTSTSVSTSASTSASMSASTSASTSASTSASTSASTSASTSA 737

Query: 354  SSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            S+S +T  S  AS+S   S +   ST AS+ +S   S+S++T +    ST A  S + + 
Sbjct: 738  STSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASISA 797

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 798  STSASMSASTSASTSASTSASMSASTSASTSASTSA 833

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 48/150 (32%), Positives = 86/150 (57%)
 Frame = -1

Query: 516  SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            SA ++ +++ +++A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S +T
Sbjct: 852  SASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSTSTSASTSASMSASTSAST 911

Query: 336  GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETV 157
              ST AS S   ST++ +S  AS+ +S+  S S++T +    ST A  S + +   S + 
Sbjct: 912  SASTSASMS--ASTSASIS--ASTSASMSASTSASTSASTSASTSASMSASTSASTSAST 967

Query: 156  VTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S+ ++     ++  SA+T  + S SM A
Sbjct: 968  SASTSASMSASTSASTSASTSASTSASMSA 997

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 49/152 (32%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 787  TSASTSASISASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSAS 846

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS+S  +S ++  ST AS+ +S   S S++T +    ST    S  T A   + 
Sbjct: 847  MSASMSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSTSTSASTSASMSAS 906

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S  SA+   + S SM A
Sbjct: 907  TSASTSASTSASMSAST-SASISASTSASMSA 937

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/151 (35%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S S +
Sbjct: 794  SISASTSASMSASTSA-STSASTSASMSASTSASTS--ASTSASTSASTSASTSASMSAS 850

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +   TST A  S + +   S +
Sbjct: 851  MSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSTSTSASTSASMSASTSAS 910

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 911  TSASTSASMSASTSASISASTSASMSASTSA 941

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 54/160 (33%), Positives = 85/160 (53%), Gaps = 9/160 (5%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 890  STSTSTSASTSASMSASTSASTSASTSASMSASTSASISASTSASMSASTSASTSASTSA 949

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS-----STTKSLVVTSTGA*DSVTGA 178
            +T  S  AS+S   S ++  ST AS  +S   S S     ST+ S+  +++ +  + T A
Sbjct: 950  STSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA 1009

Query: 177  GRDSETVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
               + T  ++S ST+    +S     SA+T  + S SM A
Sbjct: 1010 STSASTSASTSASTSASTSSSTSASTSASTSASTSASMSA 1049

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 52/133 (39%), Positives = 74/133 (55%), Gaps = 6/133 (4%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +   S+   +STS+S  AST++S+  S+S 
Sbjct: 1082 STSASTSASTSASTSASMSASTSASTSASMSASTSASMSASTSASTSASTSASMSASTSA 1141

Query: 342  TT----GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGA 178
            +T      ST AS S  +S ++  ST AS  +S   S+S+TT +    ST A  S  T A
Sbjct: 1142 STSASMSASTSASKSASMSASTSASTSASMSASTSASMSATTSASTSVSTSASTSASTSA 1201

Query: 177  GRDSETVVTSSDS 139
               S + VTS+ S
Sbjct: 1202 STSSSSSVTSNSS 1214

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 50/152 (32%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 738  STSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASISA 797

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S ++  S  AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 798  STSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASMSASMSASTSA 857

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 858  SMSASTSASTSASTSASTSASTSASTSASTSA 889

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 48/149 (32%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 1066 STSSSTSASMSASTSASTSASTSASTSASTSASMSASTSASTSASMSASTSASMSASTSA 1125

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  S  AS+ +S   S+S++T +    S  A  S + +   S 
Sbjct: 1126 STSASTSASMSASTSASTSASMSASTSASKSASMSASTSASTSASMSASTSASMSATTSA 1185

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++     ++  S+++ VT ++S
Sbjct: 1186 STSVSTSASTSASTSASTSSSSSVTSNSS 1214

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 52/156 (33%), Positives = 81/156 (51%), Gaps = 6/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSS-SASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST+  +S S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 1054 STSASTSASMSASTSSSTSASMSASTSASTSASTSASTSASTSASMSASTSASTSASMSA 1113

Query: 342  TT----GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-GA 178
            +T      ST AS+S   S +   ST AS+ +S+  S S++  + +  ST A  S +  A
Sbjct: 1114 STSASMSASTSASTSASTSASMSASTSASTSASMSASTSASKSASMSASTSASTSASMSA 1173

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMV 70
               +    T+S ST+     S  ++ +  T S+S V
Sbjct: 1174 STSASMSATTSASTSVSTSASTSASTSASTSSSSSV 1209

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 49/139 (35%), Positives = 75/139 (53%), Gaps = 6/139 (4%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 1102 STSASTSASMSASTSASMSASTSASTSASTSASMSASTSASTSASMSASTSASKSASMSA 1161

Query: 342  TTGVSTGAS-----SSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGA 178
            +T  ST AS     S+ + +TTS  ++ ++S S+   + +ST+ S  VTS  + + V  A
Sbjct: 1162 STSASTSASMSASTSASMSATTSASTSVSTSASTSASTSASTSSSSSVTSNSSKEKVYSA 1221

Query: 177  GRDSETVVTSSDSTAFGGG 121
               +     S  +TA G G
Sbjct: 1222 LPSTGDQDYSVTATALGLG 1240

[13][TOP]
>UniRef100_Q8DYL7 Cell wall surface anchor family protein n=1 Tax=Streptococcus
            agalactiae serogroup V RepID=Q8DYL7_STRA5
          Length = 970

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 86/152 (56%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 686  SMSASTSASTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSA 745

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S + +   S 
Sbjct: 746  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSA 805

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S SM A
Sbjct: 806  STSASTSASTSASMSASTSASTSASTSASMSA 837

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 59/156 (37%), Positives = 86/156 (55%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S+  S+S +
Sbjct: 710  SMSASTSASTSAST---SASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSAS 766

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGAG 175
            T  ST AS+S  +S ++  ST AS+ +S   S+S++T +    ST A  S      T A 
Sbjct: 767  TSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSAS 826

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              + T  + S ST+     SM SA+T  + S SM A
Sbjct: 827  TSASTSASMSASTSASTSASM-SASTSASTSASMSA 861

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 57/151 (37%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 670  SMSASTSASTSAST---SASMSASTSASTSASTSASTSASTSASMSASTSASTSASTSAS 726

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S  +S ++  ST AS+ +S   S+S++T +    ST A    T A   + T
Sbjct: 727  TSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA---STSASMSAST 783

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              ++S ST+     SM SA+T  + S S  A
Sbjct: 784  SASTSASTSASTSASM-SASTSASTSASTSA 813

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 57/152 (37%), Positives = 86/152 (56%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 726  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSA 785

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S   S+S++T +    ST A      A   + 
Sbjct: 786  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA---SMSASTSAS 842

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  + S ST+     SM SA+T  + S SM A
Sbjct: 843  TSASMSASTSASTSASM-SASTSASTSASMSA 873

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 51/152 (33%), Positives = 86/152 (56%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 746  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSA 805

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S+  S S++T + +  ST A  S + +   S 
Sbjct: 806  STSASTSASTSASMSASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSA 865

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S  ++     ++  SA+T  + S +  A
Sbjct: 866  STSASMSASTSASTSASMSASTSASMSATTSA 897

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 57/157 (36%), Positives = 83/157 (52%), Gaps = 2/157 (1%)
 Frame = -1

Query: 531  LHIYSSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLL 355
            + + S + ST A T AST A  S+S S   S+S +   S+   +STS+S  AST++S   
Sbjct: 638  IKLLSESASTSASTSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSASTSA 697

Query: 354  SSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGA 178
            S+S +T  ST AS S   S ++  ST AS+ +S   S S++  +    ST A  S  T A
Sbjct: 698  STSASTSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSASTSA 757

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               + T  ++S ST+     SM SA+T  + S S  A
Sbjct: 758  SMSASTSASTSASTSASTSASM-SASTSASTSASTSA 793

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 52/151 (34%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 738  SMSASTSASTSAST---SASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSAS 794

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  S  AS+S   S ++  ST AS  +S   S S++T + +  ST A  S + +   S +
Sbjct: 795  TSASMSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASMSASTSAS 854

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S  ++     ++  SA+T  + S SM A
Sbjct: 855  TSASMSASTSASTSASMSASTSASTSASMSA 885

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 52/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 650  STSASTSASMSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSA 709

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S+  S S++T +    ST A  S + +   S 
Sbjct: 710  SMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSA 769

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S SM A
Sbjct: 770  STSASTSASMSASTSASTSASTSASTSASMSA 801

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 53/156 (33%), Positives = 85/156 (54%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 694  STSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSA 753

Query: 342  TT----GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            +T      ST AS+S   S ++  S  AS+ +S   S S++T + +  ST A  S + + 
Sbjct: 754  STSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSA 813

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S ++  S+ ++     ++  SA+T  + S SM A
Sbjct: 814  STSASMSASTSASTSASTSASMSASTSASTSASMSA 849

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 55/149 (36%), Positives = 86/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 782  STSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSA 841

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  S  AS+S   S +   ST AS+ +S+  S S++T + +  ST A  S T     + 
Sbjct: 842  STSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASMSAT---TSAS 898

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T V++S ST+     S  S+++ VT ++S
Sbjct: 899  TSVSTSASTSASTSAST-SSSSSVTSNSS 926

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 742  STSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSA 801

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S +   ST AS+ +S   S+S++T +    S  A  S + +   S 
Sbjct: 802  STSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSA 861

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+   + S SM A
Sbjct: 862  STSASTSASMSASTSASTSASMSASTSASMSA 893

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 52/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 762  STSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSA 821

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS  +S   S S++  +    ST A  S++ +   S 
Sbjct: 822  STSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSA--SMSASTSAST 879

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++A    T+  S +   + STS
Sbjct: 880  SASMSASTSASMSATTSASTSVSTSASTS 908

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 52/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++    S+S 
Sbjct: 674  STSASTSASTSASMSASTSASTSASTSASTSASTSASMSASTSASTSASTSA----STSA 729

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  ST AS+ +S+  S S++T +    ST A  S + +   S 
Sbjct: 730  STSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSA 789

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S SM A
Sbjct: 790  STSASTSASMSASTSASTSASTSASTSASMSA 821

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 53/155 (34%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 758  SMSASTSASTSAST---SASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSAS 814

Query: 339  T----GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGR 172
            T      ST AS+S   S +   ST AS+ +S+  S S++T + +  ST A  S + +  
Sbjct: 815  TSASMSASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSAS 874

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             S +   S  ++     ++  SA+T V+ S S  A
Sbjct: 875  TSASTSASMSASTSASMSATTSASTSVSTSASTSA 909

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 54/156 (34%), Positives = 85/156 (54%), Gaps = 6/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 766  STSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSA 825

Query: 342  TTGVST----GASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-GA 178
            +T  ST     AS+S   S +   ST AS+ +S+  S S++T + +  ST A  S +  A
Sbjct: 826  STSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSA 885

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMV 70
               +    T+S ST+     S  ++ +  T S+S V
Sbjct: 886  STSASMSATTSASTSVSTSASTSASTSASTSSSSSV 921

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 2/135 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+S +   S+   +S S+S  AST++S+  S+S 
Sbjct: 818  SMSASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSA 877

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS-STTKSLVVTSTGA*DSVTGAGRDS 166
            +T  S  AS+S  +S T+  ST  S+ +S   S S ST+ S  VTS  + + V  A   +
Sbjct: 878  STSASMSASTSASMSATTSASTSVSTSASTSASTSASTSSSSSVTSNSSKEKVYSALPST 937

Query: 165  ETVVTSSDSTAFGGG 121
                 S  +TA G G
Sbjct: 938  GDQDYSVTATALGLG 952

[14][TOP]
>UniRef100_C1C910 Cell wall surface anchor family protein n=1 Tax=Streptococcus
            pneumoniae 70585 RepID=C1C910_STRP7
          Length = 2215

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 86/152 (56%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1485 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSA 1544

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +   TS  A  S++ +   S 
Sbjct: 1545 STSASTSASASASTSASASASTSASASASTSASASASTSASASTSASASASISASESAST 1604

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S+ A
Sbjct: 1605 SASASASTSASASASTSASASTSASASASISA 1636

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1441 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1500

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   S 
Sbjct: 1501 STSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASTSA 1560

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + STS  A
Sbjct: 1561 SASASTSASASASTSASASASTSASASTSASA 1592

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 54/150 (36%), Positives = 84/150 (56%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1429 SESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1488

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   +
Sbjct: 1489 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSASTSA 1548

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 1549 STSASASASTSASASASTSASASASTSASA 1578

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 57/150 (38%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1453 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1512

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   +
Sbjct: 1513 STSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASTSASASASTSASASA 1572

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+    TS  SA+  ++ S S
Sbjct: 1573 STSASASASTSASASTSA-SASASISASES 1601

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 54/152 (35%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1995 SASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSA 2054

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 2055 STSASTSASASASISASESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 2114

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 2115 SASASTSASASASTSASASASTSASASASTSA 2146

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 58/154 (37%), Positives = 86/154 (55%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1445 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1504

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1505 STSASTSASTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASTSASASA 1564

Query: 165  ETVVTSSDST-AFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST A    ++  SA+T  + S S+ A
Sbjct: 1565 STSASASASTSASASASTSASASTSASASASISA 1598

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1433 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1492

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S + +   S 
Sbjct: 1493 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSASTSASTSA 1552

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 1553 SASASTSASASASTSASASASTSASASASTSA 1584

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1421 SASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1480

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE
Sbjct: 1481 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA--STSASTSASE 1538

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 1539 SASTSASTSASTSASASASTSASASASTSASA 1570

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 52/154 (33%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 1607 SASASTSASASASTSASASTSASASASISASESASTSASASASTSASASASTSASASAST 1666

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A +S + +   
Sbjct: 1667 SASASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASA 1726

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            S +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1727 SASTSASASASTSASASASTSASTSASTSASTSA 1760

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1979 SASASTSASESASTSASASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSA 2038

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  ST AS+ +SI  S S++T +    ST A  S + +   S 
Sbjct: 2039 STSASTSASESASTSASTSASTSASASASISASESASTSASTSASTSASTSASTSASTSA 2098

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 2099 STSASTSASTSASTSASASASTSASASASTSA 2130

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A T AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1101 SASASTSASTSASTSA-SASASTSASESASTSASTS--ASTSASASASTSASASASTSAS 1157

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1158 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1217

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1218 TSASASSSTSASASASTSASASASTSASA 1246

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 56/151 (37%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S L S+S +
Sbjct: 1245 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASALASTSAS 1301

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST ASSS   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1302 ASASTSASSSASTSASASASTSASASASTSASESASTSASASASTSA--SASASTSASES 1359

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 1360 ASTSASASASTSASESASTSASASASTSASA 1390

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 55/148 (37%), Positives = 84/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ S  A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 541 SASTSASASASASTSA-SESASTSASASASTSASAS--ASTSASTSASTSASTSASTSAS 597

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
           T  ST AS+S  IS +   ST AS+ +SI  S S++T +    ST A +S  T A   + 
Sbjct: 598 TSASTSASASASISASESASTSASASASISASESASTSASASASTSASESASTSASASAS 657

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCST 79
           T  ++S ST+     S  ++A+  T ++
Sbjct: 658 TSASASASTSASASASTSASASASTSAS 685

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 60/155 (38%), Positives = 86/155 (55%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++SV  S+S +
Sbjct: 957  SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASVSASTSAS 1013

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  S  T A   + 
Sbjct: 1014 ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASAS 1073

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T V++S ST+     S     SA+T  + S S  A
Sbjct: 1074 TSVSASASTSASASASTSASESASTSASASASTSA 1108

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1405 SASASTSASESASTSASASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSA 1464

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1465 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1524

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1525 STSASTSASTSASESASTSASTSASTSASASA 1556

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 53/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1461 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1520

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1521 STSASTSASTSASTSASESASTSASTSASTSASASASTSASASASTSA--SASASTSASA 1578

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++     ++  SA+   + S S  A
Sbjct: 1579 SASTSASASTSASASASISASESASTSASASA 1610

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1465 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1524

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS+ +S   S S++  +    S  A  S + +   S 
Sbjct: 1525 STSASTSASTSASESASTSASTSASTSASASASTSASASASTSASASASTSASASASTSA 1584

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    +   S +   + STS  A
Sbjct: 1585 SASTSASASASISASESASTSASASASTSASA 1616

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 52/149 (34%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1469 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1528

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1529 STSASTSASESASTSASTSASTSASASASTSASASASTSASASASTSASASASTSASAST 1588

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+  +A    ++  SA+   + S S
Sbjct: 1589 SASASASISASESASTSASASASTSASAS 1617

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1477 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1536

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1537 SESASTSASTSASTSASASASTSASASASTSASASASTSASASASTSASASTSASASASI 1596

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+   + S S  A
Sbjct: 1597 SASESASTSASASASTSASASASTSASASTSA 1628

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 54/148 (36%), Positives = 84/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A T AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 781  SASASTSASTSASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 837

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 838  ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASESASTSASASAS 897

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 898  TSASASASTSASASASTSASASASTSAS 925

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 51/149 (34%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 2003 SESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSASTSASTSA 2062

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   S  AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 2063 SASASISASESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSA 2122

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++A    ++  SA+T  + S S
Sbjct: 2123 SASASTSASASASTSASASASTSASASAS 2151

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 53/148 (35%), Positives = 83/148 (56%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 443 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASESASTSASASASTSAS 499

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 500 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASASTSASES 559

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TS+ ++A    ++  S +   + STS
Sbjct: 560 ASTSASASASTSASASASTSASTSASTS 587

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 53/150 (35%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 761  STSASTSASTSASVSASTSASASASTSASTSASTSASASASTSASASASTSASASASTSA 820

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 821  SASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASA 880

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  + S ST+     S  ++A+  T +++
Sbjct: 881  STSASESASTSASASASTSASASASTSASA 910

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 55/151 (36%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 821  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 877

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   SE+
Sbjct: 878  ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASES 935

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 936  ASTSASASASTSASASASTSASASASTSASA 966

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 829  SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 885

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A +S  T A   + 
Sbjct: 886  ESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASAS 945

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 946  TSASASASTSASASASTSASASASTSASA 974

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 53/150 (35%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1129 STSASTSASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA 1188

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S +   ST AS+ +S   S SS+T +    ST A  S  T A   +
Sbjct: 1189 SASASTSASASASTSASESASTSASASASTSASASSSTSASASASTSASASASTSASASA 1248

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 1249 STSASASASTSASASASTSASASASTSASA 1278

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/150 (35%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1105 STSASTSASTSASASASTSASESASTSASTSASTSASASASTSASASASTSASASASTSA 1164

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   S
Sbjct: 1165 SASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASS 1224

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 1225 STSASASASTSASASASTSASASASTSASA 1254

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1253 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASALASTSASASASTSAS 1309

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            +  ST AS+S   S ++  ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 1310 SSASTSASASASTSASASASTSASESASTSASASASTSASASASTSASESASTSASASAS 1369

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1370 TSASESASTSASASASTSASASASTSASA 1398

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 47/151 (31%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 1410 TSASESASTSASASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1469

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1470 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1529

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1530 TSASTSASESASTSASTSASTSASASASTSA 1560

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/150 (35%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1413 SESASTSASASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1472

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1473 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1532

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  + S ST+     S  ++A+  T +++
Sbjct: 1533 STSASESASTSASTSASTSASASASTSASA 1562

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 47/151 (31%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 1418 TSASASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1477

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1478 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1537

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1538 ESASTSASTSASTSASASASTSASASASTSA 1568

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/151 (35%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 1599 SESASTSASASASTSASASASTSASASTSASASASISASESASTSASASASTSASASAST 1658

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   
Sbjct: 1659 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSA 1716

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            SE+  TS+ ++A    ++  S +   + STS
Sbjct: 1717 SESASTSASASASTSASASASTSASASASTS 1747

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 55/151 (36%), Positives = 87/151 (57%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 637  SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 693

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   SE+
Sbjct: 694  ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASESASTSA--SES 751

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +  V+ STS  A
Sbjct: 752  ASTSASASASTSASTSASTSASVSASTSASA 782

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A T AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 757  SASASTSASTSASTSA-SVSASTSASASASTSASTS--ASTSASASASTSASASASTSAS 813

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 814  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 873

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 874  TSASASASTSASESASTSASASASTSASA 902

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1053 SASASTSASASASTSA-SASASTSVSASASTSASAS--ASTSASESASTSASASASTSAS 1109

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1110 TSASTSASASASTSASESASTSASTSASTSASASASTSASASASTSASASASTSASASAS 1169

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1170 TSASASASTSASASASTSASASASTSASA 1198

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1125 SESASTSASTSASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1181

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +   +ST A  S  T A   + 
Sbjct: 1182 ASASTSASASASTSASASASTSASESASTSASASASTSASASSSTSASASASTSASASAS 1241

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1242 TSASASASTSASASASTSASASASTSASA 1270

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1389 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASESASTSASTSASTSAS 1445

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1446 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1505

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1506 TSASTSASTSASTSASTSASTSASTSASTSA 1536

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 55/152 (36%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 1693 SASASTSASASASTSASVSASTSASESASTSASASA----STSASASASTSASASASTSA 1748

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE
Sbjct: 1749 STSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASTSA--SASASISASE 1806

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 1807 SASTSASASASTSASASASTSASASASTSASA 1838

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 58/155 (37%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1701 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASTSASTSAS 1757

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST AS+S   S +   ST AS+ +S   S S++T +    S  A +S  T A   + 
Sbjct: 1758 TSASTSASTSASTSASESASTSASTSASTSASASASTSASASASISASESASTSASASAS 1817

Query: 162  TVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + STS  A
Sbjct: 1818 TSASASASTSASASASTSASASASTSASASTSASA 1852

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 57/149 (38%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1717 SESASTSASASASTSA-SASASTSASASASTSASTS--ASTSASTSASTSASTSASTSAS 1773

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +SI  S S++T +    ST A  S  T A   + 
Sbjct: 1774 ESASTSASTSASTSASASASTSASASASISASESASTSASASASTSASASASTSASASAS 1833

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+    TS  SA+  ++ S S
Sbjct: 1834 TSASASASTSASASTSA-SASASISASES 1861

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 54/154 (35%), Positives = 82/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 1829 SASASTSASASASTSASASTSASASASISASESASTSASASASTSASASASTSASASAST 1888

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   
Sbjct: 1889 SASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSA--SASASTSA 1946

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            SE+  TS+ S+A    ++  S +   + STS  A
Sbjct: 1947 SESASTSASSSASTSASASASTSASASASTSASA 1980

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1875 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASESASTSAS 1931

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST ASS +S   S S++T +    ST A  S + +  +S +
Sbjct: 1932 ASASTSASASASTSASESASTSASSSASTSASASASTSASASASTSASASASTSASESAS 1991

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1992 TSASASASTSASESASTSASTSASTSASTSA 2022

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 47/151 (31%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1880 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSAS 1939

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S +S  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 1940 ASASTSASESASTSASSSASTSASASASTSASASASTSASASASTSASESASTSASASAS 1999

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S  ++     ++  SA+T  + S S  A
Sbjct: 2000 TSASESASTSASTSASTSASTSASTSASTSA 2030

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 2011 STSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISA 2070

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S + +   S 
Sbjct: 2071 SESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSASASASTSA 2130

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++A    ++  SA+T V+ S +
Sbjct: 2131 SASASTSASASASTSASASASTSVSNSAN 2159

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/149 (34%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 523 SASASTSASESASTSA-SASASTSASASASASTSASESASTSASASASTSASASASTSAS 581

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
           T  ST AS+S   S ++  ST AS+ +SI  S S++T +    S  A +S  T A   + 
Sbjct: 582 TSASTSASTSASTSASTSASTSASASASISASESASTSASASASISASESASTSASASAS 641

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
           T  + S ST+     S  ++A+  T +++
Sbjct: 642 TSASESASTSASASASTSASASASTSASA 670

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 55/151 (36%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 877  SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 933

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 934  ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 991

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 992  ASTSASASASTSASVSASTSASASASTSASA 1022

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 55/152 (36%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 909  SASASTSASASASTSASVSASTSASESASTSASASA----STSASASASTSASASASTSA 964

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS  +S   S S++T + V  ST A  S + +   S 
Sbjct: 965  SASASTSASASASTSASASASTSASESASTSASASASTSASVSASTSA--SASASTSASA 1022

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +  V+ STS  A
Sbjct: 1023 SASTSASASASTSASASASTSASVSASTSASA 1054

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 54/148 (36%), Positives = 84/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 949  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1005

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S  T A   + 
Sbjct: 1006 VSASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASAS 1065

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1066 TSASASASTSVSASASTSASASASTSAS 1093

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 47/149 (31%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1018 TSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSVS 1077

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1078 ASASTSASASASTSASESASTSASASASTSASTSASTSASASASTSASESASTSASTSAS 1137

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1138 TSASASASTSASASASTSASASASTSASA 1166

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 47/151 (31%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +S+A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1298 TSASASASTSASSSASTSASASASTSASASASTSASESASTSASASASTSASASASTSAS 1357

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +  +S +
Sbjct: 1358 ESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESAS 1417

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1418 TSASASASTSASESASTSASTSASTSASTSA 1448

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1381 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASESASTSAS 1437

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1438 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1497

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1498 TSASTSASTSASTSASTSASTSASTSASTSA 1528

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 57/156 (36%), Positives = 83/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1397 SASASTSASASASTSASESASTSASASASTSASESASTSASTSASTSASTSASTSASTSA 1456

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1457 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 1516

Query: 165  ETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
             T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1517 STSASTSASTSASTSASTSASESASTSASTSASTSA 1552

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 53/155 (34%), Positives = 83/155 (53%), Gaps = 7/155 (4%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFAST------TSSV 361
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST      ++S 
Sbjct: 1517 STSASTSASTSASTSASTSASESASTSASTSASTSASASASTSASASASTSASASASTSA 1576

Query: 360  LLSSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTG 181
              S+ST+   ST AS+S  IS +   ST AS+ +S   S S++T +   TS  A  S++ 
Sbjct: 1577 SASASTSASASTSASASASISASESASTSASASASTSASASASTSASASTSASASASISA 1636

Query: 180  AGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S +   S+ ++A    ++  SA+   + S S
Sbjct: 1637 SESASTSASASASTSASASASTSASASASTSASAS 1671

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 51/148 (34%), Positives = 83/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 1661 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 1717

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +  +S +
Sbjct: 1718 ESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASESAS 1777

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++     ++  SA+   + S S
Sbjct: 1778 TSASTSASTSASASASTSASASASISAS 1805

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 57/155 (36%), Positives = 86/155 (55%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1669 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASESASTSAS 1725

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1726 ASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASESASTSASTSAS 1785

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S+    SA+T  + S S  A
Sbjct: 1786 TSASASASTSASASASISASESASTSASASASTSA 1820

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/148 (35%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A T AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S S +
Sbjct: 1749 STSASTSASTSASTSA-STSASTSASESASTSASTS--ASTSASASASTSASASASISAS 1805

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +   TS  A  S++ +   S +
Sbjct: 1806 ESASTSASASASTSASASASTSASASASTSASASASTSASASTSASASASISASESASTS 1865

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++A    ++  SA+   + S S
Sbjct: 1866 ASASASTSASASASTSASASASTSASAS 1893

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 733  SASASTSASESASTSA-SESASTSASASASTSASTS--ASTSASVSASTSASASASTSAS 789

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 790  TSASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 849

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 850  TSASASASTSASESASTSASASASTSASA 878

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 48/148 (32%), Positives = 80/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + + +A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 738  TSASESASTSASESASTSASASASTSASTSASTSASVSASTSASASASTSASTSASTSAS 797

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 798  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 857

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  + S ST+     S  ++A+  T ++
Sbjct: 858  TSASESASTSASASASTSASASASTSAS 885

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 785  STSASTSASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA 844

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 845  SASASTSASASASTSASESASTSASASASTSASASASTSASESASTSA--SASASTSASA 902

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +  V+ STS
Sbjct: 903  SASTSASASASTSASASASTSASVSASTS 931

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 48/149 (32%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 1082 TSASASASTSASESASTSASASASTSASTSASTSASASASTSASESASTSASTSASTSAS 1141

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1142 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1201

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1202 TSASESASTSASASASTSASASSSTSASA 1230

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1093 SESASTSASASASTSA-STSASTSASASASTSASES--ASTSASTSASTSASASASTSAS 1149

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1150 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 1207

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1208 ASTSASASASTSASASSSTSASASASTSASA 1238

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/149 (36%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1141 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1197

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ SS   S S++T +    ST A  S  T A   + 
Sbjct: 1198 ASASTSASESASTSASASASTSASASSSTSASASASTSASASASTSASASASTSASASAS 1257

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1258 TSASASASTSASASASTSASASASTSASA 1286

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/155 (34%), Positives = 86/155 (55%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  +S+++   +SS+T+ ++S   +STS+S  AST++S   S+S +
Sbjct: 1197 SASASTSASESASTSASASASTSASASSSTSASAS---ASTSASASASTSASASASTSAS 1253

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +  + ST A  S  T A   + 
Sbjct: 1254 ASASTSASASASTSASASASTSASASASTSASASASTSASALASTSASASASTSASSSAS 1313

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1314 TSASASASTSASASASTSASESASTSASASASTSA 1348

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS++  +STS+S  AST++S   S+S +
Sbjct: 1261 SASASTSASASASTSA-SASASTSASASASTSASAL--ASTSASASASTSASSSASTSAS 1317

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1318 ASASTSASASASTSASESASTSASASASTSASASASTSASESASTSA--SASASTSASES 1375

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1376 ASTSASASASTSASASASTSASASASTSASA 1406

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 52/152 (34%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1501 STSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASTSA 1560

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S +      TS  A  S + +   S 
Sbjct: 1561 SASASTSASASASTSASASASTSASASTSASASASISASESASTSASASASTSASASAST 1620

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 1621 SASASTSASASASISASESASTSASASASTSA 1652

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 48/148 (32%), Positives = 83/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1888 TSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSAS 1947

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST ASSS   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1948 ESASTSASSSASTSASASASTSASASASTSASASASTSASESASTSA--SASASTSASES 2005

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 2006 ASTSASTSASTSASTSASTSASTSASTS 2033

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/151 (35%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T ASS   +STS+S  AST++S   S+S +
Sbjct: 1923 SESASTSASASASTSA-SASASTSASESASTSASSS--ASTSASASASTSASASASTSAS 1979

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 1980 ASASTSASESASTSASASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSAS 2039

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S+ A
Sbjct: 2040 TSASTSASESASTSASTSASTSASASASISA 2070

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 427 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 483

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 484 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 543

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S+ ++A    +   S +   + STS  A
Sbjct: 544 TSASASASASTSASESASTSASASASTSASA 574

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 618  TSASASASISASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSAS 677

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 678  ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 737

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 738  TSASESASTSASESASTSASASASTSAST 766

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 629  SESASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 685

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +  +S +
Sbjct: 686  ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASESAS 745

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S  ++     ++  SA+T  + S S+ A
Sbjct: 746  TSASESASTSASASASTSASTSASTSASVSA 776

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/149 (36%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 685  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 741

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   SVS++T +    ST A  S  T A   + 
Sbjct: 742  ESASTSASESASTSASASASTSASTSASTSASVSASTSASASASTSASTSASTSASASAS 801

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 802  TSASASASTSASASASTSASASASTSASA 830

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/151 (35%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS+ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1309 SSSASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASESASTSAS 1365

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 1366 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1425

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S  ++     ++  SA+T  + S S  A
Sbjct: 1426 TSASESASTSASTSASTSASTSASTSASTSA 1456

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/153 (35%), Positives = 84/153 (54%), Gaps = 1/153 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1653 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1709

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1710 VSASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSAS 1769

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
            T  + S ST+     S  ++A+  T +++  +I
Sbjct: 1770 TSASESASTSASTSASTSASASASTSASASASI 1802

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/151 (35%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+SAS   S+S +  AS+   +STS+S  AS ++S   S+
Sbjct: 1805 SESASTSASASASTSASASASTSASASASTSASASASTSASASTSASASASISASESAST 1864

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   
Sbjct: 1865 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSA 1922

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            SE+  TS+ ++A    ++  S +   + STS
Sbjct: 1923 SESASTSASASASTSASASASTSASESASTS 1953

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/154 (35%), Positives = 82/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 1821 SASASTSASASASTSASASASTSASASTSASASASISASESASTSASASASTSASASAST 1880

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  S + +   
Sbjct: 1881 SASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSA--SASASTSA 1938

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            S +  TS+  +A    +S  S +   + STS  A
Sbjct: 1939 SASASTSASESASTSASSSASTSASASASTSASA 1972

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  SSSAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1939 SASASTSASESASTSA-SSSASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1995

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1996 ASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSAS 2055

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 2056 TSASTSASASASISASESASTSASTSASTSA 2086

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 415 STSASVSASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSA 474

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
           +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE
Sbjct: 475 SASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASE 532

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
           +  TS+ ++A    ++  SA+T  + S S  A
Sbjct: 533 SASTSASASASTSASASASASTSASESASTSA 564

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 515 SASASTSASASASTSA-SESASTSASASASTSASASASASTSASESASTSASASASTSAS 573

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   SE+
Sbjct: 574 ASASTSASTSASTSASTSASTSASTSASTSASASASISASESASTSA--SASASISASES 631

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             TS+ ++A    +   S +   + STS  A
Sbjct: 632 ASTSASASASTSASESASTSASASASTSASA 662

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 49/149 (32%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + +++A  S+SAS   S+ST+   S+   +STS+S  AST++S   S S +
Sbjct: 554  TSASESASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASASASISAS 613

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 614  ESASTSASASASISASESASTSASASASTSASESASTSASASASTSASASASTSASASAS 673

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 674  TSASASASTSASESASTSASASASTSASA 702

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/152 (35%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 749  SESASTSASASASTSASTSASTSASVSASTSASASA----STSASTSASTSASASASTSA 804

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE
Sbjct: 805  SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASE 862

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 863  SASTSASASASTSASASASTSASESASTSASA 894

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 57/156 (36%), Positives = 82/156 (52%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 989  SESASTSASASASTSASVSASTSASASASTSASASA----STSASASASTSASASASTSA 1044

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   +
Sbjct: 1045 SVSASTSASASASTSASASASTSASASASTSVSASASTSASASASTSASESASTSASASA 1104

Query: 165  ETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
             T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1105 STSASTSASTSASASASTSASESASTSASTSASTSA 1140

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 47/151 (31%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1010 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSAS 1069

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST  S+S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 1070 ASASTSVSASASTSASASASTSASESASTSASASASTSASTSASTSA--SASASTSASES 1127

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1128 ASTSASTSASTSASASASTSASASASTSASA 1158

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1077 SASASTSASASASTSA-SESASTSASASASTSASTS--ASTSASASASTSASESASTSAS 1133

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1134 TSASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1193

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1194 TSASASASTSASESASTSASASASTSASA 1222

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/152 (34%), Positives = 86/152 (56%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1149 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1205

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1206 ESASTSASASASTSASASSSTSASASASTSASASASTSASASASTSASASASTSASASAS 1265

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S  ++A+  T ++++ +
Sbjct: 1266 TSASASASTSASASASTSASASASTSASALAS 1297

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/148 (36%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   SSTS+S  AST++S   S+S +
Sbjct: 1189 SASASTSASASASTSA-SESASTSASASASTSASAS--SSTSASASASTSASASASTSAS 1245

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S   +   S +
Sbjct: 1246 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SALASTSASAS 1303

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ S+A    ++  S +   + STS
Sbjct: 1304 ASTSASSSASTSASASASTSASASASTS 1331

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1971 SASASTSASASASTSASESASTSASASASTSASESASTSASTSASTSASTSASTSASTSA 2030

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S +   ST AS+ +S   S S++  +    ST A  S + +   S 
Sbjct: 2031 STSASTSASTSASTSASESASTSASTSASTSASASASISASESASTSASTSASTSASTSA 2090

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 2091 STSASTSASTSASTSASTSASTSASASASTSA 2122

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 51/152 (33%), Positives = 79/152 (51%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1987 SESASTSASASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 2046

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  S  AS  +S   S S++T +    ST A  S + +   S 
Sbjct: 2047 SESASTSASTSASTSASASASISASESASTSASTSASTSASTSASTSASTSASTSASTSA 2106

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 2107 STSASTSASASASTSASASASTSASASASTSA 2138

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/149 (36%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 677  SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 733

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T + V  ST A  S  T A   + 
Sbjct: 734  ASASTSASESASTSASESASTSASASASTSASTSASTSASVSASTSASASASTSASTSAS 793

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 794  TSASASASTSASASASTSASASASTSASA 822

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/149 (36%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 709  SASASTSASASASTSA-SESASTSASASASTSASES--ASTSASESASTSASASASTSAS 765

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
            T  ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 766  TSASTSASVSASTSASASASTSASTSASTSASASASTSASASASTSASASASTSASASAS 825

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 826  TSASASASTSASASASTSASASASTSASA 854

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 58/155 (37%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 725  SESASTSASASASTSA-SESASTSASESASTSASAS--ASTSASTSASTSASVSASTSAS 781

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 782  ASASTSASTSASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 841

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 842  TSASASASTSASASASTSASESASTSASASASTSA 876

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 773  SVSASTSASASASTSA-STSASTSASASASTSASAS--ASTSASASASTSASASASTSAS 829

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 830  ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSA--SASASTSASES 887

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 888  ASTSASASASTSASASASTSASASASTSASA 918

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 837  SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASESASTSAS 893

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  S  T A   + 
Sbjct: 894  ASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASAS 953

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 954  TSASASASTSASASASTSASASASTSASA 982

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 869  SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 925

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 926  VSASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 983

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +  V+ STS  A
Sbjct: 984  ASTSASESASTSASASASTSASVSASTSASA 1014

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 885  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASESASTSAS 941

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 942  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1001

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1002 TSASVSASTSASASASTSASASASTSASA 1030

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/149 (36%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 917  SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 973

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   SVS++T +    ST A  S  T A   + 
Sbjct: 974  ASASTSASASASTSASESASTSASASASTSASVSASTSASASASTSASASASTSASASAS 1033

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1034 TSASASASTSASVSASTSASASASTSASA 1062

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1493 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSASTSASTSA 1552

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S +ST+ S   + + +  + T A   + 
Sbjct: 1553 SASASTSASASASTSASASASTSASASASTSAS-ASTSASASASISASESASTSASASAS 1611

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+    TS  SA+  ++ S S
Sbjct: 1612 TSASASASTSASASTSA-SASASISASES 1639

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 46/148 (31%), Positives = 80/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 1730 TSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASESASTSASTSASTSAS 1789

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1790 ASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASTS 1849

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+  +A    ++  SA+   + S S
Sbjct: 1850 ASASASISASESASTSASASASTSASAS 1877

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/148 (36%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1773 SESASTSASTSAST---SASASASTSASASASISASESASTSASASASTSASASASTSAS 1829

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++  ST AS+ +SI  S S++T +    ST A  S  T A   + 
Sbjct: 1830 ASASTSASAS--ASTSASASTSASASASISASESASTSASASASTSASASASTSASASAS 1887

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1888 TSASASASTSASASASTSASASASTSAS 1915

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 52/152 (34%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 1899 SASASTSASASASTSASVSASTSASESASTSASASA----STSASASASTSASESASTSA 1954

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            ++  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S 
Sbjct: 1955 SSSASTSASASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASTSA 2014

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 2015 STSASTSASTSASTSASTSASTSASTSASTSA 2046

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            SS+ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1955 SSSASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASESASTSAS 2011

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG--RDS 166
            T  ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +     S
Sbjct: 2012 TSASTSASTSASTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISAS 2071

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            E+  TS+ ++A    ++  S +   + STS
Sbjct: 2072 ESASTSASTSASTSASTSASTSASTSASTS 2101

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 51/148 (34%), Positives = 80/148 (54%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 411 SASASTSASVSASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 467

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 468 ESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 527

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              S  ++     ++  SA+   + STS
Sbjct: 528 TSASESASTSASASASTSASASASASTS 555

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/148 (35%), Positives = 81/148 (54%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 435 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASESASTSAS 491

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 492 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 551

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TS+  +A    ++  S +   + STS
Sbjct: 552 ASTSASESASTSASASASTSASASASTS 579

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 669  SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 725

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  SV+ +   S +
Sbjct: 726  ESASTSASASASTSASESASTSASESASTSASASASTSASTSASTSA--SVSASTSASAS 783

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 784  ASTSASTSASTSASASASTSASASASTSASA 814

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 47/148 (31%), Positives = 83/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 898  TSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSAS 957

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 958  ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSA--SVSASTSASAS 1015

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 1016 ASTSASASASTSASASASTSASASASTS 1043

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 997  SASASTSASVSASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 1053

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST  S+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1054 ASASTSASASASTSASASASTSVSASASTSASASASTSASESASTSASASASTSASTSAS 1113

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1114 TSASASASTSASESASTSASTSASTSASASA 1144

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/148 (35%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1229 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1285

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+    S ++  ST ASS +S   S S++T +    ST A +S  T A   + 
Sbjct: 1286 ASASTSASALASTSASASASTSASSSASTSASASASTSASASASTSASESASTSASASAS 1345

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1346 TSASASASTSASESASTSASASASTSAS 1373

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 47/148 (31%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S     S+   +STS+S  AST++S   S+S +
Sbjct: 1266 TSASASASTSASASASTSASASASTSASALASTSASASASTSASSSASTSASASASTSAS 1325

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1326 ASASTSASESASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASAS 1385

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1386 TSASASASTSASASASTSASASASTSAS 1413

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/148 (35%), Positives = 83/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1317 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1373

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1374 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSA--SASASTSASES 1431

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 1432 ASTSASTSASTSASTSASTSASTSASTS 1459

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1325 SASASTSASESASTSA-SASASTSASASASTSASES--ASTSASASASTSASESASTSAS 1381

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 1382 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASTSAS 1441

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1442 TSASTSASTSASTSASTSASTSASTSASTSA 1472

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1373 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1429

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1430 ESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1489

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1490 TSASTSASTSASTSASTSASTSASTSASTSA 1520

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 54/148 (36%), Positives = 83/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A T AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1513 STSASTSASTSASTSA-STSASTSASESASTSASTS--ASTSASASASTSASASASTSAS 1569

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   ST++  ST AS+ +SI  S S++T +    ST A  S + +   S +
Sbjct: 1570 ASASTSASAS--ASTSASASTSASASASISASESASTSASASASTSASASASTSASASTS 1627

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+  +A    ++  SA+   + S S
Sbjct: 1628 ASASASISASESASTSASASASTSASAS 1655

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 55/154 (35%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1705 STSASVSASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSA 1764

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  ST AS S   S ++  ST AS+ +S   S S++  +    ST A  S  T A   +
Sbjct: 1765 STSASTSASESASTSASTSASTSASASASTSASASASISASESASTSASASASTSASASA 1824

Query: 165  ETVVTSSDST-AFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST A    ++  SA+T  + S S+ A
Sbjct: 1825 STSASASASTSASASASTSASASTSASASASISA 1858

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 56/158 (35%), Positives = 83/158 (52%), Gaps = 7/158 (4%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +S S+S  AST++S   S+
Sbjct: 1813 SASASTSASASASTSASASASTSASASASTSASASTSASASASISASESASTSASASAST 1872

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A +S  T A  
Sbjct: 1873 SASASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASA 1932

Query: 171  DSETVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
             + T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1933 SASTSASASASTSASESASTSASSSASTSASASASTSA 1970

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 56/156 (35%), Positives = 82/156 (52%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+SAS   S+S +   S+   +S S+S  AST++S   S+S 
Sbjct: 585  STSASTSASTSASTSASTSASASASISASESASTSASASASISASESASTSASASASTSA 644

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 645  SESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASA 704

Query: 165  ETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
             T  ++S ST+     S     SA+T  + S S  A
Sbjct: 705  STSASASASTSASASASTSASESASTSASASASTSA 740

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 941  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 997

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 998  ASASTSASVSASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASAS 1055

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1056 ASTSASASASTSASASASTSVSASASTSASA 1086

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1117 SASASTSASESASTSA-STSASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1173

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA-*DSVTGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A   S T A   + 
Sbjct: 1174 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASSSTSASASAS 1233

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1234 TSASASASTSASASASTSASASASTSASA 1262

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/148 (35%), Positives = 84/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1165 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1221

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1222 ASSSTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 1279

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    +++ S +   + STS
Sbjct: 1280 ASTSASASASTSASALASTSASASASTS 1307

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/153 (32%), Positives = 83/153 (54%), Gaps = 6/153 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFS-----STSSSFFASTTSSVLL 355
            S + ST A   AST+  +SS++   +S++T+ ++S   S     STS+S  AST++S   
Sbjct: 1205 SESASTSASASASTSASASSSTSASASASTSASASASTSASASASTSASASASTSASASA 1264

Query: 354  SSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGA 178
            S+S +   ST AS+S   S ++  ST AS+++S   S S++T +    ST A  S  T A
Sbjct: 1265 STSASASASTSASASASTSASASASTSASALASTSASASASTSASSSASTSASASASTSA 1324

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCST 79
               + T  + S ST+     S  ++A+  T ++
Sbjct: 1325 SASASTSASESASTSASASASTSASASASTSAS 1357

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1349 SASASTSASESASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1405

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 1406 ASASTSASESASTSASASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSAS 1465

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1466 TSASTSASTSASTSASTSASTSASTSASTSA 1496

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1357 SESASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1413

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1414 ESASTSASASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1473

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1474 TSASTSASTSASTSASTSASTSASTSASTSA 1504

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1365 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1421

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1422 ASASTSASESASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 1481

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1482 TSASTSASTSASTSASTSASTSASTSASTSA 1512

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%), Gaps = 4/151 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 1561 SASASTSASASASTSASASASTSASASTSASASASISASESASTSASASASTSASA--SA 1618

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            ST+   ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 1619 STSASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASA 1678

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             + T  ++S ST+     S  ++A+  T ++
Sbjct: 1679 SASTSASASASTSASASASTSASASASTSAS 1709

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/152 (32%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1617 SASTSASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSA 1676

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  S + +   S 
Sbjct: 1677 SASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASA 1736

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 1737 STSASASASTSASTSASTSASTSASTSASTSA 1768

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1645 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1701

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1702 ASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSAS 1761

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1762 TSASTSASTSASESASTSASTSASTSASASA 1792

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 49/151 (32%), Positives = 80/151 (52%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S S +T AS+   +S S+S  AST++S   S+S +
Sbjct: 507 SASASTSASASASTSA-SASASTSASESASTSASASASTSASASASASTSASESASTSAS 565

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++T +    S  A +S + +   S +
Sbjct: 566 ASASTSASASASTSASTSASTSASTSASTSASTSASTSASASASISASESASTSASASAS 625

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
           +  S  ++     ++  SA+   + S S  A
Sbjct: 626 ISASESASTSASASASTSASESASTSASASA 656

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 645  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 701

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 702  ASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASESASTSASASAS 761

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 762  TSASTSASTSASVSASTSASASASTSAST 790

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 717  SASASTSASESASTSA-SASASTSASESASTSASES--ASTSASASASTSASTSASTSAS 773

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 774  VSASTSASASASTSASTSASTSASASASTSASASASTSASASASTSASASASTSASASAS 833

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 834  TSASASASTSASASASTSASASASTSAS 861

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 47/149 (31%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 890  TSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSAS 949

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 950  ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASVSAS 1009

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1010 TSASASASTSASASASTSASASASTSASA 1038

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 47/148 (31%), Positives = 80/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 978  TSASASASTSASESASTSASASASTSASVSASTSASASASTSASASASTSASASASTSAS 1037

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T      ST A  S + +   SE+
Sbjct: 1038 ASASTSASVSASTSASASASTSASASASTSASASASTSVSASASTSA--SASASTSASES 1095

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 1096 ASTSASASASTSASTSASTSASASASTS 1123

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/150 (34%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1001 STSASVSASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSA 1060

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1061 SASASTSASASASTSVSASASTSASASASTSASESASTSASASASTSASTSASTSASASA 1120

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  + S ST+     S  ++A+  T +++
Sbjct: 1121 STSASESASTSASTSASTSASASASTSASA 1150

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1061 SASASTSASASASTS-VSASASTSASASASTSASES--ASTSASASASTSASTSASTSAS 1117

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1118 ASASTSASESASTSASTSASTSASASASTSASASASTSASASASTSASASASTSASASAS 1177

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1178 TSASASASTSASASASTSASASASTSAS 1205

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1157 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1213

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1214 ASASTSASASSSTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1273

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A   T +++
Sbjct: 1274 TSASASASTSASASASTSASALASTSASA 1302

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 54/151 (35%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1221 SASSSTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1277

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1278 ASASTSASASASTSASALASTSASASASTSASSSASTSASASASTSA--SASASTSASES 1335

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1336 ASTSASASASTSASASASTSASESASTSASA 1366

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1341 SASASTSASASASTSA-SESASTSASASASTSASES--ASTSASASASTSASASASTSAS 1397

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1398 ASASTSASASASTSASESASTSASASASTSASESASTSASTSASTSASTSASTSASTSAS 1457

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1458 TSASTSASTSASTSASTSASTSASTSASTSA 1488

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +STS+S  AS ++S   S+
Sbjct: 1545 STSASTSASASASTSASASASTSASASASTSASASASTSASASTSASASASISASESAST 1604

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   ST++  ST AS+ +SI  S S++T +    ST A  S  T A  
Sbjct: 1605 SASASASTSASAS--ASTSASASTSASASASISASESASTSASASASTSASASASTSASA 1662

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 1663 SASTSASASASTSASASASTSASASASTSASA 1694

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 47/151 (31%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 1722 TSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASESASTSAS 1781

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  S  AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 1782 TSASTSASASASTSASASASISASESASTSASASASTSASASASTSA--SASASTSASAS 1839

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++     ++  SA+   + S S  A
Sbjct: 1840 ASTSASASTSASASASISASESASTSASASA 1870

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/148 (34%), Positives = 80/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A T AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1741 SASASTSASTSASTSA-STSASTSASTSASTSASES--ASTSASTSASTSASASASTSAS 1797

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               S  AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1798 ASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASTSASASASIS 1857

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++A    ++  SA+   + S S
Sbjct: 1858 ASESASTSASASASTSASASASTSASAS 1885

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/155 (32%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1848 TSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSAS 1907

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1908 ASASTSASVSASTSASESASTSASASASTSASASASTSASESASTSASSSASTSASASAS 1967

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1968 TSASASASTSASASASTSASESASTSASASASTSA 2002

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 58/155 (37%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 1867 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 1923

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1924 ESASTSASASASTSASASASTSASESASTSASSSASTSASASASTSASASASTSASASAS 1983

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  + S ST+     S     SA+T  + S S  A
Sbjct: 1984 TSASESASTSASASASTSASESASTSASTSASTSA 2018

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 46/148 (31%), Positives = 80/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 602  TSASASASISASESASTSASASASISASESASTSASASASTSASESASTSASASASTSAS 661

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 662  ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSA--SASASTSASAS 719

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 720  ASTSASESASTSASASASTSASESASTS 747

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 58/155 (37%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 933  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 989

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 990  ESASTSASASASTSASVSASTSASASASTSASASASTSASASASTSASASASTSASVSAS 1049

Query: 162  TVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T V+ S S  A
Sbjct: 1050 TSASASASTSASASASTSASASASTSVSASASTSA 1084

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 51/155 (32%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1066 TSASASASTSVSASASTSASASASTSASESASTSASASASTSASTSASTSASASASTSAS 1125

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1126 ESASTSASTSASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1185

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1186 TSASASASTSASASASTSASESASTSASASASTSA 1220

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  +ST++S   S+S +
Sbjct: 1181 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASSSTSASASASTSAS 1237

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S  
Sbjct: 1238 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAL 1295

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +S  S +   + STS  A
Sbjct: 1296 ASTSASASASTSASSSASTSASASASTSASA 1326

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 52/151 (34%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1333 SESASTSASASASTSA-SASASTSASESASTSASAS--ASTSASESASTSASASASTSAS 1389

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 1390 ASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASTSASTSASTSAS 1449

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1450 TSASTSASTSASTSASTSASTSASTSASTSA 1480

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 45/148 (30%), Positives = 80/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1626 TSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSAS 1685

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 1686 ASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASAS 1745

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++     ++  SA+T  + S S
Sbjct: 1746 TSASTSASTSASTSASTSASTSASTSAS 1773

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 45/151 (29%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1682 TSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSAS 1741

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1742 ASASTSASTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASTSASASAS 1801

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  S  ++     ++  SA+   + S S  A
Sbjct: 1802 ISASESASTSASASASTSASASASTSASASA 1832

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 50/149 (33%), Positives = 79/149 (53%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1839 SASTSASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSA 1898

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   +
Sbjct: 1899 SASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASESASTSASSSA 1958

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 1959 STSASASASTSASASASTSASASASTSAS 1987

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 50/152 (32%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1911 STSASVSASTSASESASTSASASASTSASASASTSASESASTSASSSASTSASASASTSA 1970

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1971 SASASTSASASASTSASESASTSASASASTSASESASTSASTSASTSASTSASTSASTSA 2030

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 2031 STSASTSASTSASTSASESASTSASTSASTSA 2062

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 47/150 (31%), Positives = 79/150 (52%)
 Frame = -1

Query: 516  SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            SA  + + + +++A  S+S S   S+S +   S+   +STS+S  AST++S   S+S + 
Sbjct: 611  SASESASTSASASASISASESASTSASASASTSASESASTSASASASTSASASASTSASA 670

Query: 336  GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETV 157
              ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+ 
Sbjct: 671  SASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASESA 728

Query: 156  VTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             TS+ ++A    +   S +   + STS  A
Sbjct: 729  STSASASASTSASESASTSASESASTSASA 758

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST+ S   S+S 
Sbjct: 1029 SASASTSASASASTSASVSASTSASASASTSASASA----STSASASASTSVSASASTSA 1084

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1085 SASASTSASESASTSASASASTSASTSASTSASASASTSASESASTSASTSASTSASASA 1144

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 1145 STSASASASTSASASASTSASASASTSASA 1174

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS S  AST++S   S+S +
Sbjct: 1037 SASASTSASVSASTSA-SASASTSASASASTSASAS--ASTSVSASASTSASASASTSAS 1093

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1094 ESASTSASASASTSASTSASTSASASASTSASESASTSASTSASTSASASASTSASASAS 1153

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1154 TSASASASTSASASASTSASASASTSASA 1182

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/155 (34%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1173 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASSSTSAS 1229

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTST----GA*DSVTGAGR 172
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST     A  S + +  
Sbjct: 1230 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1289

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             S + + S+ ++A    ++  SA+T  + S S  A
Sbjct: 1290 TSASALASTSASASASTSASSSASTSASASASTSA 1324

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 58/155 (37%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1237 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1293

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +S  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1294 ALASTSASASASTSASSSASTSASASASTSASASASTSASESASTSASASASTSASASAS 1353

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  + S ST+     S     SA+T  + S S  A
Sbjct: 1354 TSASESASTSASASASTSASESASTSASASASTSA 1388

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 58/155 (37%), Positives = 80/155 (51%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S+  ST A   AST+  SSSAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1293 SALASTSASASASTSA-SSSASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1349

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1350 ASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1409

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  + S ST+     S     SA+T  + S S  A
Sbjct: 1410 TSASESASTSASASASTSASESASTSASTSASTSA 1444

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1777 STSASTSASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSA 1836

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++ +S  AS  +S   S S++T +    ST A  S + +   S 
Sbjct: 1837 SASASTSASASTSASASASIS--ASESASTSASASASTSASASASTSA--SASASTSASA 1892

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +  V+ STS
Sbjct: 1893 SASTSASASASTSASASASTSASVSASTS 1921

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 52/151 (34%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 653  SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 709

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 710  ASASTSASASASTSASESASTSASASASTSASESASTSASESASTSASASASTSASTSAS 769

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S  ++     ++  SA+T  + S S  A
Sbjct: 770  TSASVSASTSASASASTSASTSASTSASASA 800

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 693  SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASESASTSAS 749

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 750  ESASTSASASASTSASTSASTSASVSASTSASASASTSASTSASTSASASASTSASASAS 809

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 810  TSASASASTSASASASTSASASASTSASA 838

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 701  SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASESASTSASESASTSAS 757

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 758  ASASTSASTSASTSASVSASTSASASASTSASTSASTSASASASTSASASASTSASASAS 817

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 818  TSASASASTSASASASTSASASASTSASA 846

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 805  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 861

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 862  ESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 921

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 922  TSASVSASTSASESASTSASASASTSASA 950

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/150 (34%), Positives = 80/150 (53%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S    +STS+S  AST++S   S+S 
Sbjct: 1041 STSASVSASTSASASASTSASASASTSASASASTSVSASASTSASASASTSASESASTSA 1100

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   +
Sbjct: 1101 SASASTSASTSASTSASASASTSASESASTSASTSASTSASASASTSASASASTSASASA 1160

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 1161 STSASASASTSASASASTSASASASTSASA 1190

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A T AST   A  S+SAS   S+S +  AS+   +S S+S  AST++S   S 
Sbjct: 1537 SESASTSASTSASTSASASASTSASASASTSASASASTSASASASTSASASTSASASASI 1596

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   S S +      TS  A  S + +   
Sbjct: 1597 SASESASTSASASASTSASASASTSASASTSASASASISASESASTSASASASTSASASA 1656

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 1657 STSASASASTSASASASTSASASASTSASAS 1687

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 47/151 (31%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1674 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSAS 1733

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1734 ASASTSASASASTSASTSASTSASTSASTSASTSASTSASESASTSA--STSASTSASAS 1791

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 1792 ASTSASASASISASESASTSASASASTSASA 1822

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 58/174 (33%), Positives = 88/174 (50%), Gaps = 9/174 (5%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2047 SESASTSASTSAST---SASASASISASESASTSASTSASTSASTSASTSASTSASTSAS 2103

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  S  AS+ +S   S S++  +    S  A  SV+ +   S +
Sbjct: 2104 TSASTSASTSASASASTSASASASTSASASASTSASASASTSASASASTSVSNSANHSNS 2163

Query: 159  VV-TSSDSTA--------FGGGTSMFSAATGVTCSTSMVAI*IYVEKRVKRTEK 25
             V  +S ST          G  +S+ S   GV  + + + +   V KR KR E+
Sbjct: 2164 QVGNASGSTGKSQKELPNTGTESSIGSVLLGVLAAVTGIGL---VAKRRKRDEE 2214

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 49/143 (34%), Positives = 77/143 (53%), Gaps = 1/143 (0%)
 Frame = -1

Query: 501 GAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTTGVSTG 322
           G V E+ST   S S S   S S +  AS+   +STS+S  AST++S   S+S +   ST 
Sbjct: 384 GKVVESSTTSQSLSQSKSLSVSASQSASAS--ASTSASVSASTSASASASTSASASASTS 441

Query: 321 ASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSETVVTSS 145
           AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + T  ++S
Sbjct: 442 ASASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASAS 501

Query: 144 DSTAFGGGTSMFSAATGVTCSTS 76
            ST+     S  ++A+  T +++
Sbjct: 502 ASTSASASASTSASASASTSASA 524

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 51/149 (34%), Positives = 81/149 (54%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 593  STSASTSASTSASASASISASESASTSASASASISASESASTSASASASTSASESASTSA 652

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 653  SASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASA 712

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 713  STSASASASTSASESASTSASASASTSAS 741

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 661  SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 717

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 718  ASASTSASESASTSASASASTSASESASTSASESASTSASASASTSASTSASTSASVSAS 777

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 778  TSASASASTSASTSASTSASASASTSASA 806

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 57/155 (36%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 797  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 853

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 854  ASASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 913

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 914  TSASASASTSASVSASTSASESASTSASASASTSA 948

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 845  SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASESASTSASASASTSAS 901

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 902  ASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASAS 961

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 962  TSASASASTSASASASTSASASASTSAS 989

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 853  SASASTSASESASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 909

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 910  ASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASAS 969

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 970  TSASASASTSASASASTSASESASTSASASASTSA 1004

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 51/150 (34%), Positives = 79/150 (52%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 921  STSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSA 980

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   +
Sbjct: 981  SASASTSASESASTSASASASTSASVSASTSASASASTSASASASTSASASASTSASASA 1040

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  + S ST+     S  ++A+  T +++
Sbjct: 1041 STSASVSASTSASASASTSASASASTSASA 1070

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 54/148 (36%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   SSS +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1285 SASASTSASALASTSA-SASASTSASSSASTSASAS--ASTSASASASTSASESASTSAS 1341

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1342 ASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASAS 1401

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1402 TSASASASTSASESASTSASASASTSAS 1429

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 47/151 (31%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + +S+A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1944 TSASESASTSASSSASTSASASASTSASASASTSASASASTSASESASTSASASASTSAS 2003

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 2004 ESASTSASTSASTSASTSASTSASTSASTSASTSASTSA----STSASESASTSASTSAS 2059

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 2060 TSASASASISASESASTSASTSASTSASTSA 2090

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 53/148 (35%), Positives = 79/148 (53%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 861  SESASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 917

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 918  ASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 977

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 978  TSASASASTSASESASTSASASASTSAS 1005

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 57/155 (36%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+ AS   S+S +T ASS   +STS+S  AST++S   S+S +
Sbjct: 1277 SASASTSASASASTSA-SALASTSASASASTSASSS--ASTSASASASTSASASASTSAS 1333

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1334 ESASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASAS 1393

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1394 TSASASASTSASASASTSASESASTSASASASTSA 1428

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/155 (33%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+S S   S+S +   S+   +STS+S  AST++S   S+ST+
Sbjct: 1786 TSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASA--SASTS 1843

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1844 ASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 1903

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1904 TSASASASTSASVSASTSASESASTSASASASTSA 1938

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1859 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1915

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1916 VSASTSASESASTSASASASTSASASASTSASESASTSASSSASTSASASASTSASASAS 1975

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1976 TSASASASTSASESASTSASASASTSAS 2003

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/151 (34%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1907 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASESASTSASSSASTSAS 1963

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 1964 ASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASTSASTSASTSAS 2023

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 2024 TSASTSASTSASTSASTSASTSASESASTSA 2054

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/148 (32%), Positives = 79/148 (53%), Gaps = 1/148 (0%)
 Frame = -1

Query: 516 SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
           SA  + + + +++A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S + 
Sbjct: 405 SASQSASASASTSASVSASTSASASASTSASASA----STSASASASTSASASASTSASA 460

Query: 336 GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSET 160
             ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + T
Sbjct: 461 SASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAST 520

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             ++S ST+     S  ++A+  T +++
Sbjct: 521 SASASASTSASESASTSASASASTSASA 548

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/148 (33%), Positives = 78/148 (52%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 451 SASASTSASASASTSA-SESASTSASASASTSASES--ASTSASASASTSASASASTSAS 507

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS  +S   S S++T +    S     S + +   S +
Sbjct: 508 ASASTSASASASTSASASASTSASESASTSASASASTSASASASASTSASESASTSASAS 567

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TS+ ++A    ++  S +   + STS
Sbjct: 568 ASTSASASASTSASTSASTSASTSASTS 595

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 51/151 (33%), Positives = 78/151 (51%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 973  SASASTSASASASTSA-SESASTSASASASTSAS--VSASTSASASASTSASASASTSAS 1029

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 1030 ASASTSASASASTSASVSASTSASASASTSASASASTSASASASTSVSASASTSASASAS 1089

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S  ++     ++  SA+T  + S S  A
Sbjct: 1090 TSASESASTSASASASTSASTSASTSASASA 1120

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/148 (35%), Positives = 80/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1637 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1693

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 1694 ASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSA--SASASTSASTS 1751

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 1752 ASTSASTSASTSASTSASTSASESASTS 1779

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+ST+
Sbjct: 499 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASASTS 555

Query: 339 T--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
                ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S
Sbjct: 556 ASESASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSA--SASASISAS 613

Query: 165 ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
           E+  TS+ ++A    +   S +   + STS
Sbjct: 614 ESASTSASASASISASESASTSASASASTS 643

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/148 (32%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 516  SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            SA  + + + +++A  S+SAS   S+S +T AS+   +S S+S  AST++S   S+S + 
Sbjct: 1597 SASESASTSASASASTSASASASTSASASTSASAS--ASISASESASTSASASASTSASA 1654

Query: 336  GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + T
Sbjct: 1655 SASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASVSAST 1714

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              + S ST+     S  ++A+  T +++
Sbjct: 1715 SASESASTSASASASTSASASASTSASA 1742

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 50/151 (33%), Positives = 79/151 (52%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 459 SASASTSASESASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 515

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S +   ST AS+ +S   S S++  +    S     S + +   S +
Sbjct: 516 ASASTSASASASTSASESASTSASASASTSASASASASTSASESASTSASASASTSASAS 575

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             TS+ ++A    ++  S +   + STS  A
Sbjct: 576 ASTSASTSASTSASTSASTSASTSASTSASA 606

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 57/157 (36%), Positives = 85/157 (54%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 475 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 531

Query: 339 TGVST--GASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
              ST   AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   
Sbjct: 532 ESASTSASASASTSASASASASTSASESASTSASASASTSASASASTSASTSASTSASTS 591

Query: 168 SETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
           + T  ++S ST+     S+    SA+T  + S S+ A
Sbjct: 592 ASTSASTSASTSASASASISASESASTSASASASISA 628

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/151 (33%), Positives = 81/151 (53%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 1569 SASASTSASASASTSASASTSASASASISASESASTSASASASTSASASASTSASASTSA 1628

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +  +S  AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   
Sbjct: 1629 SASASIS--ASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSA 1684

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +  TS+ ++A    ++  S +  V+ STS
Sbjct: 1685 SASASTSASASASTSASASASTSASVSASTS 1715

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 54/154 (35%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S + ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 467 SESASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 523

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
              ST AS S   S ++  ST AS+ +S   S S   ST+ S   +++ +  + T A   
Sbjct: 524 ASASTSASESASTSASASASTSASASASASTSASESASTSASASASTSASASASTSASTS 583

Query: 168 SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
           + T  ++S ST     ++  SA+T  + S S+ A
Sbjct: 584 ASTSASTSAST-----SASTSASTSASASASISA 612

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 51/148 (34%), Positives = 77/148 (52%), Gaps = 4/148 (2%)
 Frame = -1

Query: 498 AVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTTGVSTGA 319
           +V+ + +A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S +   ST A
Sbjct: 403 SVSASQSASASASTSASVSASTSASASA----STSASASASTSASASASTSASASASTSA 458

Query: 318 SSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSETVVTSSD 142
           S+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + T  ++S 
Sbjct: 459 SASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASA 518

Query: 141 STAFGGGTSMF---SAATGVTCSTSMVA 67
           ST+     S     SA+T  + S S  A
Sbjct: 519 STSASASASTSASESASTSASASASTSA 546

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 51/153 (33%), Positives = 81/153 (52%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFAST--TSSVLLSSS 346
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST  ++S   S+S
Sbjct: 491 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 547

Query: 345 TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
            +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S
Sbjct: 548 ASASASTSASESASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSASAS 607

Query: 165 ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S  ++     ++  SA+   + S S  A
Sbjct: 608 ASISASESASTSASASASISASESASTSASASA 640

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 51/155 (32%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S SAS   S+S +  AS+   +S S+S  AST++S   S S +
Sbjct: 1578 ASASTSASASTSASASASISASESASTSASASASTSASASASTSASASTSASASASISAS 1637

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1638 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1697

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1698 TSASASASTSASVSASTSASESASTSASASASTSA 1732

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 41/148 (27%), Positives = 78/148 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1794 TSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASTSASAS 1853

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              +S   S+S   S ++  S  AS+ +S   S S++  +   TS  A  S + +   S +
Sbjct: 1854 ASISASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTS 1913

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++A    ++  SA+   + S S
Sbjct: 1914 ASVSASTSASESASTSASASASTSASAS 1941

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +  AS+   +STS+S  AS ++S   S+S +
Sbjct: 1588 TSASASASISASESASTSASASA--STSASASASTSASASTSASASASISASESASTSAS 1645

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1646 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1705

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1706 TSASVSASTSASESASTSASASASTSASA 1734

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 45/150 (30%), Positives = 80/150 (53%), Gaps = 1/150 (0%)
 Frame = -1

Query: 525 IYSSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSS 346
           +  S+ ++ +++++ +   S+S S   S+ST+   S+    STS+S  AST++S   S+S
Sbjct: 386 VVESSTTSQSLSQSKSLSVSASQSASASASTSASVSA----STSASASASTSASASASTS 441

Query: 345 TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
            +   ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   
Sbjct: 442 ASASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASAS 501

Query: 168 SETVVTSSDSTAFGGGTSMFSAATGVTCST 79
           + T  ++S ST+     S  ++A+  T ++
Sbjct: 502 ASTSASASASTSASASASTSASASASTSAS 531

[15][TOP]
>UniRef100_Q3DKL3 Cell wall surface anchor family protein (Fragment) n=1
            Tax=Streptococcus agalactiae 515 RepID=Q3DKL3_STRAG
          Length = 931

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 55/152 (36%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+ST
Sbjct: 718  STSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTST 777

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S +   ST AS+ +S   S+S++T   +  ST A  S + +   S 
Sbjct: 778  STSASTSASTSASTSASMSASTSASTSASTSASMSASTSESISASTSASMSASTSASTSA 837

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     +S  SA+T  + S S  A
Sbjct: 838  STSASTSASTSASTSSSTSASTSASTSASTSA 869

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 59/161 (36%), Positives = 86/161 (53%), Gaps = 6/161 (3%)
 Frame = -1

Query: 531  LHIYSSAFSTGAVTEAST-----AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTS 367
            + + S + ST A T AST     A  S+S S   S+ST+   S+   +STS+S  AST++
Sbjct: 638  IKLLSESASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTST 697

Query: 366  SVLLSSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV 187
            S   S+S +T  ST AS S   S ++  ST AS+ +S   S+S++T +    ST A  S 
Sbjct: 698  STSASTSASTSASTSASMSASTSASTSASTSASTSASTSASMSASTSASTSASTSASMSA 757

Query: 186  -TGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T A   + T  ++S ST+     S  SA+T  + S SM A
Sbjct: 758  STSASTSASTSASTSASTSTSTSAST-SASTSASTSASMSA 797

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 53/149 (35%), Positives = 87/149 (58%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 702  STSASTSASTSASMSASTSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSA 761

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   ST++  ST AS+ +S   S+S++T +    ST A  S++ +  +S 
Sbjct: 762  STSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSA--SMSASTSESI 819

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+  +A    ++  S +   + STS
Sbjct: 820  SASTSASMSASTSASTSASTSASTSASTS 848

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 58/152 (38%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 738  SMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSA 797

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  S  AS+ +S+  S S++T +    ST A    T A   S 
Sbjct: 798  STSASTSASTSASMSASTSESISASTSASMSASTSASTSASTSASTSA---STSASTSSS 854

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S  SA+T  + S SM A
Sbjct: 855  TSASTSASTSASTSAST-SASTSASTSASMSA 885

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 56/157 (35%), Positives = 88/157 (56%), Gaps = 6/157 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 722  STSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSA 781

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS-----STTKSLVVTSTGA*DSVTGA 178
            +T  ST AS+S  +S ++  ST AS+ +S+  S S     ST+ S+  +++ +  + T A
Sbjct: 782  STSASTSASTSASMSASTSASTSASTSASMSASTSESISASTSASMSASTSASTSASTSA 841

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               + T  ++S ST+     S  SA+T  + S S  A
Sbjct: 842  STSASTSASTSSSTSASTSAST-SASTSASTSASTSA 877

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 58/155 (37%), Positives = 85/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 662  STSASTSASMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA 721

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S +   ST AS+ +S   S+S++T +    ST A    T A   + 
Sbjct: 722  STSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSA---STSASTSTS 778

Query: 162  TVVTSSDSTAFGGGTSM---FSAATGVTCSTSMVA 67
            T  ++S ST+     SM    SA+T  + S SM A
Sbjct: 779  TSASTSASTSASTSASMSASTSASTSASTSASMSA 813

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AST+   S+S S   S+ST+   S+   +STS+S  AST++S   S S 
Sbjct: 682  SMSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASMSA 741

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S  +S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 742  STSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA 801

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     +   SA+T  + S S  A
Sbjct: 802  STSASTSASMSASTSESISASTSASMSASTSA 833

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 758  STSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASMSASTSE 817

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS S   S ++  ST AS+ +S   S SS+T +    ST A  S + +   S 
Sbjct: 818  SISASTSASMSASTSASTSASTSASTSASTSASTSSSTSASTSASTSA--STSASTSAST 875

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+  +A    ++  S +  ++ STS
Sbjct: 876  SASTSASMSASTSASTSASTSASMSASTS 904

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 58/151 (38%), Positives = 83/151 (54%), Gaps = 1/151 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST   T AST+  S+SAS   S S +T AS+   +STS+S  AST+ S+  S+S +
Sbjct: 770  STSASTSTSTSASTSA-STSASTSASMSASTSASTS--ASTSASMSASTSESISASTSAS 826

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ SS   S S++T +    ST A  S  T A   + 
Sbjct: 827  MSASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASTSASTSASTSASMSAS 886

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMV 70
            T  ++S ST+     S  SA+T  + S S V
Sbjct: 887  TSASTSASTSASMSAST-SASTSASTSASTV 916

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 59/160 (36%), Positives = 84/160 (52%), Gaps = 9/160 (5%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S+  S+S 
Sbjct: 742  STSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSA 801

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DS-----VTGA 178
            +T  ST AS S   S +   ST AS  +S   S S++T +    ST A  S      T A
Sbjct: 802  STSASTSASMSASTSESISASTSASMSASTSASTSASTSASTSASTSASTSSSTSASTSA 861

Query: 177  GRDSETVVTSSDSTAFGGGTSM---FSAATGVTCSTSMVA 67
               + T  ++S ST+     SM    SA+T  + S SM A
Sbjct: 862  STSASTSASTSASTSASTSASMSASTSASTSASTSASMSA 901

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/156 (33%), Positives = 84/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS-- 349
            S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+  
Sbjct: 694  STSTSTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASMSASTSASTSASTSA 753

Query: 348  --STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
              S +T  ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + + 
Sbjct: 754  SMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASMSA 813

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              SE++  S+ ++     ++  SA+T  + S S  A
Sbjct: 814  STSESISASTSASMSASTSASTSASTSASTSASTSA 849

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/156 (33%), Positives = 83/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A T AS +A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 670  SMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSA 729

Query: 342  TTGVSTGASSSFLISTTSGVST----*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            +T  ST AS S   S ++  ST     AS+ +S   S S++T +   TST A  S + + 
Sbjct: 730  STSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSA 789

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S ++  S+ ++     ++  SA+T  + S S  A
Sbjct: 790  STSASMSASTSASTSASTSASMSASTSESISASTSA 825

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 52/148 (35%), Positives = 83/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 714  SMSASTSASTSASTSA-STSASTSASMSASTSASTS--ASTSASMSASTSASTSASTSAS 770

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST  S+S   S ++  ST AS  +S   S S++T + +  ST   +S++ +   S +
Sbjct: 771  TSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASMSASTS--ESISASTSASMS 828

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 829  ASTSASTSASTSASTSASTSASTSSSTS 856

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 1/122 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST+   S+S S   S+ST+   S+   +STS+S  AST+SS   S+S 
Sbjct: 802  STSASTSASMSASTSESISASTSASMSASTSASTSASTSASTSASTSASTSSSTSASTSA 861

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS+S   S ++  S  AS+ +S   S S++  +    ST A  S +   R  +
Sbjct: 862  STSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTVPRRQQ 921

Query: 162  TV 157
             +
Sbjct: 922  VL 923

[16][TOP]
>UniRef100_B8ZMV0 Cell wall surface anchored protein n=1 Tax=Streptococcus pneumoniae
           ATCC 700669 RepID=B8ZMV0_STRPJ
          Length = 4433

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 56/152 (36%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 407 SASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 466

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
           +T  ST AS+S   S ++  ST AS  +S   SVS++T +    ST A  S + +   SE
Sbjct: 467 STSASTSASTSASTSASASASTSASESASTSASVSASTSASASASTSA--SASASTSASE 524

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
           +  TS+ ++A    ++  S +   + STS  A
Sbjct: 525 SASTSASASASTSASASASTSASASASTSASA 556

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 56/152 (36%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+   +STS+S  AST++S   S+S 
Sbjct: 907  SASASTSASESASTSASASASTSASASASTSASASASTSASTSTSTSASTSASTSASTSA 966

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +T  ST AS S   S ++  ST AS+ +SI  S S++T +    ST A  S + +   SE
Sbjct: 967  STSASTSASESASTSASTSASTSASASASISASESASTSASASASTSA--SASASISASE 1024

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 1025 SASTSASASASTSASASASTSASASASTSASA 1056

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 50/151 (33%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++SV  S+S +
Sbjct: 1012 TSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSAS 1071

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +SI  S S++T +    ST A  S + +   SE+
Sbjct: 1072 ESASTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSTSASES 1131

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1132 ASTSASASASTSASASASTSASASASTSASA 1162

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 415 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 474

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
           +T  ST AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   +
Sbjct: 475 STSASTSASASASTSASESASTSASVSASTSASASASTSASASASTSASESASTSASASA 534

Query: 165 ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 535 STSASASASTSASASASTSASASASTSASA 564

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 56/151 (37%), Positives = 86/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 1533 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 1589

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +SI  S S++T +    ST A  S + +   SE+
Sbjct: 1590 ESASTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSTSASES 1649

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1650 ASTSASASASTSASASASTSASASASTSASA 1680

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 54/151 (35%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3719 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 3775

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 3776 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASTSAS 3835

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +  V+ STS  A
Sbjct: 3836 ASTSASASASTSASASASTSASVSASTSASA 3866

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 55/148 (37%), Positives = 85/148 (57%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4233 SASASTSASASASTSA-SESASTSASESASTSASAS--ASTSASESASTSASESASTSAS 4289

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   SE+
Sbjct: 4290 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASVSASTSASES 4349

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  SA+T V+ S +
Sbjct: 4350 ASTSASASALASTSASASASTSVSNSAN 4377

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 57/154 (37%), Positives = 85/154 (55%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AST A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 463 STSASTSASTSASTSASTSASASASTSASESASTSASVSASTSASASASTSASASASTSA 522

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
           +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   +
Sbjct: 523 SESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASA 582

Query: 165 ETVVTSSDST-AFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST A    ++  SA+T  + S S  A
Sbjct: 583 STSASASASTSASASASTSASASTSASASASTSA 616

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 56/148 (37%), Positives = 86/148 (58%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 4065 SASASTSASESASTSA-SASASTSASESASTSASAS--ASTSASESASTSASVSASTSAS 4121

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   SVS++T +    ST A +S + +   SE+
Sbjct: 4122 ASASTSASASASTSASASASTSASESASTSASVSASTSASASASTSASESASTSA--SES 4179

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +  V+ STS
Sbjct: 4180 ASTSASASASTSASASASTSASVSASTS 4207

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 54/149 (36%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 1441 STSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSA 1500

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 1501 SASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASA 1558

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +  V+ STS
Sbjct: 1559 SASTSASASASTSASASASTSASVSASTS 1587

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 54/150 (36%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++SV  S+S 
Sbjct: 447 STSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSASESASTSASVSASTSA 506

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
           +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 507 SASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASA 566

Query: 165 ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 567 STSASESASTSASASASTSASASASTSASA 596

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 1959 STSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSA 2018

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 2019 SASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 2078

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 2079 STSASASASTSASASASTSASASASTSASA 2108

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 3183 STSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSA 3242

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3243 SASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 3302

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 3303 STSASASASTSASASASTSASASASTSASA 3332

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 54/150 (36%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S + ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 399 SESASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 458

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
           +T  ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S  T A   +
Sbjct: 459 STSASTSASTSASTSASTSASTSASASASTSASESASTSASVSASTSASASASTSASASA 518

Query: 165 ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 519 STSASESASTSASASASTSASASASTSASA 548

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 55/152 (36%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+ST+T AS+   +S S+S  AST++S   S+S 
Sbjct: 2587 SASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSA 2646

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S 
Sbjct: 2647 SASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSA--SASASTSASA 2704

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +  V+ STS  A
Sbjct: 2705 SASTSASASASTSASASASTSASVSASTSASA 2736

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 411 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 470

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
           +T  ST AS+S   S ++  S  AS+ +S+  S S++  +    S  A  S + +   S 
Sbjct: 471 STSASTSASTSASASASTSASESASTSASVSASTSASASASTSASASASTSASESASTSA 530

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
           +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 531 SASASTSASASASTSASASASTSASASASTSA 562

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 55/151 (36%), Positives = 84/151 (55%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A T AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 459 STSASTSASTSASTSA-STSASTSASASASTSASES--ASTSASVSASTSASASASTSAS 515

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 516 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 573

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             TS+ ++A    ++  S +   + STS  A
Sbjct: 574 ASTSASASASTSASASASTSASASASTSASA 604

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/154 (35%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 579  SASASTSASASASTSASASASTSASASTSASASASTSASESASTSASASASTSASASAST 638

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   ST++  ST AS  +S   S S++T +    ST A  S + +   
Sbjct: 639  SASASASTSASASASTSTSASASTSASESASTSASASASTSASASASTSA--SASASTSA 696

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            SE+  TS+ ++A    ++  S +   + STS  A
Sbjct: 697  SESASTSASASASTSASASASTSASASASTSASA 730

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 53/148 (35%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 801  SASASTSASASASTSA-SESASTSASESASTSASAS--ASTSASASASTSASASASTSAS 857

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 858  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASASTSASES 917

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 918  ASTSASASASTSASASASTSASASASTS 945

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1145 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1201

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +SI  S S++T +    ST A +S  T A   + 
Sbjct: 1202 ASASTSASASASTSASASASTSASESASISASASASTSASASASTSASESASTSASASAS 1261

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1262 TSASASASTSASASASTSASASASTSASA 1290

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1663 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1719

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +SI  S S++T +    ST A +S  T A   + 
Sbjct: 1720 ASASTSASASASTSASASASTSASESASISASASASTSASASASTSASESASTSASASAS 1779

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1780 TSASASASTSASASASTSASASASTSASA 1808

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2299 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2355

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +SI  S S++T +    ST A +S  T A   + 
Sbjct: 2356 ASASTSASASASTSASASASTSASESASISASASASTSASASASTSASESASTSASASAS 2415

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2416 TSASASASTSASASASTSASASASTSASA 2444

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2887 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2943

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +SI  S S++T +    ST A +S  T A   + 
Sbjct: 2944 ASASTSASASASTSASASASTSASESASISASASASTSASASASTSASESASTSASASAS 3003

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3004 TSASASASTSASASASTSASASASTSASA 3032

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 48/149 (32%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3304 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSAS 3363

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A +S  T A   + 
Sbjct: 3364 ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASAS 3423

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3424 TSASASASTSASASASTSASASASTSASA 3452

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 49/156 (31%), Positives = 85/156 (54%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFS-----STSSSFFASTTSSVLL 355
            S++ ST A T AST+   S+++   +S++T+ ++S   S     STS+S  AST++S   
Sbjct: 959  STSASTSASTSASTSASESASTSASTSASTSASASASISASESASTSASASASTSASASA 1018

Query: 354  SSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            S S +   ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A +S + + 
Sbjct: 1019 SISASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSA 1078

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             +S +   S+ ++     ++  SA+   + S S  A
Sbjct: 1079 SESASTSASASASTSASASASISASESASTSASASA 1114

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 53/150 (35%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+   +STS+S  AST++S   S+S 
Sbjct: 1401 SASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSA 1460

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  S  AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   +
Sbjct: 1461 STSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSASESASTSASASA 1520

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 1521 STSASASASTSASASASTSASASASTSASA 1550

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1485 SESASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1541

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A +S + +  +S +
Sbjct: 1542 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASESAS 1601

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+   + S S  A
Sbjct: 1602 TSASASASTSASASASISASESASTSASASA 1632

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 53/150 (35%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+   +STS+S  AST++S   S+S 
Sbjct: 1919 SASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSA 1978

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  S  AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   +
Sbjct: 1979 STSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSASESASTSASASA 2038

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 2039 STSASASASTSASASASTSASASASTSASA 2068

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 48/149 (32%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2636 TSASESASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSAS 2695

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A +S  T A   + 
Sbjct: 2696 ASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASAS 2755

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2756 TSASASASTSASASASTSASASASTSASA 2784

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 53/150 (35%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+   +STS+S  AST++S   S+S 
Sbjct: 3143 SASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSA 3202

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +T  S  AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   +
Sbjct: 3203 STSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSASESASTSASASA 3262

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 3263 STSASASASTSASASASTSASASASTSASA 3292

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/151 (36%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3235 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3291

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   SE+
Sbjct: 3292 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASES 3349

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 3350 ASTSASASASTSASASASTSASASASTSASA 3380

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 54/149 (36%), Positives = 86/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3243 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3299

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A +S  T A   + 
Sbjct: 3300 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASAS 3359

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3360 TSASASASTSASASASTSASASASTSASA 3388

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/151 (36%), Positives = 86/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3299 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASESASTSAS 3355

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   SE+
Sbjct: 3356 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA--SASASTSASES 3413

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 3414 ASTSASASASTSASASASTSASASASTSASA 3444

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/151 (36%), Positives = 86/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3711 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3767

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3768 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 3825

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 3826 ASTSASTSASASTSASASASTSASASASTSA 3856

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/148 (37%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 4105 SESASTSASVSASTSA-SASASTSASASASTSASAS--ASTSASESASTSASVSASTSAS 4161

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T + V  ST A +S  T A   + 
Sbjct: 4162 ASASTSASESASTSASESASTSASASASTSASASASTSASVSASTSASESASTSASASAS 4221

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 4222 TSASASASTSASASASTSASASASTSAS 4249

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 49/147 (33%), Positives = 77/147 (52%)
 Frame = -1

Query: 507 STGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTTGVS 328
           S G + E+ST   S S S   S S +  AS+   +STS+S  AST++S   S+S +T  S
Sbjct: 368 SKGKIVESSTTSQSLSQSKSLSVSASQSASASESASTSASASASTSASTSASTSASTSAS 427

Query: 327 TGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETVVTS 148
           T AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +   S
Sbjct: 428 TSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASAS 487

Query: 147 SDSTAFGGGTSMFSAATGVTCSTSMVA 67
           + ++     ++  SA+T  + S S  A
Sbjct: 488 TSASESASTSASVSASTSASASASTSA 514

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1345 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1401

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1402 ASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSAS 1461

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 1462 TSTSASASASTSASASVSASTSASESASTSA 1492

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1863 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1919

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1920 ASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSAS 1979

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 1980 TSTSASASASTSASASVSASTSASESASTSA 2010

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 54/148 (36%), Positives = 84/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2011 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2067

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   SE+
Sbjct: 2068 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASES 2125

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 2126 ASTSASASASTSASASASTSASASASTS 2153

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2499 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2555

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2556 ASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSAS 2615

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 2616 TSTSASASASTSASASVSASTSASESASTSA 2646

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 53/152 (34%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 2627 SASASVSASTSASESASTSASASASTSASASASTSASASASTSASVSASTSASESASTSA 2686

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   SE
Sbjct: 2687 SASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSA--SASASTSASE 2744

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 2745 SASTSASASASTSASASASTSASASASTSASA 2776

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3087 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3143

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3144 ASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSAS 3203

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 3204 TSTSASASASTSASASVSASTSASESASTSA 3234

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +S S+S  AST++S   S+S +
Sbjct: 865  SASASTSASASASTSA-SASASTSASASASTSASASASTSASASASASTSASESASTSAS 923

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 924  ASASTSASASASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSAS 983

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 984  TSASTSASASASISASESASTSASASASTSA 1014

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 58/155 (37%), Positives = 86/155 (55%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2019 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2075

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A +S  T A   + 
Sbjct: 2076 ASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASAS 2135

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2136 TSASASASTSASASASTSASESASTSASASASTSA 2170

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 54/151 (35%), Positives = 86/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3355 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASASASTSAS 3411

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3412 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 3469

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +++ SA+   + S S  A
Sbjct: 3470 ASTSASASASTSASALTSASASASTSASASA 3500

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3895 SASASTSASASASTSA-SASASTSASESASTSASTSASASTSASASASTSASASASTSAS 3953

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3954 ESASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASAS 4013

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4014 TSASASASTSASASASTSASASASTSASA 4042

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/150 (35%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 439 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSASESASTSA 498

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
           +   ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   +
Sbjct: 499 SVSASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASA 558

Query: 165 ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 559 STSASASASTSASESASTSASASASTSASA 588

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 713  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 769

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 770  ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESAS 829

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 830  TSASASASTSASASASTSASASASTSASA 858

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 47/151 (31%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+ST+T  S+   +STS+S  AST++S   S S +
Sbjct: 920  TSASASASTSASASASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESAS 979

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S +   S  AS+ +S   S S++  + +  S  A  S + +   S +
Sbjct: 980  TSASTSASTSASASASISASESASTSASASASTSASASASISASESASTSASASASTSAS 1039

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 1040 ASASTSASASASTSASASASTSASVSASTSA 1070

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 55/150 (36%), Positives = 86/150 (57%), Gaps = 3/150 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S  +S+ST+
Sbjct: 2579 SASASTSASASASTSA-STSASTSASTSASTSASTSASTSTSASASASTSASASVSASTS 2637

Query: 339  T--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
                 ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  S  T A   
Sbjct: 2638 ASESASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASAS 2697

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCST 79
            + T  ++S ST+     S  ++A+  T ++
Sbjct: 2698 ASTSASASASTSASASASTSASASASTSAS 2727

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 54/151 (35%), Positives = 86/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2687 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASASASTSAS 2743

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 2744 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 2801

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +++ SA+   + S S  A
Sbjct: 2802 ASTSASASASTSASALTSASESASTSASASA 2832

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 55/151 (36%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 3291 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 3347

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 3348 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASAS 3405

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 3406 ASTSASESASTSASASASTSASASASTSASA 3436

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3695 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3751

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3752 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3811

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + STS  A
Sbjct: 3812 TSASASASTSASESASTSASTSASASTSASA 3842

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+ST+
Sbjct: 3815 SASASTSASESASTSA-STSASASTSASASASTSASASASTSASVSASTSASA--SASTS 3871

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 3872 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASTSAS 3931

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 3932 ASTSASASASTSASASASTSASESASTSASA 3962

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 47/148 (31%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1214 TSASASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSAS 1273

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1274 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1333

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1334 TSASASASTSASASASTSASASASTSAS 1361

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1257 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1313

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1314 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1373

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1374 TSASASASTSASASASTSASASASTSASA 1402

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1305 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1361

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 1362 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1421

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1422 TSASASASTSASASASTSASTSASTSASTSA 1452

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 47/148 (31%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1732 TSASASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSAS 1791

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1792 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1851

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1852 TSASASASTSASASASTSASASASTSAS 1879

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1775 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1831

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 1832 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1891

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1892 TSASASASTSASASASTSASASASTSASA 1920

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1823 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1879

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 1880 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 1939

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1940 TSASASASTSASASASTSASTSASTSASTSA 1970

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 47/148 (31%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2368 TSASASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSAS 2427

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2428 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 2487

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2488 TSASASASTSASASASTSASASASTSAS 2515

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2411 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2467

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2468 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 2527

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2528 TSASASASTSASASASTSASASASTSASA 2556

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2459 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2515

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 2516 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 2575

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 2576 TSASASASTSASASASTSASTSASTSASTSA 2606

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 54/149 (36%), Positives = 81/149 (54%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST A  S+S S   S+S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 2595 STSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSA 2654

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   +
Sbjct: 2655 SASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASA 2714

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 2715 STSASASASTSASVSASTSASASASTSAS 2743

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 47/148 (31%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2956 TSASASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSAS 3015

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 3016 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 3075

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 3076 TSASASASTSASASASTSASASASTSAS 3103

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2999 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3055

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 3056 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 3115

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3116 TSASASASTSASASASTSASASASTSASA 3144

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3047 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3103

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 3104 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 3163

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3164 TSASASASTSASASASTSASTSASTSASTSA 3194

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 53/154 (34%), Positives = 82/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 3537 SASASTSASASASTSASASASTSASASTSASASASTSASESASTSASASASTSASASAST 3596

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   
Sbjct: 3597 SASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSA--SASASTSA 3654

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            SE+  TS+ ++A    ++  S +   + STS  A
Sbjct: 3655 SESASTSASASASTSASASASTSASASASTSASA 3688

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 3545 SASASTSASASASTSASASTSASASASTSASESASTSASASASTSASASASTSASASAST 3604

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A +S  T A  
Sbjct: 3605 SASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASA 3664

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 3665 SASTSASASASTSASASASTSASASASTSASA 3696

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3639 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3695

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3696 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 3753

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 3754 ASTSASASASTSASASASTSASASASTSASA 3784

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 53/149 (35%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3647 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3703

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 3704 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 3763

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3764 TSASASASTSASASASTSASASASTSASA 3792

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 55/151 (36%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3799 SASASTSASASASTSA-SASASTSASESASTSASTSASASTSASASASTSASASASTSAS 3857

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   ST++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3858 VSASTSASAS--ASTSASASTSASASASTSASESASTSASASASTSA--SASASTSASAS 3913

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  SA+T  + S S  A
Sbjct: 3914 ASTSASESASTSASTSASASTSASASASTSA 3944

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 55/151 (36%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3977 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4033

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 4034 ASASTSASASASTSASASASTSASESASTSASASASTSASESASTSA--SASASTSASES 4091

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +  V+ STS  A
Sbjct: 4092 ASTSASASASTSASESASTSASVSASTSASA 4122

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 49/155 (31%), Positives = 85/155 (54%)
 Frame = -1

Query: 531 LHIYSSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLS 352
           L + +S  ++ + + +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S
Sbjct: 388 LSVSASQSASASESASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 447

Query: 351 SSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGR 172
           +S +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +  
Sbjct: 448 TSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSASESASTSA--SVSASTS 505

Query: 171 DSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            S +  TS+ ++A    +   S +   + STS  A
Sbjct: 506 ASASASTSASASASTSASESASTSASASASTSASA 540

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/149 (35%), Positives = 80/149 (53%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 423 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 482

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
           +   ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 483 SASASTSASESASTSASVSASTSASASASTSASASASTSASESASTSASASASTSASASA 542

Query: 165 ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 543 STSASASASTSASASASTSASASASTSAS 571

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 665  SESASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 721

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 722  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 779

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 780  ASTSASASASTSASASASTSASASASTSASA 810

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/148 (35%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 673  SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 729

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 730  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 789

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 790  TSASASASTSASASASTSASASASTSAS 817

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 705  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 761

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 762  ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 819

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 820  ASTSASESASTSASASASTSASASASTSASA 850

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/151 (35%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 793  SASASTSASASASTSA-SASASTSASESASTSASES--ASTSASASASTSASASASTSAS 849

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 850  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 909

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 910  ASTSASESASTSASASASTSASASASTSASA 940

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 51/151 (33%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 873  SASASTSASASASTSA-SASASTSASASASTSASASASASTSASESASTSASASASTSAS 931

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S + +   S +
Sbjct: 932  ASASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSAS 991

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S  ++     ++  SA+T  + S S+ A
Sbjct: 992  ASASISASESASTSASASASTSASASASISA 1022

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1161 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1217

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S  IS ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1218 ASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1277

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1278 TSASASASTSASASASTSASASASTSASA 1306

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1249 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1305

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1306 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 1363

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1364 ASTSASASASTSASASASTSASASASTSASA 1394

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 57/150 (38%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1337 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1393

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1394 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSAS 1453

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
            T  ++S ST+     S   SA+  V+ STS
Sbjct: 1454 TSASTSASTSTSASASASTSASASVSASTS 1483

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 85/151 (56%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S  +S+ST+
Sbjct: 1425 SASASTSASASASTSA-STSASTSASTSASTSASTSASTSTSASASASTSASASVSASTS 1483

Query: 339  T--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
                 ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   
Sbjct: 1484 ASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASAS 1543

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 1544 ASTSASASASTSASASASTSASASASTSASA 1574

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1679 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1735

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S  IS ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1736 ASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1795

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1796 TSASASASTSASASASTSASASASTSASA 1824

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1767 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1823

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1824 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 1881

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1882 ASTSASASASTSASASASTSASASASTSASA 1912

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 57/150 (38%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1855 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1911

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1912 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSAS 1971

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
            T  ++S ST+     S   SA+  V+ STS
Sbjct: 1972 TSASTSASTSTSASASASTSASASVSASTS 2001

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 85/151 (56%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S  +S+ST+
Sbjct: 1943 SASASTSASASASTSA-STSASTSASTSASTSASTSASTSTSASASASTSASASVSASTS 2001

Query: 339  T--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
                 ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   
Sbjct: 2002 ASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASAS 2061

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 2062 ASTSASASASTSASASASTSASASASTSASA 2092

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2315 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2371

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S  IS ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2372 ASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 2431

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2432 TSASASASTSASASASTSASASASTSASA 2460

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2403 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2459

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 2460 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 2517

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2518 ASTSASASASTSASASASTSASASASTSASA 2548

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 57/150 (38%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2491 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2547

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2548 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSAS 2607

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
            T  ++S ST+     S   SA+  V+ STS
Sbjct: 2608 TSASTSASTSTSASASASTSASASVSASTS 2637

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 53/152 (34%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 2563 SESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASA 2622

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   S  AS S   S +   ST AS+ +S   S S++T +    ST A  SV+ +   SE
Sbjct: 2623 SASTSASASVSASTSASESASTSASASASTSASASASTSASASASTSA--SVSASTSASE 2680

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 2681 SASTSASASASTSASASASTSASASASTSASA 2712

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 50/153 (32%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST- 343
            +SA ++ + + +++A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+ST 
Sbjct: 2568 TSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTS 2627

Query: 342  ---TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAG 175
               +   ST AS S   S ++  ST AS+ +S   S S++T + V  ST A +S  T A 
Sbjct: 2628 ASASVSASTSASESASTSASASASTSASASASTSASASASTSASVSASTSASESASTSAS 2687

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              + T  ++S ST+     S  ++A+  T +++
Sbjct: 2688 ASASTSASASASTSASASASTSASASASTSASA 2720

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2903 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2959

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S  IS ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2960 ASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 3019

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3020 TSASASASTSASASASTSASASASTSASA 3048

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2991 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3047

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3048 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 3105

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 3106 ASTSASASASTSASASASTSASASASTSASA 3136

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 57/150 (38%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3079 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3135

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3136 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASTSASTSASTSAS 3195

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
            T  ++S ST+     S   SA+  V+ STS
Sbjct: 3196 TSASTSASTSTSASASASTSASASVSASTS 3225

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/151 (35%), Positives = 85/151 (56%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S  +S+ST+
Sbjct: 3167 SASASTSASASASTSA-STSASTSASTSASTSASTSASTSTSASASASTSASASVSASTS 3225

Query: 339  T--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
                 ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   
Sbjct: 3226 ASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASAS 3285

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 3286 ASTSASASASTSASASASTSASASASTSASA 3316

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 51/151 (33%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 3459 SASASTSASESASTSASASASTSASALTSASASASTSASASASTSASASASTSASESAST 3518

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +   TS  A  + T A   
Sbjct: 3519 SASASASTSASASASTSASASASTSASASASTSASASASTSASASTSASA-SASTSASES 3577

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 3578 ASTSASASASTSASASASTSASASASTSASA 3608

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 55/152 (36%), Positives = 82/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 4097 SASASTSASESASTSASVSASTSASASASTSASASA----STSASASASTSASESASTSA 4152

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S +   ST AS  +S   S S++T +    ST A  SV+ +   SE
Sbjct: 4153 SVSASTSASASASTSASESASTSASESASTSASASASTSASASASTSA--SVSASTSASE 4210

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    ++  S +   + STS  A
Sbjct: 4211 SASTSASASASTSASASASTSASASASTSASA 4242

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 57/156 (36%), Positives = 82/156 (52%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 431 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTSA 490

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
           +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 491 SESASTSASVSASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASA 550

Query: 165 ETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 551 STSASASASTSASASASTSASESASTSASASASTSA 586

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/149 (36%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 601  SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSTS 657

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 658  ASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 717

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 718  TSASASASTSASASASTSASASASTSASA 746

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/150 (36%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+T AS+    STS+S  AST++S   S+S 
Sbjct: 625  SASASTSASASASTSASASASTSASASASTSTSASA----STSASESASTSASASASTSA 680

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 681  SASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASA 740

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 741  STSASASASTSASASASTSASASASTSASA 770

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/149 (35%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 721  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 777

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 778  ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASAS 837

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 838  TSASASASTSASASASTSASASASTSASA 866

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/148 (35%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1297 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1353

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1354 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 1411

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 1412 ASTSASASASTSASASASTSASASASTS 1439

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1353 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1409

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1410 ESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASAS 1469

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++     ++  SA+T  + S S  A
Sbjct: 1470 ASTSASASVSASTSASESASTSASASASTSA 1500

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/152 (35%), Positives = 85/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1473 SASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSA 1532

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   SE
Sbjct: 1533 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASE 1590

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+  +A    ++  SA+T  + S S+ A
Sbjct: 1591 SASTSASESASTSASA--SASTSASASASISA 1620

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/148 (35%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1815 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1871

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1872 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 1929

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 1930 ASTSASASASTSASASASTSASASASTS 1957

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1871 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1927

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1928 ESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASAS 1987

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++     ++  SA+T  + S S  A
Sbjct: 1988 ASTSASASVSASTSASESASTSASASASTSA 2018

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/152 (35%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 2099 SASASTSASASASTSASVSASTSASESASTSASASA----STSASASASTSASASASTSA 2154

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE
Sbjct: 2155 SESASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASE 2212

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +  TS+ ++A    +++ SA+   + S S  A
Sbjct: 2213 SASTSASASASTSASALTSASESASTSASASA 2244

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/148 (35%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2451 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2507

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 2508 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 2565

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 2566 ASTSASASASTSASASASTSASASASTS 2593

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2507 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2563

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2564 ESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASAS 2623

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++     ++  SA+T  + S S  A
Sbjct: 2624 ASTSASASVSASTSASESASTSASASASTSA 2654

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/148 (35%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3039 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3095

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3096 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 3153

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 3154 ASTSASASASTSASASASTSASASASTS 3181

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3095 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3151

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3152 ESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASAS 3211

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++     ++  SA+T  + S S  A
Sbjct: 3212 ASTSASASVSASTSASESASTSASASASTSA 3242

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 51/148 (34%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3387 SASASTSASVSASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3443

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +  +TS  A  S + +   S +
Sbjct: 3444 ASASTSASASASTSASASASTSASESASTSASASASTSASALTSASASASTSASASASTS 3503

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++A    ++  SA+   + S S
Sbjct: 3504 ASASASTSASESASTSASASASTSASAS 3531

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +   S+   +STS+S  AST++SV  S+S +
Sbjct: 3807 SASASTSASASASTSA-SESASTSASTSASASTSASASASTSASASASTSASVSASTSAS 3865

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 3866 ASASTSASAS--TSASASASTSASESASTSASASASTSASASASTSA--SASASTSASES 3921

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 3922 ASTSASTSASASTSASASASTSASASASTSA 3952

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 50/152 (32%), Positives = 81/152 (53%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 427 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASA 486

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
           +T  S  AS+S  +S ++  S  AS+ +S   S S++  +    S  A  S + +   S 
Sbjct: 487 STSASESASTSASVSASTSASASASTSASASASTSASESASTSASASASTSASASASTSA 546

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
           +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 547 SASASTSASASASTSASASASTSASESASTSA 578

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 52/148 (35%), Positives = 82/148 (55%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 507 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 563

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS S   S ++  ST AS+ +S   S S++T +   TS  A  + T A   + T
Sbjct: 564 ASASTSASESASTSASASASTSASASASTSASASASTSASASTSASA-SASTSASESAST 622

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             ++S ST+     S  ++A+  T +++
Sbjct: 623 SASASASTSASASASTSASASASTSASA 650

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 51/151 (33%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 889  SASASTSASASASTSA-SASASASTSASESASTSASASASTSASASASTSASASASTSAS 947

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S + +   S +
Sbjct: 948  TSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISASESASTSAS 1007

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 1008 ASASTSASASASISASESASTSASASASTSA 1038

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 48/149 (32%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + +E+++   S+SAS   S+S +T  S+   +STS+S  AST++S   S+S +
Sbjct: 1094 ASASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSAS 1153

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1154 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1213

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S+ ++A+  T +++
Sbjct: 1214 TSASASASTSASESASISASASASTSASA 1242

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1209 SASASTSASASASTSA-SESASISASASASTSASAS--ASTSASESASTSASASASTSAS 1265

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1266 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 1323

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1324 ASTSASASASTSASASASTSASASASTSASA 1354

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1321 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1377

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1378 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1437

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + STS  A
Sbjct: 1438 TSASTSASTSASTSASTSASTSASTSTSASA 1468

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 48/149 (32%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + +E+++   S+SAS   S+S +T  S+   +STS+S  AST++S   S+S +
Sbjct: 1612 ASASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSAS 1671

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1672 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1731

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S+ ++A+  T +++
Sbjct: 1732 TSASASASTSASESASISASASASTSASA 1760

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1727 SASASTSASASASTSA-SESASISASASASTSASAS--ASTSASESASTSASASASTSAS 1783

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 1784 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 1841

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1842 ASTSASASASTSASASASTSASASASTSASA 1872

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1839 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1895

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1896 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1955

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + STS  A
Sbjct: 1956 TSASTSASTSASTSASTSASTSASTSTSASA 1986

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST+   S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1967 STSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSA 2026

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 2027 SESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 2086

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 2087 STSASASASTSASASASTSASASASTSAS 2115

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2043 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2099

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 2100 ASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSA--SASASTSASES 2157

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2158 ASTSASASASTSASASASTSASASASTSASA 2188

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2051 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2107

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2108 ASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASAS 2167

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2168 TSASASASTSASASASTSASASASTSASA 2196

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/148 (36%), Positives = 84/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 2067 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 2123

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2124 ESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 2183

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2184 TSASASASTSASASASTSASASASTSAS 2211

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 47/152 (30%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2080 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSAS 2139

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2140 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 2199

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S  ++A+  T ++++ +
Sbjct: 2200 TSASASASTSASESASTSASASASTSASALTS 2231

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 48/149 (32%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + +E+++   S+SAS   S+S +T  S+   +STS+S  AST++S   S+S +
Sbjct: 2248 ASASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSAS 2307

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2308 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2367

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S+ ++A+  T +++
Sbjct: 2368 TSASASASTSASESASISASASASTSASA 2396

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2363 SASASTSASASASTSA-SESASISASASASTSASAS--ASTSASESASTSASASASTSAS 2419

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 2420 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 2477

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2478 ASTSASASASTSASASASTSASASASTSASA 2508

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2475 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 2531

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2532 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 2591

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + STS  A
Sbjct: 2592 TSASTSASTSASTSASTSASTSASTSTSASA 2622

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/150 (36%), Positives = 85/150 (56%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2523 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 2579

Query: 339  TGVSTGASSSFLISTTSGVST*A--SSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST AS+S   S ++  ST A  S+ +S   S S++T +    ST A  SV+ +   S
Sbjct: 2580 ASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSAS 2639

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            E+  TS+ ++A    ++  S +   + STS
Sbjct: 2640 ESASTSASASASTSASASASTSASASASTS 2669

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 48/149 (32%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + +E+++   S+SAS   S+S +T  S+   +STS+S  AST++S   S+S +
Sbjct: 2836 ASASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSAS 2895

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2896 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2955

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S+ ++A+  T +++
Sbjct: 2956 TSASASASTSASESASISASASASTSASA 2984

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2951 SASASTSASASASTSA-SESASISASASASTSASAS--ASTSASESASTSASASASTSAS 3007

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 3008 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 3065

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 3066 ASTSASASASTSASASASTSASASASTSASA 3096

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3063 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3119

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3120 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 3179

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + STS  A
Sbjct: 3180 TSASTSASTSASTSASTSASTSASTSTSASA 3210

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST+   S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 3191 STSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSA 3250

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3251 SESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 3310

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 3311 STSASASASTSASASASTSASASASTSAS 3339

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/148 (36%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3251 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3307

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  S  T A   + 
Sbjct: 3308 ASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASAS 3367

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 3368 TSASASASTSASASASTSASASASTSAS 3395

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 58/153 (37%), Positives = 82/153 (53%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 3347 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 3403

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3404 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3463

Query: 162  TVVTSSDST-AFGGGTSMFSAATGVTCSTSMVA 67
            T  + S ST A    ++  SA T  + S S  A
Sbjct: 3464 TSASESASTSASASASTSASALTSASASASTSA 3496

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 56/158 (35%), Positives = 82/158 (51%), Gaps = 7/158 (4%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST   A  S+SAS   S+S +  AS+   +S S+S  AST++S   S+
Sbjct: 3513 SESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASTSASASAST 3572

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A  
Sbjct: 3573 SASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASA 3632

Query: 171  DSETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
             + T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3633 SASTSASASASTSASASASTSASESASTSASASASTSA 3670

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 53/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3727 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3783

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3784 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASTSASASTSASAS 3843

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 3844 ASTSASASASTSASVSASTSASASASTSASA 3874

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 55/151 (36%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +S S+S  AST++S   S+S +
Sbjct: 3791 SASASTSASASASTSA-SASASTSASASASTSASESASTSASTSASASTSASASASTSAS 3849

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++      TS  A  + T A   + T
Sbjct: 3850 ASASTSASVSASTSASASASTSASASTSASASASTSASESASTSASA-SASTSASASAST 3908

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              ++S ST+     S  SA+T  + STS  A
Sbjct: 3909 SASASASTSASESAST-SASTSASASTSASA 3938

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 55/151 (36%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4017 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 4073

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S++T + V  ST A  S + +   S +
Sbjct: 4074 ESASTSASASASTSASESASTSASASASTSASESASTSASVSASTSA--SASASTSASAS 4131

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +  V+ STS  A
Sbjct: 4132 ASTSASASASTSASESASTSASVSASTSASA 4162

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 47/149 (31%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4166 TSASESASTSASESASTSASASASTSASASASTSASVSASTSASESASTSASASASTSAS 4225

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 4226 ASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASESASTSASESAS 4285

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4286 TSASASASTSASASASTSASASASTSASA 4314

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/152 (32%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 419 STSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSA 478

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
           +T  S  AS+S   S ++  S  AS+ +S   S S++  +    S  A  S + +   S 
Sbjct: 479 STSASASASTSASESASTSASVSASTSASASASTSASASASTSASESASTSASASASTSA 538

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
           +   S+ ++A    ++  SA+T  + S S  A
Sbjct: 539 SASASTSASASASTSASASASTSASASASTSA 570

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/152 (33%), Positives = 81/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 587  SASASTSASASASTSASASTSASASASTSASESASTSASASASTSASASASTSASASAST 646

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST  S+S   S +   ST AS+ +S   S S++T +    ST A +S  T A  
Sbjct: 647  SASASASTSTSASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASA 706

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 707  SASTSASASASTSASASASTSASASASTSASA 738

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 785  SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASESASTSASASASTSAS 841

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 842  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 899

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 900  ASTSASASASASTSASESASTSASASASTSA 930

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/152 (33%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST+   S SAS   S+S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 1111 SASASTSASASASTSTSASESASTSASASASTSASAS--ASTSASASASTSASASASTSA 1168

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +  +S 
Sbjct: 1169 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESA 1228

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+   + S S  A
Sbjct: 1229 SISASASASTSASASASTSASESASTSASASA 1260

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 55/153 (35%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1369 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1425

Query: 339  TGVSTGASSSFLISTTSGVST*A--SSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST AS+S   S ++  ST A  S+ +S   S S++T +    ST A  SV+ +   S
Sbjct: 1426 ASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSAS 1485

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            E+  TS+ ++A    ++  S +   + STS  A
Sbjct: 1486 ESASTSASASASTSASASASTSASESASTSASA 1518

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/151 (33%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1393 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASTSASTSAS 1449

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   ST++  S   S+ +S+  S S++  +    S  A  S + +   S +
Sbjct: 1450 TSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSAS 1509

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 1510 ESASTSASASASTSASASASTSASASASTSA 1540

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/152 (33%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST+   S SAS   S+S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 1629 SASASTSASASASTSTSASESASTSASASASTSASAS--ASTSASASASTSASASASTSA 1686

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +  +S 
Sbjct: 1687 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESA 1746

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+   + S S  A
Sbjct: 1747 SISASASASTSASASASTSASESASTSASASA 1778

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 55/153 (35%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1887 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1943

Query: 339  TGVSTGASSSFLISTTSGVST*A--SSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST AS+S   S ++  ST A  S+ +S   S S++T +    ST A  SV+ +   S
Sbjct: 1944 ASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSAS 2003

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            E+  TS+ ++A    ++  S +   + STS  A
Sbjct: 2004 ESASTSASASASTSASASASTSASESASTSASA 2036

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/151 (33%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1911 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASTSASTSAS 1967

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   ST++  S   S+ +S+  S S++  +    S  A  S + +   S +
Sbjct: 1968 TSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSAS 2027

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 2028 ESASTSASASASTSASASASTSASASASTSA 2058

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASG--FFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSS 346
            S++ ST A T AST+  S+SAS     S+ST+T AS+   +S S+S  AST++S   S+S
Sbjct: 1951 SASASTSASTSASTSA-STSASTSASTSASTSTSASASASTSASASVSASTSASESASTS 2009

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 2010 ASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASAS 2069

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 2070 ASTSASASASTSASASASTSASASASTSASA 2100

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2027 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2083

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A  S  T A   + 
Sbjct: 2084 ASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASAS 2143

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2144 TSASASASTSASESASTSASASASTSASA 2172

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 55/151 (36%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 2171 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASA--SASTS 2225

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
                T AS S   S ++  ST AS+ +SI  S S++T +    ST A  S + +   SE+
Sbjct: 2226 ASALTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSTSASES 2285

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2286 ASTSASASASTSASASASTSASASASTSASA 2316

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/152 (33%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST+   S SAS   S+S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 2265 SASASTSASASASTSTSASESASTSASASASTSASAS--ASTSASASASTSASASASTSA 2322

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +  +S 
Sbjct: 2323 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESA 2382

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+   + S S  A
Sbjct: 2383 SISASASASTSASASASTSASESASTSASASA 2414

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/153 (33%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 2667 STSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSA 2726

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 2727 SVSASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASA 2786

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+     S  ++A+  T ++++ +
Sbjct: 2787 STSASASASTSASESASTSASASASTSASALTS 2819

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/153 (32%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2692 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSAS 2751

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2752 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 2811

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            T  ++  S +    TS   SA+T  + S S+ A
Sbjct: 2812 TSASALTSASESASTSASASASTSASASASISA 2844

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 55/151 (36%), Positives = 85/151 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 2759 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASA--SASTS 2813

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
                T AS S   S ++  ST AS+ +SI  S S++T +    ST A  S + +   SE+
Sbjct: 2814 ASALTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSTSASES 2873

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2874 ASTSASASASTSASASASTSASASASTSASA 2904

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/152 (33%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST+   S SAS   S+S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 2853 SASASTSASASASTSTSASESASTSASASASTSASAS--ASTSASASASTSASASASTSA 2910

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +  +S 
Sbjct: 2911 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESA 2970

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            ++  S+ ++     ++  SA+   + S S  A
Sbjct: 2971 SISASASASTSASASASTSASESASTSASASA 3002

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 55/153 (35%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3111 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3167

Query: 339  TGVSTGASSSFLISTTSGVST*A--SSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST AS+S   S ++  ST A  S+ +S   S S++T +    ST A  SV+ +   S
Sbjct: 3168 ASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSAS 3227

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            E+  TS+ ++A    ++  S +   + STS  A
Sbjct: 3228 ESASTSASASASTSASASASTSASESASTSASA 3260

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/151 (33%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3135 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASTSASTSAS 3191

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   ST++  S   S+ +S+  S S++  +    S  A  S + +   S +
Sbjct: 3192 TSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSAS 3251

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 3252 ESASTSASASASTSASASASTSASASASTSA 3282

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASG--FFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSS 346
            S++ ST A T AST+  S+SAS     S+ST+T AS+   +S S+S  AST++S   S+S
Sbjct: 3175 SASASTSASTSASTSA-STSASTSASTSASTSTSASASASTSASASVSASTSASESASTS 3233

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 3234 ASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASAS 3293

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 3294 ASTSASASASTSASASASTSASASASTSASA 3324

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/153 (33%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 3335 STSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSA 3394

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3395 SVSASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASA 3454

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             T  ++S ST+     S  ++A+  T ++++ +
Sbjct: 3455 STSASASASTSASESASTSASASASTSASALTS 3487

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 45/148 (30%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3360 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSAS 3419

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 3420 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 3479

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++A    ++  SA+   + S S
Sbjct: 3480 TSASALTSASASASTSASASASTSASAS 3507

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 3521 SASASTSASASASTSASASASTSASASASTSASASASTSASASTSASASASTSASESAST 3580

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 3581 SASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASA 3640

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 3641 SASTSASASASTSASESASTSASASASTSASA 3672

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3671 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3727

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3728 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 3787

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3788 TSASASASTSASASASTSASASASTSASA 3816

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3703 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3759

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3760 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 3817

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  SA+T  + S S  A
Sbjct: 3818 ASTSASESASTSASTSASASTSASASASTSA 3848

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3945 SASASTSASESASTSA-SASASTSASESASTSASES--ASTSASASASTSASASASTSAS 4001

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 4002 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASES 4059

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    +   S +   + STS
Sbjct: 4060 ASTSASASASTSASESASTSASASASTS 4087

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 54/148 (36%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4057 SESASTSASASASTSA-SESASTSASASASTSASES--ASTSASASASTSASESASTSAS 4113

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T + V  ST A  S + +   SE+
Sbjct: 4114 VSASTSASASASTSASASASTSASASASTSASESASTSASVSASTSA--SASASTSASES 4171

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 4172 ASTSASESASTSASASASTSASASASTS 4199

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/149 (33%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 4197 STSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSA 4256

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S +   ST AS  +S   S S++T +    ST A  S + +   S 
Sbjct: 4257 SESASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASA 4316

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++     ++  SA+  V+ STS
Sbjct: 4317 STSASASASTSASASASTSASASVSASTS 4345

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 49/149 (32%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519 SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 495 STSASVSASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA 554

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
           +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 555 SASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASTSASASAST 614

Query: 162 TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
           +   S+ ++A    ++  SA+   + S S
Sbjct: 615 SASESASTSASASASTSASASASTSASAS 643

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 55/158 (34%), Positives = 83/158 (52%), Gaps = 7/158 (4%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGF---SSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST+     S+SAS   S+S +  AS+   +S S+S  AST++S   S+
Sbjct: 555  SASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASTSASASAST 614

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A  
Sbjct: 615  SASESASTSASASASTSASASASTSASASASTSASASASTSTSASASTSASESASTSASA 674

Query: 171  DSETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
             + T  ++S ST+     S     SA+T  + S S  A
Sbjct: 675  SASTSASASASTSASASASTSASESASTSASASASTSA 712

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 563  SASASTSASESASTSASASASTSASASASTSASASASTSASASTSASASASTSASESAST 622

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 623  SASASASTSASASASTSASASASTSASASASTSTSASASTSASESASTSASASASTSASA 682

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 683  SASTSASASASTSASESASTSASASASTSASA 714

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 3/150 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASG--FFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSS 346
            S++ ST A T AST+  S+SAS     S+ST+T AS+   +S S+S  AST++S   S+S
Sbjct: 1433 SASASTSASTSASTSA-STSASTSASTSASTSTSASASASTSASASVSASTSASESASTS 1491

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 1492 ASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASAS 1551

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCST 79
            + T  ++S ST+     S  ++A+  T ++
Sbjct: 1552 ASTSASASASTSASASASTSASASASTSAS 1581

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1493 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1549

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A +S + +   S +
Sbjct: 1550 ASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASESASTSASASAS 1609

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+   + S S  A
Sbjct: 1610 TSASASASISASESASTSASASASTSASASA 1640

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 50/151 (33%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +S  ++ +V+ +++A  S+S S   S+ST+  AS+    STS+S  AST++SV  S+S +
Sbjct: 2624 ASTSASASVSASTSASESASTSASASASTSASASA----STSASASASTSASVSASTSAS 2679

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 2680 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SVSASTSASAS 2737

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 2738 ASTSASESASTSASASASTSASASASTSASA 2768

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 51/148 (34%), Positives = 83/148 (56%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3403 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3459

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+++S   S S++  +   TS  A  + T A   + T
Sbjct: 3460 ASASTSASESASTSASASASTSASALTSASASASTSASASASTSASA-SASTSASESAST 3518

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              ++S ST+     S  ++A+  T +++
Sbjct: 3519 SASASASTSASASASTSASASASTSASA 3546

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3583 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3639

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3640 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 3699

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3700 TSASASASTSASASASTSASASASTSASA 3728

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3591 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 3647

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3648 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3707

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3708 TSASASASTSASASASTSASASASTSASA 3736

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3599 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3655

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3656 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3715

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3716 TSASASASTSASASASTSASASASTSASA 3744

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3631 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3687

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3688 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3747

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 3748 TSASESASTSASASASTSASASASTSASA 3776

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3663 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3719

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3720 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 3779

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3780 TSASASASTSASASASTSASASASTSASA 3808

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3679 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3735

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3736 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 3795

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 3796 TSASASASTSASASASTSASASASTSAS 3823

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/149 (34%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS    +S S+S  AST++S   S+S +
Sbjct: 3887 SESASTSASASASTSA-SASASTSASASASTSASESASTSASTSASASTSASASASTSAS 3945

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3946 ASASTSASESASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASAS 4005

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4006 TSASASASTSASASASTSASASASTSASA 4034

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3953 SESASTSASASASTSA-SESASTSASESASTSASAS--ASTSASASASTSASASASTSAS 4009

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 4010 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 4069

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  + S ST+     S     SA+T  + S S  A
Sbjct: 4070 TSASESASTSASASASTSASESASTSASASASTSA 4104

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 54/151 (35%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4145 SESASTSASVSASTSA-SASASTSASESASTSASES--ASTSASASASTSASASASTSAS 4201

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A +S + +   SE+
Sbjct: 4202 VSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASESASTSA--SES 4259

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    +   S +   + STS  A
Sbjct: 4260 ASTSASASASTSASESASTSASESASTSASA 4290

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 47/149 (31%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4174 TSASESASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSAS 4233

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 4234 ASASTSASASASTSASESASTSASESASTSASASASTSASESASTSASESASTSASASAS 4293

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4294 TSASASASTSASASASTSASASASTSASA 4322

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 54/152 (35%), Positives = 83/152 (54%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4193 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4249

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 4250 ESASTSASESASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASAS 4309

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S  ++A+  T +++ V+
Sbjct: 4310 TSASASASTSASASASTSASASASTSASASVS 4341

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 47/153 (30%), Positives = 83/153 (54%)
 Frame = -1

Query: 525 IYSSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSS 346
           I  S+ ++ +++++ +   S+S S   S S +T AS+   +STS+S  AST++S   S+S
Sbjct: 372 IVESSTTSQSLSQSKSLSVSASQSASASESASTSASAS--ASTSASTSASTSASTSASTS 429

Query: 345 TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
            +T  ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S
Sbjct: 430 ASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASASASTS 489

Query: 165 ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            +   S+ ++     ++  SA+T  + S S  A
Sbjct: 490 ASESASTSASVSASTSASASASTSASASASTSA 522

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 45/151 (29%), Positives = 80/151 (52%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           +SA  + + + +++A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S +
Sbjct: 396 ASASESASTSASASASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSAS 455

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           T  ST AS+S   S ++  ST AS+ +S   S S++  +    S  A  S + +   S +
Sbjct: 456 TSASTSASTSASTSASTSASTSASTSASASASTSASESASTSASVSASTSASASASTSAS 515

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S+ ++     ++  SA+T  + S S  A
Sbjct: 516 ASASTSASESASTSASASASTSASASASTSA 546

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 633  SASASTSASASASTSA-SASASTSTSASASTSASES--ASTSASASASTSASASASTSAS 689

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 690  ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 749

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 750  TSASASASTSASASASTSASASASTSAS 777

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 657  SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 713

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 714  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 773

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 774  TSASESASTSASASASTSASASASTSASA 802

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 745  SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 801

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 802  ASASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASAS 861

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 862  TSASASASTSASASASTSASASASTSASA 890

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 753  SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 809

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 810  ASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 869

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 870  TSASASASTSASASASTSASASASTSASA 898

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 761  SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 817

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 818  ESASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 877

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 878  TSASASASTSASASASTSASASASTSASA 906

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/148 (34%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 769  SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 825

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 826  ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 885

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++     ++  SA+   + STS
Sbjct: 886  TSASASASTSASASASTSASASASASTS 913

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 46/151 (30%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1028 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASESASTSAS 1087

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S  IS +   ST AS+ +S   S S++T +    S     S + +   S +
Sbjct: 1088 ASASTSASASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASAS 1147

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1148 ASTSASASASTSASASASTSASASASTSASA 1178

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/149 (34%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1121 SASTSTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1177

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-GAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S +  A   + 
Sbjct: 1178 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASAS 1237

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1238 TSASASASTSASESASTSASASASTSASA 1266

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/155 (32%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + +++ +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1222 TSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSAS 1281

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1282 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 1341

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1342 TSASASASTSASASASTSASESASTSASASASTSA 1376

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1241 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1297

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1298 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1357

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1358 TSASESASTSASASASTSASASASTSASA 1386

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1289 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 1345

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1346 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 1405

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1406 TSASESASTSASASASTSASASASTSASA 1434

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 46/151 (30%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1546 TSASASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASESASTSAS 1605

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S  IS +   ST AS+ +S   S S++T +    S     S + +   S +
Sbjct: 1606 ASASTSASASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASAS 1665

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1666 ASTSASASASTSASASASTSASASASTSASA 1696

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/149 (34%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1639 SASTSTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1695

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-GAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S +  A   + 
Sbjct: 1696 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASAS 1755

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1756 TSASASASTSASESASTSASASASTSASA 1784

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/155 (32%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + +++ +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1740 TSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSAS 1799

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1800 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 1859

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1860 TSASASASTSASASASTSASESASTSASASASTSA 1894

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1759 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1815

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1816 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1875

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1876 TSASESASTSASASASTSASASASTSASA 1904

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1807 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 1863

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1864 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 1923

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1924 TSASESASTSASASASTSASASASTSASA 1952

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2059 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2115

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2116 VSASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 2175

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2176 TSASASASTSASASASTSASASASTSASA 2204

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 56/153 (36%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2107 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASESASTSAS 2163

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 2164 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAS 2223

Query: 162  TVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            T  ++  S +    TS   SA+T  + S S+ A
Sbjct: 2224 TSASALTSASESASTSASASASTSASASASISA 2256

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/151 (33%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2147 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2203

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+++S   S S++  +   TS  A  S++ +   S +
Sbjct: 2204 ASASTSASESASTSASASASTSASALTSASESASTSASASASTSASASASISASESASTS 2263

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+   + S S  A
Sbjct: 2264 ASASASTSASASASTSTSASESASTSASASA 2294

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/149 (34%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2275 SASTSTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2331

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-GAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S +  A   + 
Sbjct: 2332 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASAS 2391

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2392 TSASASASTSASESASTSASASASTSASA 2420

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/155 (32%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + +++ +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2376 TSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSAS 2435

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2436 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 2495

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2496 TSASASASTSASASASTSASESASTSASASASTSA 2530

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2395 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2451

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2452 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 2511

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2512 TSASESASTSASASASTSASASASTSASA 2540

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2443 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 2499

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2500 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 2559

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2560 TSASESASTSASASASTSASASASTSASA 2588

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/151 (33%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2735 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2791

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+++S   S S++  +   TS  A  S++ +   S +
Sbjct: 2792 ASASTSASESASTSASASASTSASALTSASESASTSASASASTSASASASISASESASTS 2851

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+   + S S  A
Sbjct: 2852 ASASASTSASASASTSTSASESASTSASASA 2882

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/149 (34%), Positives = 85/149 (57%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2863 SASTSTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2919

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVT-GAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S +  A   + 
Sbjct: 2920 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASAS 2979

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2980 TSASASASTSASESASTSASASASTSASA 3008

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/155 (32%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + +++ +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2964 TSASESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSAS 3023

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3024 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 3083

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3084 TSASASASTSASASASTSASESASTSASASASTSA 3118

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2983 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3039

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3040 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 3099

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 3100 TSASESASTSASASASTSASASASTSASA 3128

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3031 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 3087

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3088 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 3147

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 3148 TSASESASTSASASASTSASASASTSASA 3176

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3259 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3315

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 3316 ASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSA--SASASTSASAS 3373

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +  V+ STS  A
Sbjct: 3374 ASTSASASASTSASASASTSASVSASTSASA 3404

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 47/148 (31%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S  T AS+   +STS+S  AST++S   S+S +
Sbjct: 3456 TSASASASTSASESASTSASASASTSASALTSASAS--ASTSASASASTSASASASTSAS 3513

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3514 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASTSASASASTS 3573

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++A    ++  SA+   + S S
Sbjct: 3574 ASESASTSASASASTSASASASTSASAS 3601

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 3529 SASASTSASASASTSASASASTSASASASTSASASTSASASASTSASESASTSASASAST 3588

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 3589 SASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASA 3648

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  + S ST+     S  ++A+  T +++
Sbjct: 3649 SASTSASESASTSASASASTSASASASTSASA 3680

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3655 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3711

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3712 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 3771

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3772 TSASASASTSASASASTSASASASTSASA 3800

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/148 (34%), Positives = 80/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3911 SASASTSASESASTSA-STSASASTSASASASTSASASASTSASESASTSASASASTSAS 3969

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3970 ESASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4029

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 4030 TSASASASTSASASASTSASASASTSAS 4057

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3985 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4041

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 4042 ASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASESASTSASASAS 4101

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 4102 TSASESASTSASVSASTSASASASTSASA 4130

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3993 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4049

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 4050 ASASTSASESASTSASASASTSASESASTSASASASTSASESASTSA--SASASTSASES 4107

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 4108 ASTSASVSASTSASASASTSASASASTSASA 4138

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4001 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4057

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 4058 ESASTSASASASTSASESASTSASASASTSASESASTSASASASTSASESASTSASVSAS 4117

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 4118 TSASASASTSASASASTSASASASTSAS 4145

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 54/149 (36%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 4153 SVSASTSASASASTSA-SESASTSASESASTSASAS--ASTSASASASTSASVSASTSAS 4209

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 4210 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASAS 4269

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 4270 TSASESASTSASESASTSASASASTSASA 4298

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 56/154 (36%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A T AS +A  S+S S   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 471 STSASTSASTSASASASTSASESASTSASVSASTSASASASTSASASASTSASESASTSA 530

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
           +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 531 SASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASA 590

Query: 165 ETVVTSSDSTAFGGGTS-MFSAATGVTCSTSMVA 67
            T  ++S ST+    TS   SA+T  + S S  A
Sbjct: 591 STSASASASTSASASTSASASASTSASESASTSA 624

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 57/154 (37%), Positives = 82/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 483 SASASTSASESASTSASVSASTSASASASTSASASA----STSASESASTSASASASTSA 538

Query: 342 TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
           +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 539 SASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASA 598

Query: 165 ETVVTSSDSTAFGGGTSMF-SAATGVTCSTSMVA 67
            T  ++S S +    TS   SA+T  + S S  A
Sbjct: 599 STSASASTSASASASTSASESASTSASASASTSA 632

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 609  SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSTSASASTSAS 665

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 666  ESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 725

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 726  TSASASASTSASASASTSASASASTSASA 754

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 617  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSTSASASTSASESASTSAS 673

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 674  ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 733

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 734  TSASASASTSASASASTSASASASTSASA 762

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/155 (32%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 638  TSASASASTSASASASTSTSASASTSASESASTSASASASTSASASASTSASASASTSAS 697

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 698  ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 757

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 758  TSASASASTSASASASTSASESASTSASASASTSA 792

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 737  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 793

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 794  ASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASASTSASASAS 853

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 854  TSASASASTSASASASTSASASASTSASA 882

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 50/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AS +  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1087 SASASTSASASASISA-SESASTSASASASTSASASASTSTSASESASTSASASASTSAS 1145

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1146 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1205

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+   + S S  A
Sbjct: 1206 TSASASASTSASASASTSASESASISASASA 1236

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1137 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1193

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   SE+
Sbjct: 1194 ASASTSASASASTSASASASTSASASASTSASESASISASASASTSA--SASASTSASES 1251

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1252 ASTSASASASTSASASASTSASASASTSASA 1282

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1265 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1321

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1322 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 1381

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1382 TSASASASTSASASASTSASASASTSAS 1409

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1281 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1337

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1338 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1397

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1398 TSASASASTSASESASTSASASASTSASA 1426

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 57/154 (37%), Positives = 82/154 (53%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1329 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 1385

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGAG 175
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S      T A 
Sbjct: 1386 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASTSAS 1445

Query: 174  RDSETVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
              + T  ++S ST+    TS   SA+T  + S S
Sbjct: 1446 TSASTSASTSASTSASTSTSASASASTSASASVS 1479

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1361 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1417

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 1418 ASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASAS 1477

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            V  S+ ++     ++  SA+T  + S S  A
Sbjct: 1478 VSASTSASESASTSASASASTSASASASTSA 1508

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 50/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AS +  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1605 SASASTSASASASISA-SESASTSASASASTSASASASTSTSASESASTSASASASTSAS 1663

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1664 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1723

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+   + S S  A
Sbjct: 1724 TSASASASTSASASASTSASESASISASASA 1754

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1655 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1711

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   SE+
Sbjct: 1712 ASASTSASASASTSASASASTSASASASTSASESASISASASASTSA--SASASTSASES 1769

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 1770 ASTSASASASTSASASASTSASASASTSASA 1800

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1783 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1839

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1840 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 1899

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1900 TSASASASTSASASASTSASASASTSAS 1927

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1799 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 1855

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1856 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1915

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1916 TSASASASTSASESASTSASASASTSASA 1944

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 57/154 (37%), Positives = 82/154 (53%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 1847 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 1903

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGAG 175
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S      T A 
Sbjct: 1904 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASTSAS 1963

Query: 174  RDSETVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
              + T  ++S ST+    TS   SA+T  + S S
Sbjct: 1964 TSASTSASTSASTSASTSTSASASASTSASASVS 1997

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1879 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1935

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 1936 ASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASAS 1995

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            V  S+ ++     ++  SA+T  + S S  A
Sbjct: 1996 VSASTSASESASTSASASASTSASASASTSA 2026

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSS-SASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST+  +S SAS   S S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 1977 SASTSTSASASASTSASASVSASTSASESASTSASAS--ASTSASASASTSASESASTSA 2034

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 2035 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASA 2092

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +  V+ STS
Sbjct: 2093 SASTSASASASTSASASASTSASVSASTS 2121

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 57/155 (36%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2075 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASVSASTSASESASTSAS 2131

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2132 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 2191

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2192 TSASASASTSASASASTSASESASTSASASASTSA 2226

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/149 (34%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S L S+S +
Sbjct: 2179 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASALTSASES 2235

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS+S   S ++ +S   S+ +S   S S++  +   TST A +S  T A   + 
Sbjct: 2236 ASTSASASASTSASASASISASESASTSASASASTSASASASTSTSASESASTSASASAS 2295

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2296 TSASASASTSASASASTSASASASTSASA 2324

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 50/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AS +  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2241 SASASTSASASASISA-SESASTSASASASTSASASASTSTSASESASTSASASASTSAS 2299

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2300 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2359

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+   + S S  A
Sbjct: 2360 TSASASASTSASASASTSASESASISASASA 2390

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2291 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2347

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   SE+
Sbjct: 2348 ASASTSASASASTSASASASTSASASASTSASESASISASASASTSA--SASASTSASES 2405

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2406 ASTSASASASTSASASASTSASASASTSASA 2436

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2419 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2475

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2476 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 2535

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2536 TSASASASTSASASASTSASASASTSAS 2563

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2435 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 2491

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2492 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 2551

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2552 TSASASASTSASESASTSASASASTSASA 2580

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 57/154 (37%), Positives = 82/154 (53%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 2483 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 2539

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGAG 175
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S      T A 
Sbjct: 2540 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASTSAS 2599

Query: 174  RDSETVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
              + T  ++S ST+    TS   SA+T  + S S
Sbjct: 2600 TSASTSASTSASTSASTSTSASASASTSASASVS 2633

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2515 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 2571

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 2572 ASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASAS 2631

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            V  S+ ++     ++  SA+T  + S S  A
Sbjct: 2632 VSASTSASESASTSASASASTSASASASTSA 2662

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 50/151 (33%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2547 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASTSASTSAS 2603

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   ST++  S   S+ +S+  S S++  +    S  A  S + +   S +
Sbjct: 2604 TSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSAS 2663

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 2664 ASASTSASVSASTSASESASTSASASASTSA 2694

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 58/153 (37%), Positives = 82/153 (53%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++SV  S+S +
Sbjct: 2679 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASVSASTSAS 2735

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2736 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2795

Query: 162  TVVTSSDST-AFGGGTSMFSAATGVTCSTSMVA 67
            T  + S ST A    ++  SA T  + S S  A
Sbjct: 2796 TSASESASTSASASASTSASALTSASESASTSA 2828

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/149 (34%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S L S+S +
Sbjct: 2767 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASALTSASES 2823

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS+S   S ++ +S   S+ +S   S S++  +   TST A +S  T A   + 
Sbjct: 2824 ASTSASASASTSASASASISASESASTSASASASTSASASASTSTSASESASTSASASAS 2883

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2884 TSASASASTSASASASTSASASASTSASA 2912

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 50/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AS +  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2829 SASASTSASASASISA-SESASTSASASASTSASASASTSTSASESASTSASASASTSAS 2887

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2888 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2947

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+   + S S  A
Sbjct: 2948 TSASASASTSASASASTSASESASISASASA 2978

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2879 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2935

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +   SE+
Sbjct: 2936 ASASTSASASASTSASASASTSASASASTSASESASISASASASTSA--SASASTSASES 2993

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2994 ASTSASASASTSASASASTSASASASTSASA 3024

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 83/148 (56%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3007 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3063

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3064 ESASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 3123

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 3124 TSASASASTSASASASTSASASASTSAS 3151

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3023 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3079

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3080 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 3139

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3140 TSASASASTSASESASTSASASASTSASA 3168

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 57/154 (37%), Positives = 82/154 (53%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3071 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 3127

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-----TGAG 175
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S      T A 
Sbjct: 3128 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASTSAS 3187

Query: 174  RDSETVVTSSDSTAFGGGTS-MFSAATGVTCSTS 76
              + T  ++S ST+    TS   SA+T  + S S
Sbjct: 3188 TSASTSASTSASTSASTSTSASASASTSASASVS 3221

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3103 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3159

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 3160 ASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTSASAS 3219

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            V  S+ ++     ++  SA+T  + S S  A
Sbjct: 3220 VSASTSASESASTSASASASTSASASASTSA 3250

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSS-SASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST+  +S SAS   S S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 3201 SASTSTSASASASTSASASVSASTSASESASTSASAS--ASTSASASASTSASESASTSA 3258

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S 
Sbjct: 3259 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASA 3316

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +  V+ STS
Sbjct: 3317 SASTSASASASTSASASASTSASVSASTS 3345

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3283 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3339

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 3340 VSASTSASESASTSASASASTSASASASTSASASASTSASASAST----SASASASTSAS 3395

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            V  S+ ++A    ++  SA+T  + S S  A
Sbjct: 3396 VSASTSASASASTSASESASTSASASASTSA 3426

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 56/154 (36%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3379 SASASTSASASASTSA-SVSASTSASASASTSASES--ASTSASASASTSASASASTSAS 3435

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  ++T A   + T
Sbjct: 3436 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSA-SALTSASASAST 3494

Query: 159  VVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
              ++S ST+     S     SA+T  + S S  A
Sbjct: 3495 SASASASTSASASASTSASESASTSASASASTSA 3528

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 48/149 (32%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A+T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 3477 SASTSASALTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSA 3536

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS+S   S ++  ST AS+ +S   S S++      TS  A  S + +   S 
Sbjct: 3537 SASASTSASASASTSASASASTSASASTSASASASTSASESASTSASASASTSASASAST 3596

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +   S+ ++A    ++  SA+   + S S
Sbjct: 3597 SASASASTSASASASTSASASASTSASES 3625

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3559 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3615

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3616 ASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 3675

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3676 TSASASASTSASASASTSASASASTSASA 3704

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3567 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3623

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3624 ESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 3683

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3684 TSASASASTSASASASTSASASASTSASA 3712

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3575 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3631

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3632 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 3691

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3692 TSASASASTSASASASTSASASASTSASA 3720

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3607 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3663

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3664 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3723

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 3724 TSASASASTSASASASTSASASASTSAS 3751

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3615 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3671

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3672 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3731

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3732 TSASASASTSASASASTSASESASTSASASASTSA 3766

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3623 SESASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 3679

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3680 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3739

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3740 TSASASASTSASESASTSASASASTSASA 3768

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 53/150 (35%), Positives = 84/150 (56%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3767 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3823

Query: 339  TGVSTGASSSFLIST--TSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST AS+S   ST  ++  ST AS+ +S   SVS++T +    ST A  S + +   S
Sbjct: 3824 ESASTSASTSASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASAS 3883

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             +   S+ ++A    ++  SA+   + S S
Sbjct: 3884 TSASESASTSASASASTSASASASTSASAS 3913

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 56/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3919 SESASTSASTSAS-ASTSASASASTSASASASTSASESASTSASASASTSASESASTSAS 3977

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3978 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4037

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 4038 TSASASASTSASASASTSASESASTSASASASTSA 4072

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 54/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4161 SASASTSASESASTSA-SESASTSASASASTSASAS--ASTSASVSASTSASESASTSAS 4217

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 4218 ASASTSASASASTSASASASTSASASASTSASESASTSASESASTSA--SASASTSASES 4275

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    ++  S +   + STS  A
Sbjct: 4276 ASTSASESASTSASASASTSASASASTSASA 4306

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 51/148 (34%), Positives = 79/148 (53%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S + ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 491 SESASTSASVSASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 547

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 548 ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASTS 607

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              S+ ++A    ++  SA+   + S S
Sbjct: 608 ASASASTSASESASTSASASASTSASAS 635

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 697  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 753

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 754  ASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 813

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 814  TSASESASTSASESASTSASASASTSASA 842

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 50/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AST   S+SAS   S+S +   S+   +STS+S  AS ++S   S+S +
Sbjct: 975  SESASTSASTSAST---SASASASISASESASTSASASASTSASASASISASESASTSAS 1031

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   SVS++T +    ST A +S + +   S +
Sbjct: 1032 ASASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASESASTSASASAS 1091

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+   + S S  A
Sbjct: 1092 TSASASASISASESASTSASASASTSASASA 1122

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1198 TSASASASTSASASASTSASASASTSASESASISASASASTSASASASTSASESASTSAS 1257

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1258 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1317

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1318 TSASESASTSASASASTSASASASTSASA 1346

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1233 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1289

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1290 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1349

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1350 TSASASASTSASESASTSASASASTSASA 1378

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 45/151 (29%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+ST+
Sbjct: 1414 TSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTS 1473

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               S  AS+S   S ++  S  AS+ +S   S S++  +    S  A  S + +   S +
Sbjct: 1474 ASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSAS 1533

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 1534 ASASTSASASASTSASASASTSASASASTSA 1564

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1716 TSASASASTSASASASTSASASASTSASESASISASASASTSASASASTSASESASTSAS 1775

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1776 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1835

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1836 TSASESASTSASASASTSASASASTSASA 1864

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1751 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1807

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1808 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1867

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1868 TSASASASTSASESASTSASASASTSASA 1896

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 45/151 (29%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+ST+
Sbjct: 1932 TSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTS 1991

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               S  AS+S   S ++  S  AS+ +S   S S++  +    S  A  S + +   S +
Sbjct: 1992 ASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSAS 2051

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 2052 ASASTSASASASTSASASASTSASASASTSA 2082

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2003 SESASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2059

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2060 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASVSAS 2119

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2120 TSASESASTSASASASTSASASASTSASA 2148

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2352 TSASASASTSASASASTSASASASTSASESASISASASASTSASASASTSASESASTSAS 2411

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2412 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2471

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2472 TSASESASTSASASASTSASASASTSASA 2500

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2387 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2443

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2444 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 2503

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2504 TSASASASTSASESASTSASASASTSASA 2532

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2940 TSASASASTSASASASTSASASASTSASESASISASASASTSASASASTSASESASTSAS 2999

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3000 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3059

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 3060 TSASESASTSASASASTSASASASTSASA 3088

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2975 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3031

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3032 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 3091

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3092 TSASASASTSASESASTSASASASTSASA 3120

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 45/151 (29%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+ST+   S+   +STS+S  AST++S   S+ST+
Sbjct: 3156 TSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASASASTS 3215

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               S  AS+S   S ++  S  AS+ +S   S S++  +    S  A  S + +   S +
Sbjct: 3216 ASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSAS 3275

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 3276 ASASTSASASASTSASASASTSASASASTSA 3306

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3735 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3791

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +   TS  A  S + +   S +
Sbjct: 3792 ASASTSASASASTSASASASTSASASASTSASESASTSA--STSASASTSASASASTSAS 3849

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + STS  A
Sbjct: 3850 ASASTSASVSASTSASASASTSASASTSASA 3880

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 51/149 (34%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3903 SASASTSASASASTSA-SESASTSASTSASASTSASASASTSASASASTSASESASTSAS 3961

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3962 ASASTSASESASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 4021

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 4022 TSASASASTSASASASTSASASASTSASA 4050

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 52/148 (35%), Positives = 80/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4225 SASASTSASASASTSA-SASASTSASESASTSASES--ASTSASASASTSASESASTSAS 4281

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 4282 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASVS 4341

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++   A+T  + S S
Sbjct: 4342 ASTSASESASTSASASALASTSASASAS 4369

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 729  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 785

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 786  ASASTSASASASTSASASASTSASASASTSASESASTSASESASTSASASASTSASASAS 845

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 846  TSASASASTSASASASTSASASASTSASA 874

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 777  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASESASTSAS 833

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 834  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 891

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 892  ASTSASASASTSASASASASTSASESASTSA 922

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/153 (34%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFAST--TSSVLLSSS 346
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST  ++S   S+S
Sbjct: 849  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 905

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
             +   ST AS S   S ++  ST AS+ +S   S S++T +   TST A  S + +   S
Sbjct: 906  ASASASTSASESASTSASASASTSASASASTSASASASTSASTSTSTSASTSASTSASTS 965

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             +   S+ ++     ++  SA+T  + S S+ A
Sbjct: 966  ASTSASTSASESASTSASTSASTSASASASISA 998

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1273 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1329

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1330 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1389

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1390 TSASASASTSASASASTSASESASTSASASASTSA 1424

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1313 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1369

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1370 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 1429

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1430 TSASASASTSASTSASTSASTSASTSASTSA 1460

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 51/148 (34%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1501 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1557

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 1558 ASASTSASASASTSASASASTSASVSASTSASESASTSASESASTSASASASTSASASAS 1617

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  S  ++     ++  SA+   + STS
Sbjct: 1618 ISASESASTSASASASTSASASASTSTS 1645

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1791 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1847

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1848 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 1907

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1908 TSASASASTSASASASTSASESASTSASASASTSA 1942

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1831 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 1887

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1888 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 1947

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1948 TSASASASTSASTSASTSASTSASTSASTSA 1978

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2035 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2091

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2092 ASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASAS 2151

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2152 TSASESASTSASASASTSASASASTSASA 2180

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2427 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 2483

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2484 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 2543

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2544 TSASASASTSASASASTSASESASTSASASASTSA 2578

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2467 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 2523

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2524 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 2583

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 2584 TSASASASTSASTSASTSASTSASTSASTSA 2614

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 51/151 (33%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2539 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2595

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST  S+ +S   S S++  +    S  A  S + +   S +
Sbjct: 2596 TSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSAS 2655

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 2656 ASASTSASASASTSASVSASTSASESASTSA 2686

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/156 (33%), Positives = 82/156 (52%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTA-GFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A T AST+   S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 2603 STSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSASASASTSA 2662

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTST----GA*DSVTGAG 175
            +   ST AS S   S +   ST AS+ +S   S S++T +    ST     A  S + + 
Sbjct: 2663 SASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASA 2722

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S +V  S+ ++A    ++  SA+T  + S S  A
Sbjct: 2723 STSASVSASTSASASASTSASESASTSASASASTSA 2758

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2644 TSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSAS 2703

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2704 ASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASASAS 2763

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2764 TSASASASTSASASASTSASASASTSASA 2792

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3015 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3071

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3072 ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 3131

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3132 TSASASASTSASASASTSASESASTSASASASTSA 3166

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 52/151 (34%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3055 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3111

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3112 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 3171

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3172 TSASASASTSASTSASTSASTSASTSASTSA 3202

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3312 TSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSAS 3371

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3372 ASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASASAS 3431

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3432 TSASASASTSASASASTSASASASTSASA 3460

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 45/148 (30%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3368 TSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSAS 3427

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST    S + +   S +
Sbjct: 3428 ASASTSASASASTSASASASTSASASASTSASASASTSASESAST----SASASASTSAS 3483

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             +TS+ ++A    ++  S +   + STS
Sbjct: 3484 ALTSASASASTSASASASTSASASASTS 3511

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 50/151 (33%), Positives = 79/151 (52%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   + TS+S  AST++S   S+
Sbjct: 3443 SASASTSASASASTSASASASTSASESASTSASASASTSASALTSASASASTSASASAST 3502

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   
Sbjct: 3503 SASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA 3562

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            S +   S+ ++A    ++  SA+   + S S
Sbjct: 3563 STSASASASTSASESASTSASASASTSASAS 3593

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/150 (35%), Positives = 84/150 (56%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3759 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3815

Query: 339  TGVSTGA--SSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST A  S+S   ST++  ST AS+ +S   S S++T + V  ST A  S + +   S
Sbjct: 3816 ASASTSASESASTSASTSASASTSASASASTSASASASTSASVSASTSASASASTSASAS 3875

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             +   S+ ++A    ++  SA+   + S S
Sbjct: 3876 TSASASASTSASESASTSASASASTSASAS 3905

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 51/148 (34%), Positives = 78/148 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A T AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3823 SESASTSASTSAS-ASTSASASASTSASASASTSASVSASTSASASASTSASA--STSAS 3879

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 3880 ASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASTSASASTSASAS 3939

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    +   S +   + STS
Sbjct: 3940 ASTSASASASTSASESASTSASASASTS 3967

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 3937 SASASTSASASASTSA-SESASTSASASASTSASES--ASTSASESASTSASASASTSAS 3993

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3994 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4053

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  + S ST+     S     SA+T  + S S  A
Sbjct: 4054 TSASESASTSASASASTSASESASTSASASASTSA 4088

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 54/148 (36%), Positives = 80/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4025 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASESASTSAS 4081

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   SVS++T +    ST A  S  T A   + 
Sbjct: 4082 ASASTSASESASTSASASASTSASESASTSASVSASTSASASASTSASASASTSASASAS 4141

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  + S ST+     S  ++A+  T ++
Sbjct: 4142 TSASESASTSASVSASTSASASASTSAS 4169

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 51/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 4109 STSASVSASTSASASASTSASASASTSASASASTSASESASTSASVSASTSASASASTSA 4168

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSE 163
            +   ST AS S   S ++  ST AS+ +S   SVS++T +    ST A  S + +   S 
Sbjct: 4169 SESASTSASESASTSASASASTSASASASTSASVSASTSASESASTSA--SASASTSASA 4226

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  TS+ ++A    ++  S +   + STS
Sbjct: 4227 SASTSASASASTSASASASTSASESASTS 4255

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 689  SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 745

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 746  ASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAS 805

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 806  TSASASASTSASESASTSASESASTSASASASTSA 840

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 49/155 (31%), Positives = 84/155 (54%), Gaps = 3/155 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST- 343
            +SA  + + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+ST 
Sbjct: 1076 TSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSTSASESASTS 1135

Query: 342  -TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 1136 ASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASAS 1195

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
            + T  ++S ST+     S  ++A+  T ++   +I
Sbjct: 1196 ASTSASASASTSASASASTSASASASTSASESASI 1230

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S S +
Sbjct: 1177 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASISAS 1233

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1234 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 1293

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1294 TSASASASTSASASASTSASASASTSAS 1321

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 49/155 (31%), Positives = 84/155 (54%), Gaps = 3/155 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST- 343
            +SA  + + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+ST 
Sbjct: 1594 TSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSTSASESASTS 1653

Query: 342  -TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 1654 ASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASAS 1713

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
            + T  ++S ST+     S  ++A+  T ++   +I
Sbjct: 1714 ASTSASASASTSASASASTSASASASTSASESASI 1748

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S S +
Sbjct: 1695 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASISAS 1751

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1752 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 1811

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 1812 TSASASASTSASASASTSASASASTSAS 1839

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/150 (34%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 1991 SASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSA 2050

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 2051 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 2110

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  + S ST+     S  ++A+  T +++
Sbjct: 2111 STSASVSASTSASESASTSASASASTSASA 2140

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 50/148 (33%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2131 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2187

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +  +TS     S + +   S +
Sbjct: 2188 ASASTSASASASTSASASASTSASESASTSASASASTSASALTSASESASTSASASASTS 2247

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+  +A    ++  SA+   + S S
Sbjct: 2248 ASASASISASESASTSASASASTSASAS 2275

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 49/155 (31%), Positives = 84/155 (54%), Gaps = 3/155 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST- 343
            +SA  + + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+ST 
Sbjct: 2230 TSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSTSASESASTS 2289

Query: 342  -TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 2290 ASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASAS 2349

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
            + T  ++S ST+     S  ++A+  T ++   +I
Sbjct: 2350 ASTSASASASTSASASASTSASASASTSASESASI 2384

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S S +
Sbjct: 2331 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASISAS 2387

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2388 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 2447

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 2448 TSASASASTSASASASTSASASASTSAS 2475

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2663 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2719

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2720 ASASTSASVSASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 2779

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2780 TSASASASTSASASASTSASESASTSASASASTSA 2814

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/161 (31%), Positives = 85/161 (52%), Gaps = 10/161 (6%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2700 TSASASASTSASASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSAS 2759

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DS-------VTG 181
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S       +T 
Sbjct: 2760 ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASALTS 2819

Query: 180  AGRDSETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            A   + T  ++S ST+     S+    SA+T  + S S  A
Sbjct: 2820 ASESASTSASASASTSASASASISASESASTSASASASTSA 2860

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 50/148 (33%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2719 SASASTSASVSASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 2775

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +S   S S++T +  +TS     S + +   S +
Sbjct: 2776 ASASTSASASASTSASASASTSASESASTSASASASTSASALTSASESASTSASASASTS 2835

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+  +A    ++  SA+   + S S
Sbjct: 2836 ASASASISASESASTSASASASTSASAS 2863

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 49/155 (31%), Positives = 84/155 (54%), Gaps = 3/155 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST- 343
            +SA  + + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+ST 
Sbjct: 2818 TSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSTSASESASTS 2877

Query: 342  -TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 2878 ASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASAS 2937

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
            + T  ++S ST+     S  ++A+  T ++   +I
Sbjct: 2938 ASTSASASASTSASASASTSASASASTSASESASI 2972

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S S +
Sbjct: 2919 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASISAS 2975

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2976 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 3035

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 3036 TSASASASTSASASASTSASASASTSAS 3063

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/150 (34%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 3215 SASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSA 3274

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3275 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 3334

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  + S ST+     S  ++A+  T +++
Sbjct: 3335 STSASVSASTSASESASTSASASASTSASA 3364

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3331 SASASTSASVSASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3387

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3388 ASASTSASVSASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 3447

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3448 TSASASASTSASASASTSASESASTSASASASTSA 3482

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 55/156 (35%), Positives = 80/156 (51%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +S S+S  A T++S   S+
Sbjct: 3435 SASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASALTSASASAST 3494

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 3495 SASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASA 3554

Query: 171  DSETVVTSSDSTAFGGGTSMF-SAATGVTCSTSMVA 67
             + T  ++S S +    TS   SA+T  + S S  A
Sbjct: 3555 SASTSASASTSASASASTSASESASTSASASASTSA 3590

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/154 (33%), Positives = 79/154 (51%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   +STS+S  AST++S   S+
Sbjct: 3833 SASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSASESAST 3892

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRD 169
            S +   ST AS+S   S ++  ST AS  +S   S S++  +    S     S + +   
Sbjct: 3893 SASASASTSASASASTSASASASTSASESASTSASTSASASTSASASASTSASASASTSA 3952

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            SE+  TS+ ++A    +   S +   + STS  A
Sbjct: 3953 SESASTSASASASTSASESASTSASESASTSASA 3986

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 54/156 (34%), Positives = 83/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 3849 SASASTSASVSASTSASASASTSASASTSASASASTSASESASTSASASASTSASASAST 3908

Query: 348  STTTGVSTGA--SSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG 175
            S +   ST A  S+S   ST++  ST AS+ +S   S S++T +    ST A  S + + 
Sbjct: 3909 SASASASTSASESASTSASTSASASTSASASASTSASASASTSASESASTSA--SASAST 3966

Query: 174  RDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              SE+  TS+  +A    ++  S +   + STS  A
Sbjct: 3967 SASESASTSASESASTSASASASTSASASASTSASA 4002

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3929 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASESASTSASESASTSAS 3985

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3986 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 4045

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 4046 TSASASASTSASESASTSASASASTSAS 4073

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 53/148 (35%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4009 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 4065

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS  +S   S S++T +    ST A  SV+ +   S +
Sbjct: 4066 ASASTSASESASTSASASASTSASESASTSASASASTSASESASTSA--SVSASTSASAS 4123

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 4124 ASTSASASASTSASASASTSASESASTS 4151

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4209 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASESASTSAS 4265

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 4266 ASASTSASESASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASAS 4323

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  SA+T  + S S  A
Sbjct: 4324 ASTSASASASTSASASVSASTSASESASTSA 4354

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 52/151 (34%), Positives = 84/151 (55%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 515 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 571

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S + +   S +
Sbjct: 572 ESASTSASASASTSASASASTSASASAST--SASASTSASASASTSASESASTSASASAS 629

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              S+ ++     ++  SA+   + STS  A
Sbjct: 630 TSASASASTSASASASTSASASASTSTSASA 660

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 50/148 (33%), Positives = 79/148 (53%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 523 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 579

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS+ +S   S S++      TS  A  S + +   S +
Sbjct: 580 ASASTSASASASTSASASASTSASASTSASASASTSASESASTSASASASTSASASASTS 639

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              S+ ++A    ++  SA+   + S S
Sbjct: 640 ASASASTSASASASTSTSASASTSASES 667

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 48/149 (32%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 576  TSASASASTSASASASTSASASASTSASASTSASAS--ASTSASESASTSASASASTSAS 633

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST  S+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 634  ASASTSASASASTSASASASTSTSASASTSASESASTSASASASTSASASASTSASASAS 693

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 694  TSASESASTSASASASTSASASASTSASA 722

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 52/148 (35%), Positives = 82/148 (55%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 681  SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 737

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 738  ASASTSASASASTSASASASTSASASASTSASASASTSASESASTSA--SASASTSASAS 795

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++A    ++  S +   + STS
Sbjct: 796  ASTSASASASTSASASASTSASESASTS 823

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/151 (35%), Positives = 83/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 809  SASASTSASESASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 865

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S + +   S +
Sbjct: 866  ASASTSASASASTSASASASTSASASASTSASASASTSA--SASASASTSASESASTSAS 923

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + STS  A
Sbjct: 924  ASASTSASASASTSASASASTSASTSTSTSA 954

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 56/154 (36%), Positives = 85/154 (55%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 817  SESASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 873

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               ST AS+S   S ++  ST AS+ +S   S S   ST+ S   +++ +  + T A   
Sbjct: 874  ASASTSASASASTSASASASTSASASASTSASASASASTSASESASTSASASASTSASAS 933

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            + T  ++S ST+    TS  SA+T  + S S  A
Sbjct: 934  ASTSASASASTSASTSTST-SASTSASTSASTSA 966

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/153 (34%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 841  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 897

Query: 339  TGVSTGASSSFLISTTS--GVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
               ST AS+S   ST++    ST AS+ +S   S S++T +    ST A  S + +   S
Sbjct: 898  ASASTSASASASASTSASESASTSASASASTSASASASTSASASASTSASTSTSTSASTS 957

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             +   S+ ++     ++  SA+T  + S S  A
Sbjct: 958  ASTSASTSASTSASTSASESASTSASTSASTSA 990

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 50/149 (33%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 915  SESASTSASASASTSASASASTSASASASTSASTSTSTSASTSASTSASTSASTSASTSA 974

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  S  AS  +S   S S++T +    S  A +S  T A   +
Sbjct: 975  SESASTSASTSASTSASASASISASESASTSASASASTSASASASISASESASTSASASA 1034

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 1035 STSASASASTSASASASTSASASASTSAS 1063

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 48/151 (31%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ +++ + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 988  TSASASASISASESASTSASASASTSASASASISASESASTSASASASTSASASASTSAS 1047

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 1048 ASASTSASASASTSASVSASTSASESASTSASESASTSASASASTSA--SASASISASES 1105

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +T  + S S  A
Sbjct: 1106 ASTSASASASTSASASASTSTSASESASTSA 1136

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 50/148 (33%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1103 SESASTSASASASTSA-SASASTSTSASESASTSASASASTSASASASTSASASASTSAS 1161

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1162 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 1219

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 1220 ASTSASESASISASASASTSASASASTS 1247

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1169 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1225

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1226 ESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1285

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1286 TSASASASTSASASASTSASASASTSASA 1314

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 50/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1385 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1441

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST  S+ +S   S S++  +    S  A  S + +   S +
Sbjct: 1442 TSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSAS 1501

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 1502 ASASTSASESASTSASASASTSASASASTSA 1532

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1409 SESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASA 1468

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   S  AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1469 SASTSASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASA 1528

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 1529 STSASASASTSASASASTSASASASTSASA 1558

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 49/153 (32%), Positives = 84/153 (54%), Gaps = 1/153 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +S  ++ +V+ +++A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S +
Sbjct: 1470 ASTSASASVSASTSASESASTSASASASTSASASA----STSASESASTSASASASTSAS 1525

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1526 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASVSAS 1585

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
            T  + S ST+     S  ++A+  T +++  +I
Sbjct: 1586 TSASESASTSASESASTSASASASTSASASASI 1618

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 50/148 (33%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1621 SESASTSASASASTSA-SASASTSTSASESASTSASASASTSASASASTSASASASTSAS 1679

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 1680 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 1737

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 1738 ASTSASESASISASASASTSASASASTS 1765

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1687 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1743

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 1744 ESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1803

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1804 TSASASASTSASASASTSASASASTSASA 1832

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 50/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1903 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 1959

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST  S+ +S   S S++  +    S  A  S + +   S +
Sbjct: 1960 TSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSAS 2019

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 2020 ASASTSASESASTSASASASTSASASASTSA 2050

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 1927 SESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASA 1986

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   S  AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1987 SASTSASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASA 2046

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 2047 STSASASASTSASASASTSASASASTSASA 2076

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 51/153 (33%), Positives = 81/153 (52%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2088 TSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSAS 2147

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2148 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2207

Query: 162  TVVTSSDST-AFGGGTSMFSAATGVTCSTSMVA 67
            T  + S ST A    ++  SA T  + S S  A
Sbjct: 2208 TSASESASTSASASASTSASALTSASESASTSA 2240

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 55/162 (33%), Positives = 84/162 (51%), Gaps = 11/162 (6%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S 
Sbjct: 2111 STSASVSASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSA 2170

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DS-------VT 184
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S       +T
Sbjct: 2171 SASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASALT 2230

Query: 183  GAGRDSETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
             A   + T  ++S ST+     S+    SA+T  + S S  A
Sbjct: 2231 SASESASTSASASASTSASASASISASESASTSASASASTSA 2272

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A+T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+ST
Sbjct: 2221 SASTSASALTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTST 2280

Query: 342  TT--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            +     ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 2281 SASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA 2340

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 2341 SASTSASASASTSASASASTSASASASTSASA 2372

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 50/148 (33%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2257 SESASTSASASASTSA-SASASTSTSASESASTSASASASTSASASASTSASASASTSAS 2315

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2316 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 2373

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 2374 ASTSASESASISASASASTSASASASTS 2401

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2323 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2379

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2380 ESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 2439

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2440 TSASASASTSASASASTSASASASTSASA 2468

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/149 (35%), Positives = 80/149 (53%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 2655 SASASTSASASASTSASVSASTSASESASTSASASA----STSASASASTSASASASTSA 2710

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 2711 SASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASASASTSASASA 2770

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 2771 STSASASASTSASASASTSASASASTSAS 2799

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEAS-TAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ S  A+T AS +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+ST
Sbjct: 2809 SASTSASALTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTST 2868

Query: 342  TT--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            +     ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A  
Sbjct: 2869 SASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA 2928

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 2929 SASTSASASASTSASASASTSASASASTSASA 2960

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 50/148 (33%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 2845 SESASTSASASASTSA-SASASTSTSASESASTSASASASTSASASASTSASASASTSAS 2903

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 2904 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA--SASASTSASAS 2961

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 2962 ASTSASESASISASASASTSASASASTS 2989

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2911 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2967

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S  AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 2968 ESASISASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 3027

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3028 TSASASASTSASASASTSASASASTSASA 3056

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 50/151 (33%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3127 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3183

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  ST  S+ +S   S S++  +    S  A  S + +   S +
Sbjct: 3184 TSASTSASTSASTSASTSASTSTSASASASTSASASVSASTSASESASTSASASASTSAS 3243

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++     ++  SA+T  + S S  A
Sbjct: 3244 ASASTSASESASTSASASASTSASASASTSA 3274

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S + ST A   AST A  S+S S   S+ST+   S+   +STS+S  AST++S   S+S 
Sbjct: 3151 SESASTSASASASTSASASASTSASASASTSASTSASTSASTSASTSASTSASTSTSASA 3210

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   S  AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3211 SASTSASASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASA 3270

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 3271 STSASASASTSASASASTSASASASTSASA 3300

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/148 (35%), Positives = 81/148 (54%), Gaps = 1/148 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3267 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3323

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3324 ASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASAS 3383

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCST 79
            T  ++S ST+     S  ++A+  T ++
Sbjct: 3384 TSASASASTSASVSASTSASASASTSAS 3411

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/149 (35%), Positives = 80/149 (53%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 3323 SASASTSASASASTSASVSASTSASESASTSASASA----STSASASASTSASASASTSA 3378

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 3379 SASASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASASASTSASASA 3438

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 3439 STSASASASTSASASASTSASASASTSAS 3467

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/149 (35%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3411 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3467

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++   T AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 3468 ESASTSASAS--ASTSASALTSASASASTSASASASTSASASASTSASESASTSASASAS 3525

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3526 TSASASASTSASASASTSASASASTSASA 3554

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 54/149 (36%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 3505 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASA--SASTS 3559

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3560 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAS 3619

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 3620 TSASESASTSASASASTSASASASTSASA 3648

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 54/151 (35%), Positives = 84/151 (55%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTS--SVLLSSS 346
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++  S   S+S
Sbjct: 3871 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3927

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
            T+   ST AS+S   S ++  ST AS  +S   S S++T +    ST A +S  T A   
Sbjct: 3928 TSASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASESASTSASAS 3987

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 3988 ASTSASASASTSASASASTSASASASTSASA 4018

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 2/150 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 4185 SASASTSASASASTSASVSASTSASESASTSASASA----STSASASASTSASASASTSA 4240

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 4241 SASASTSASESASTSASESASTSASASASTSASESASTSASESASTSASASASTSASASA 4300

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             T  ++S ST+     S  ++A+  T +++
Sbjct: 4301 STSASASASTSASASASTSASASASTSASA 4330

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 58/155 (37%), Positives = 85/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 531 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 587

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
              ST AS+S   ST++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 588 ASASTSASAS--ASTSASASTSASASASTSASESASTSASASASTSASASASTSASASAS 645

Query: 162 TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
           T  ++S ST+     S     SA+T  + S S  A
Sbjct: 646 TSASASASTSTSASASTSASESASTSASASASTSA 680

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 547 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASA--SASTS 601

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S + +   S +
Sbjct: 602 ASASTSASASASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSTSAS 659

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             TS+  +A    ++  S +   + STS  A
Sbjct: 660 ASTSASESASTSASASASTSASASASTSASA 690

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST     AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 649  SASASTSTSASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASESASTSAS 705

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 706  ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 765

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 766  TSASASASTSASESASTSASASASTSASA 794

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 55/154 (35%), Positives = 84/154 (54%), Gaps = 3/154 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 825  SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 881

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               ST AS+S   S ++  ST AS+ +S   S S   ST+ S   +++ +  + T A   
Sbjct: 882  ASASTSASASASTSASASASTSASASASASTSASESASTSASASASTSASASASTSASAS 941

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            + T  ++S ST+     S  SA+T  + S S  A
Sbjct: 942  ASTSASTSTSTSASTSAST-SASTSASTSASTSA 974

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 51/153 (33%), Positives = 82/153 (53%), Gaps = 2/153 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 881  SASASTSASASASTSA-SASASTSASASASASTSASESASTSASASASTSASASASTSAS 939

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAG--RDS 166
               ST AS+S   S ++  ST AS+ +S   S S++  +    ST A  S + +     S
Sbjct: 940  ASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISAS 999

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            E+  TS+ ++A    ++  S +   + STS  A
Sbjct: 1000 ESASTSASASASTSASASASISASESASTSASA 1032

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1153 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1209

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   S  AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1210 ASASTSASASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASAS 1269

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1270 TSASASASTSASASASTSASASASTSASA 1298

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 54/151 (35%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1509 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1565

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 1566 ASASTSASASASTSASVSASTSASESASTSASESASTSASASASTSA--SASASISASES 1623

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +T  + S S  A
Sbjct: 1624 ASTSASASASTSASASASTSTSASESASTSA 1654

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1671 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1727

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   S  AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1728 ASASTSASASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASAS 1787

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1788 TSASASASTSASASASTSASASASTSASA 1816

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2307 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2363

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   S  AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2364 ASASTSASASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASAS 2423

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2424 TSASASASTSASASASTSASASASTSASA 2452

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2895 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2951

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   S  AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2952 ASASTSASASASTSASESASISASASASTSASASASTSASESASTSASASASTSASASAS 3011

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3012 TSASASASTSASASASTSASASASTSASA 3040

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 58/155 (37%), Positives = 85/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+ST+
Sbjct: 3419 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASE--SASTS 3473

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               S   S+S L S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3474 ASASASTSASALTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAS 3533

Query: 162  TVVTSSDSTAFGGGTS---MFSAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + STS  A
Sbjct: 3534 TSASASASTSASASASTSASASASTSASASTSASA 3568

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 58/155 (37%), Positives = 84/155 (54%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3489 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASASASTSASASASTSAS 3545

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   ST++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3546 ASASTSASAS--ASTSASASTSASASASTSASESASTSASASASTSASASASTSASASAS 3603

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3604 TSASASASTSASASASTSASESASTSASASASTSA 3638

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 55/155 (35%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3751 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3807

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               ST AS+S   S +   ST AS+ +S   S S   ST+ S   +++ +  + T A   
Sbjct: 3808 ASASTSASASASTSASESASTSASTSASASTSASASASTSASASASTSASVSASTSASAS 3867

Query: 168  SETVVTSSDSTAFGGGTSMF-SAATGVTCSTSMVA 67
            + T  ++S S +    TS   SA+T  + S S  A
Sbjct: 3868 ASTSASASTSASASASTSASESASTSASASASTSA 3902

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/151 (34%), Positives = 83/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ S  A T AS A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 3861 STSASASASTSAS-ASTSASASASTSASESASTSASASASTSASASASTSASASASTSAS 3919

Query: 339  TGVSTGASSSFLIST--TSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
               ST AS+S   ST  ++  ST AS+ +S   S S++T +    ST A +S  T A   
Sbjct: 3920 ESASTSASTSASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASES 3979

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 3980 ASTSASASASTSASASASTSASASASTSASA 4010

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 53/148 (35%), Positives = 80/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4033 SASASTSASASASTSA-SASASTSASESASTSASAS--ASTSASESASTSASASASTSAS 4089

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS  +S   S S++T +    ST A  S + +   SE+
Sbjct: 4090 ESASTSASASASTSASESASTSASVSASTSASASASTSASASASTSA--SASASTSASES 4147

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 4148 ASTSASVSASTSASASASTSASESASTS 4175

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 54/151 (35%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4049 SASASTSASESASTSA-SASASTSASESASTSASAS--ASTSASESASTSASASASTSAS 4105

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  SV+ +   S +
Sbjct: 4106 ESASTSASVSASTSASASASTSASASASTSASASASTSASESASTSA--SVSASTSASAS 4163

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+  +A    +   S +   + STS  A
Sbjct: 4164 ASTSASESASTSASESASTSASASASTSASA 4194

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 57/155 (36%), Positives = 80/155 (51%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4073 SESASTSASASASTSA-SESASTSASASASTSASES--ASTSASVSASTSASASASTSAS 4129

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S +   ST AS  +S   S S++T +    ST A +S  T A   + 
Sbjct: 4130 ASASTSASASASTSASESASTSASVSASTSASASASTSASESASTSASESASTSASASAS 4189

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 4190 TSASASASTSASVSASTSASESASTSASASASTSA 4224

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1129 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1185

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S  T A   + 
Sbjct: 1186 ASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASASTSASASAS 1245

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1246 TSASESASTSASASASTSASASASTSASA 1274

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/155 (32%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AS ++S   S+S +
Sbjct: 1182 TSASASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASASTSAS 1241

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1242 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1301

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1302 TSASASASTSASASASTSASESASTSASASASTSA 1336

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +S S+S  AST++S   S+S +
Sbjct: 1193 SASASTSASASASTSA-SASASTSASASASTSASES--ASISASASASTSASASASTSAS 1249

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1250 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1309

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1310 TSASASASTSASESASTSASASASTSASA 1338

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 55/152 (36%), Positives = 80/152 (52%), Gaps = 1/152 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1517 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1573

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS  +S   S S++T +    S  A +S  T A   + 
Sbjct: 1574 ASASTSASVSASTSASESASTSASESASTSASASASTSASASASISASESASTSASASAS 1633

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
            T  ++S ST+     S  S +   + STS  A
Sbjct: 1634 TSASASASTSTSASESA-STSASASASTSASA 1664

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 1647 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 1703

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S  T A   + 
Sbjct: 1704 ASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASASTSASASAS 1763

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 1764 TSASESASTSASASASTSASASASTSASA 1792

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/155 (32%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AS ++S   S+S +
Sbjct: 1700 TSASASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASASTSAS 1759

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1760 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1819

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 1820 TSASASASTSASASASTSASESASTSASASASTSA 1854

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +S S+S  AST++S   S+S +
Sbjct: 1711 SASASTSASASASTSA-SASASTSASASASTSASES--ASISASASASTSASASASTSAS 1767

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 1768 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 1827

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 1828 TSASASASTSASESASTSASASASTSASA 1856

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2283 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2339

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S  T A   + 
Sbjct: 2340 ASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASASTSASASAS 2399

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2400 TSASESASTSASASASTSASASASTSASA 2428

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/155 (32%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AS ++S   S+S +
Sbjct: 2336 TSASASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASASTSAS 2395

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2396 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2455

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2456 TSASASASTSASASASTSASESASTSASASASTSA 2490

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +S S+S  AST++S   S+S +
Sbjct: 2347 SASASTSASASASTSA-SASASTSASASASTSASES--ASISASASASTSASASASTSAS 2403

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2404 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2463

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 2464 TSASASASTSASESASTSASASASTSASA 2492

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/149 (34%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2871 SESASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2927

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    S  A  S  T A   + 
Sbjct: 2928 ASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASASTSASASAS 2987

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 2988 TSASESASTSASASASTSASASASTSASA 3016

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/155 (32%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AS ++S   S+S +
Sbjct: 2924 TSASASASTSASASASTSASASASTSASASASTSASASASTSASESASISASASASTSAS 2983

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2984 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3043

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3044 TSASASASTSASASASTSASESASTSASASASTSA 3078

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS    +S S+S  AST++S   S+S +
Sbjct: 2935 SASASTSASASASTSA-SASASTSASASASTSASES--ASISASASASTSASASASTSAS 2991

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2992 ESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3051

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3052 TSASASASTSASESASTSASASASTSASA 3080

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/151 (34%), Positives = 82/151 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3743 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3799

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS  +    S S++T +   TS  A  S + +   S +
Sbjct: 3800 ASASTSASASASTSASASASTSASESA----STSASTSASASTSASASASTSASASASTS 3855

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 3856 ASVSASTSASASASTSASASTSASASASTSA 3886

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 53/149 (35%), Positives = 83/149 (55%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTS--SVLLSSS 346
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++  S   S+S
Sbjct: 3775 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASESASTSAS 3831

Query: 345  TTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDS 166
            T+   ST AS+S   S ++  ST AS  +S   S S++T +   TS  A  + T A   +
Sbjct: 3832 TSASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASA-SASTSASESA 3890

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  ++S ST+     S  ++A+  T ++
Sbjct: 3891 STSASASASTSASASASTSASASASTSAS 3919

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4041 SASASTSASASASTSA-SESASTSASASASTSASES--ASTSASASASTSASESASTSAS 4097

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A +S  T A   + 
Sbjct: 4098 ASASTSASESASTSASVSASTSASASASTSASASASTSASASASTSASESASTSASVSAS 4157

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 4158 TSASASASTSASESASTSASESASTSASASASTSA 4192

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 53/148 (35%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 4137 SASASTSASESASTSA-SVSASTSASASASTSASES--ASTSASESASTSASASASTSAS 4193

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S + +   SE+
Sbjct: 4194 ASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSA--SASASTSASES 4251

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 4252 ASTSASESASTSASASASTSASESASTS 4279

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 49/151 (32%), Positives = 77/151 (50%), Gaps = 1/151 (0%)
 Frame = -1

Query: 516  SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
            SA  + + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S + 
Sbjct: 997  SASESASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASA 1056

Query: 336  GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSET 160
              ST AS S   S +   ST AS  +S   S S++T +    S  A +S  T A   + T
Sbjct: 1057 SASTSASVSASTSASESASTSASESASTSASASASTSASASASISASESASTSASASAST 1116

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              ++S ST+     S  S +   + STS  A
Sbjct: 1117 SASASASTSTSASESA-STSASASASTSASA 1146

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 4/152 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGF---SSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S + ST A   AST+     S+SAS   S+S +   S+   +STS+S  AST++S   S+
Sbjct: 3467 SESASTSASASASTSASALTSASASASTSASASASTSASASASTSASESASTSASASAST 3526

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGR 172
            S +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A +S  T A  
Sbjct: 3527 SASASASTSASASASTSASASASTSASASAST--SASASTSASASASTSASESASTSASA 3584

Query: 171  DSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             + T  ++S ST+     S  ++A+  T +++
Sbjct: 3585 SASTSASASASTSASASASTSASASASTSASA 3616

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 52/151 (34%), Positives = 81/151 (53%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ST A   AST+  S+SAS   S+S +T AS    +STS+S  AST++S   S+S +
Sbjct: 539 SASASTSASASASTSA-SASASTSASASASTSASES--ASTSASASASTSASASASTSAS 595

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
              ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S + +   S +
Sbjct: 596 ASASTSASAS--TSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 653

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
             TS+ ++     ++  SA+   + S S  A
Sbjct: 654 TSTSASASTSASESASTSASASASTSASASA 684

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 54/162 (33%), Positives = 83/162 (51%), Gaps = 10/162 (6%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSV------ 361
            S++ ST A T  ST A  S+S S   S+ST+   S+   +STS+S  AST++S       
Sbjct: 939  SASASTSASTSTSTSASTSASTSASTSASTSASTSASESASTSASTSASTSASASASISA 998

Query: 360  --LLSSSTTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV 187
                S+S +   ST AS+S  IS +   ST AS+ +S   S S++T +    ST A  S 
Sbjct: 999  SESASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASA 1058

Query: 186  -TGAGRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTSMVAI 64
             T A   + T  + S ST+     S  ++A+  T +++  +I
Sbjct: 1059 STSASVSASTSASESASTSASESASTSASASASTSASASASI 1100

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/151 (31%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+ST+
Sbjct: 1068 TSASESASTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSTS 1127

Query: 339  T--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
                 ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 1128 ASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASAS 1187

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 1188 ASTSASASASTSASASASTSASASASTSASA 1218

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 57/156 (36%), Positives = 82/156 (52%), Gaps = 5/156 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSS-SASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST+  +S SAS   S S +T AS+   +STS+S  AST++S   S+S 
Sbjct: 1459 SASTSTSASASASTSASASVSASTSASESASTSASAS--ASTSASASASTSASESASTSA 1516

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   +
Sbjct: 1517 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 1576

Query: 165  ETVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
             T  + S ST+     S     SA+T  + S S  A
Sbjct: 1577 STSASVSASTSASESASTSASESASTSASASASTSA 1612

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/151 (31%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA  + + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+ST+
Sbjct: 1586 TSASESASTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSTS 1645

Query: 339  T--GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
                 ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 1646 ASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASAS 1705

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 1706 ASTSASASASTSASASASTSASASASTSASA 1736

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 52/155 (33%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +S  ++ +V+ +++A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S +
Sbjct: 1988 ASTSASASVSASTSASESASTSASASASTSASASA----STSASESASTSASASASTSAS 2043

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 2044 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2103

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 2104 TSASASASTSASVSASTSASESASTSASASASTSA 2138

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 52/155 (33%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +S  ++ +V+ +++A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S +
Sbjct: 3212 ASTSASASVSASTSASESASTSASASASTSASASA----STSASESASTSASASASTSAS 3267

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 3268 ASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3327

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 3328 TSASASASTSASVSASTSASESASTSASASASTSA 3362

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 44/148 (29%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +  AS+   +S S+S  AST++S   S+S +
Sbjct: 3828 TSASTSASASTSASASASTSASASASTSASVSASTSASASASTSASASTSASASASTSAS 3887

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++  ST AS+ +S   S S++T +    S     S + +   S +
Sbjct: 3888 ESASTSASASASTSASASASTSASASASTSASESASTSASTSASASTSASASASTSASAS 3947

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+  +A    ++  S +   + STS
Sbjct: 3948 ASTSASESASTSASASASTSASESASTS 3975

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 51/155 (32%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4118 TSASASASTSASASASTSASASASTSASESASTSASVSASTSASASASTSASESASTSAS 4177

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 4178 ESASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASAS 4237

Query: 162  TVVTSSDSTAFGGGTSMF---SAATGVTCSTSMVA 67
            T  ++S ST+     S     SA+T  + S S  A
Sbjct: 4238 TSASASASTSASESASTSASESASTSASASASTSA 4272

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 50/151 (33%), Positives = 81/151 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3427 SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASESASTSASASASTSAS 3483

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               S  AS+S   S ++  S  AS+ +S   S S++  +   TS  A  S + +   S +
Sbjct: 3484 ALTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTS 3543

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S+ ++A    ++  SA+T  + S S  A
Sbjct: 3544 ASASASTSASASASTSASASTSASASASTSA 3574

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3497 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3553

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS+S   S ++  ST AS  +S   S S++T +    ST A  S  T A   + 
Sbjct: 3554 ASASTSASAS--TSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 3611

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  ++S ST+     S  ++A+  T +++
Sbjct: 3612 TSASASASTSASESASTSASASASTSASA 3640

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 53/149 (35%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST-AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
            S++ ST A   AST A  S+S S   S+ST+  AS+    STS+S  AST++S   S+S 
Sbjct: 4129 SASASTSASASASTSASESASTSASVSASTSASASA----STSASESASTSASESASTSA 4184

Query: 342  TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDS 166
            +   ST AS+S   S +   ST AS  +S   S S++T +    ST A  S  T A   +
Sbjct: 4185 SASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASASA 4244

Query: 165  ETVVTSSDSTAFGGGTSMFSAATGVTCST 79
             T  + S ST+     S  ++A+  T ++
Sbjct: 4245 STSASESASTSASESASTSASASASTSAS 4273

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 50/148 (33%), Positives = 81/148 (54%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 833  SASASTSASASASTSA-SASASTSASASASTSASAS--ASTSASASASTSASASASTSAS 889

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   ST++  S  AS+ +S   S S++  +    S  A  S + +   S +
Sbjct: 890  ASASTSASAS--ASTSASASASASTSASESASTSASASASTSASASASTSASASASTSAS 947

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              TS+ ++     ++  SA+T  + S S
Sbjct: 948  TSTSTSASTSASTSASTSASTSASTSAS 975

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 47/149 (31%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 4078 TSASASASTSASESASTSASASASTSASESASTSASVSASTSASASASTSASASASTSAS 4137

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSE 163
               ST AS S   S +   ST AS+ +S   S S++T +    ST A  S  T A   + 
Sbjct: 4138 ASASTSASESASTSASVSASTSASASASTSASESASTSASESASTSASASASTSASASAS 4197

Query: 162  TVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            T  + S ST+     S  ++A+  T +++
Sbjct: 4198 TSASVSASTSASESASTSASASASTSASA 4226

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 49/151 (32%), Positives = 79/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ S  A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 899  SASTSASASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASTSTSTSAS 955

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
            T  ST AS+S   S ++  S  AS+ +S   S S++  + +  S  A  S + +   S +
Sbjct: 956  TSASTSASTSASTSASTSASESASTSASTSASTSASASASISASESASTSASASASTSAS 1015

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
               S  ++     ++  SA+T  + S S  A
Sbjct: 1016 ASASISASESASTSASASASTSASASASTSA 1046

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 51/148 (34%), Positives = 79/148 (53%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2139 SASASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2195

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S+ T +    ST A  S + +   S +
Sbjct: 2196 ASASTSASASASTSASESASTSASASAST--SASALTSASESASTSASASASTSASASAS 2253

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  S  ++     ++  SA+   + STS
Sbjct: 2254 ISASESASTSASASASTSASASASTSTS 2281

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 52/154 (33%), Positives = 82/154 (53%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AS ++S   S+
Sbjct: 2203 SASASTSASESASTSASASASTSASALTSASESASTSASASASTSASASASISASESAST 2262

Query: 348  STTTGVSTGASSSFLISTTS--GVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGA 178
            S +   ST AS+S   ST++    ST AS+ +S   S S++T +    ST A  S  T A
Sbjct: 2263 SASASASTSASASASTSTSASESASTSASASASTSASASASTSASASASTSASASASTSA 2322

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               + T  ++S ST+     S  ++A+  T +++
Sbjct: 2323 SASASTSASASASTSASASASTSASASASTSASA 2356

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 52/154 (33%), Positives = 82/154 (53%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +   S+   +STS+S  AS ++S   S+
Sbjct: 2791 SASASTSASESASTSASASASTSASALTSASESASTSASASASTSASASASISASESAST 2850

Query: 348  STTTGVSTGASSSFLISTTS--GVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGA 178
            S +   ST AS+S   ST++    ST AS+ +S   S S++T +    ST A  S  T A
Sbjct: 2851 SASASASTSASASASTSTSASESASTSASASASTSASASASTSASASASTSASASASTSA 2910

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               + T  ++S ST+     S  ++A+  T +++
Sbjct: 2911 SASASTSASASASTSASASASTSASASASTSASA 2944

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 49/148 (33%), Positives = 77/148 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 3395 SVSASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 3451

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S  ++  +   TS  A  S + +   S +
Sbjct: 3452 ASASTSASASASTSASESASTSASASASTSASALTSASASASTSASASASTSASASASTS 3511

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               S+ ++A    ++  SA+   + S S
Sbjct: 3512 ASESASTSASASASTSASASASTSASAS 3539

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 54/151 (35%), Positives = 84/151 (55%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST- 343
            S++ ST A   AST+  S+SAS   S+S +T AS+   +STS+S  AST++S   S+ST 
Sbjct: 3879 SASASTSASESASTSA-SASASTSASASASTSASAS--ASTSASESASTSASTSASASTS 3935

Query: 342  -TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRD 169
             +   ST AS+S   S +   ST AS+ +S   S S++T +    ST A  S  T A   
Sbjct: 3936 ASASASTSASASASTSASESASTSASASASTSASESASTSASESASTSASASASTSASAS 3995

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 3996 ASTSASASASTSASASASTSASASASTSASA 4026

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 44/151 (29%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1036 TSASASASTSASASASTSASASASTSASVSASTSASESASTSASESASTSASASASTSAS 1095

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               S  AS S   S ++  ST AS+ +S   S S   ST+ S   +++ +  + T A   
Sbjct: 1096 ASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSASAS 1155

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 1156 ASTSASASASTSASASASTSASASASTSASA 1186

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 44/151 (29%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  AST++S   S+S +
Sbjct: 1554 TSASASASTSASASASTSASASASTSASVSASTSASESASTSASESASTSASASASTSAS 1613

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               S  AS S   S ++  ST AS+ +S   S S   ST+ S   +++ +  + T A   
Sbjct: 1614 ASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSASAS 1673

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 1674 ASTSASASASTSASASASTSASASASTSASA 1704

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 51/148 (34%), Positives = 78/148 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S + ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 2727 SVSASTSASASASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 2783

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S +   ST AS+ +S   S S+ T +    ST A  S + +   S +
Sbjct: 2784 ASASTSASASASTSASESASTSASASAST--SASALTSASESASTSASASASTSASASAS 2841

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            +  S  ++     ++  SA+   + STS
Sbjct: 2842 ISASESASTSASASASTSASASASTSTS 2869

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 45/151 (29%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  A T++S   S+S +
Sbjct: 2184 TSASASASTSASASASTSASASASTSASESASTSASASASTSAS--ALTSASESASTSAS 2241

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S  IS +   ST AS+ +S   S S++T +    S     S + +   S +
Sbjct: 2242 ASASTSASASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASAS 2301

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2302 ASTSASASASTSASASASTSASASASTSASA 2332

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 49/154 (31%), Positives = 81/154 (52%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   + TS+S  AST++S   S+
Sbjct: 2187 SASASTSASASASTSASASASTSASESASTSASASASTSASALTSASESASTSASASAST 2246

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGA 178
            S +   S  AS S   S ++  ST AS+ +S   S S   ST+ S   +++ +  + T A
Sbjct: 2247 SASASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSA 2306

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               + T  ++S ST+     S  ++A+  T +++
Sbjct: 2307 SASASTSASASASTSASASASTSASASASTSASA 2340

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 45/151 (29%), Positives = 80/151 (52%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + +++A  S+SAS   S+S +   S+   +STS+S  A T++S   S+S +
Sbjct: 2772 TSASASASTSASASASTSASASASTSASESASTSASASASTSAS--ALTSASESASTSAS 2829

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S  IS +   ST AS+ +S   S S++T +    S     S + +   S +
Sbjct: 2830 ASASTSASASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASAS 2889

Query: 159  VVTSSDSTAFGGGTSMFSAATGVTCSTSMVA 67
              TS+ ++A    ++  S +   + STS  A
Sbjct: 2890 ASTSASASASTSASASASTSASASASTSASA 2920

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 49/154 (31%), Positives = 81/154 (52%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519  SSAFSTGAVTEAST---AGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSS 349
            S++ ST A   AST   A  S+SAS   S+S +  AS+   + TS+S  AST++S   S+
Sbjct: 2775 SASASTSASASASTSASASASTSASESASTSASASASTSASALTSASESASTSASASAST 2834

Query: 348  STTTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGA 178
            S +   S  AS S   S ++  ST AS+ +S   S S   ST+ S   +++ +  + T A
Sbjct: 2835 SASASASISASESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSA 2894

Query: 177  GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
               + T  ++S ST+     S  ++A+  T +++
Sbjct: 2895 SASASTSASASASTSASASASTSASASASTSASA 2928

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 46/151 (30%), Positives = 80/151 (52%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S  T AS    +STS+S  AST++S   S S +
Sbjct: 2200 TSASASASTSASESASTSASASASTSASALTSASES--ASTSASASASTSASASASISAS 2257

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               ST AS+S   S ++  ST  S+  S   S S   ST+ S   +++ +  + T A   
Sbjct: 2258 ESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSASASASTSASAS 2317

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 2318 ASTSASASASTSASASASTSASASASTSASA 2348

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 46/151 (30%), Positives = 80/151 (52%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            +SA ++ + + + +A  S+SAS   S+S  T AS    +STS+S  AST++S   S S +
Sbjct: 2788 TSASASASTSASESASTSASASASTSASALTSASES--ASTSASASASTSASASASISAS 2845

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               ST AS+S   S ++  ST  S+  S   S S   ST+ S   +++ +  + T A   
Sbjct: 2846 ESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSASASASTSASAS 2905

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 2906 ASTSASASASTSASASASTSASASASTSASA 2936

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 58/174 (33%), Positives = 88/174 (50%), Gaps = 9/174 (5%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S+S +T AS+   +STS+S  AST++S   S+S +
Sbjct: 4265 SASASTSASESASTSA-SESASTSASASASTSASAS--ASTSASASASTSASASASTSAS 4321

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
               ST AS+S   S ++ VS   S+  S   S S++  +    S  A  SV+ +   S +
Sbjct: 4322 ASASTSASASASTSASASVSASTSASESASTSASASALASTSASASASTSVSNSANHSNS 4381

Query: 159  VV-TSSDSTA--------FGGGTSMFSAATGVTCSTSMVAI*IYVEKRVKRTEK 25
             V  +S ST          G  +S+ S   GV  + + + +   V KR KR E+
Sbjct: 4382 QVGNTSGSTGKSQKELPNTGTESSIGSVLLGVLAAVTGIGL---VAKRRKRDEE 4432

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 50/151 (33%), Positives = 79/151 (52%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S S +T AS    +STS+S  AST++S   S S +
Sbjct: 1047 SASASTSASASASTSA-SVSASTSASESASTSASES--ASTSASASASTSASASASISAS 1103

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               ST AS+S   S ++  ST  S+  S   S S   ST+ S   +++ +  + T A   
Sbjct: 1104 ESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSASASASTSASAS 1163

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 1164 ASTSASASASTSASASASTSASASASTSASA 1194

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 50/151 (33%), Positives = 79/151 (52%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519  SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
            S++ ST A   AST+  S SAS   S S +T AS    +STS+S  AST++S   S S +
Sbjct: 1565 SASASTSASASASTSA-SVSASTSASESASTSASES--ASTSASASASTSASASASISAS 1621

Query: 339  TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVS---STTKSLVVTSTGA*DSVTGAGRD 169
               ST AS+S   S ++  ST  S+  S   S S   ST+ S   +++ +  + T A   
Sbjct: 1622 ESASTSASASASTSASASASTSTSASESASTSASASASTSASASASTSASASASTSASAS 1681

Query: 168  SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
            + T  ++S ST+     S  ++A+  T +++
Sbjct: 1682 ASTSASASASTSASASASTSASASASTSASA 1712

[17][TOP]
>UniRef100_A9VCR8 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VCR8_MONBE
          Length = 523

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 3/151 (1%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS+ S+   T  ST+  SSS+S   SSST++ +S+   +STS+S  +S++SS   SSST+
Sbjct: 255 SSSSSSSTSTSTSTSSSSSSSS---SSSTSSSSSTSTSTSTSTSSSSSSSSSTSTSSSTS 311

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV---TGAGRD 169
           T  S+ +SSS   ST++  ST  S+ +S   S S++T +   TST    S    T     
Sbjct: 312 TSTSSSSSSSSSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTS 371

Query: 168 SETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
           S T  +SS ST+    TS  S +T  + STS
Sbjct: 372 SSTSTSSSTSTSSSTSTST-STSTSTSTSTS 401

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 55/149 (36%), Positives = 83/149 (55%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           +S  S+ + + +S+   SSS S   S+ST++ +SS   +STSSS   ST+SS   SSST+
Sbjct: 266 TSTSSSSSSSSSSSTSSSSSTSTSTSTSTSSSSSSSSSTSTSSSTSTSTSSSSSSSSSTS 325

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           T  ST  S+S   ST++  ST  S+ +S   S S++T +   TST    S T     + T
Sbjct: 326 TSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTST---SSSTSTSSSTST 382

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTSM 73
             ++S ST+    TS  S +T  + STS+
Sbjct: 383 SSSTSTSTSTSTSTST-STSTSTSTSTSL 410

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 55/148 (37%), Positives = 86/148 (58%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ S+ + T  ST+  SSS+S   SSS++T +SS   +STS+S  +S++SS   S+S++
Sbjct: 253 STSSSSSSSTSTSTSTSSSSSS---SSSSSTSSSSSTSTSTSTSTSSSSSSSSSTSTSSS 309

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           T  ST +SSS   ST++  ST  S+ +S   S S++T +   TST    + T     + T
Sbjct: 310 TSTSTSSSSSSSSSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTST-STSTSTSTSTST 368

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             +SS ST+    TS  S +T  + STS
Sbjct: 369 STSSSTSTSSSTSTSS-STSTSTSTSTS 395

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 51/142 (35%), Positives = 81/142 (57%)
 Frame = -1

Query: 501 GAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTTGVSTG 322
           G  T  ST+  SSS+S   S+ST++ +SS   SSTSSS   ST++S   SSS+++  ST 
Sbjct: 247 GVATSTSTSS-SSSSSTSTSTSTSSSSSSSSSSSTSSSSSTSTSTSTSTSSSSSSSSSTS 305

Query: 321 ASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETVVTSSD 142
            SSS   ST+S  S+ +S+ +S   S S++T +   TST    S + +   S +  TS+ 
Sbjct: 306 TSSSTSTSTSSSSSSSSSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTS 365

Query: 141 STAFGGGTSMFSAATGVTCSTS 76
           ++     ++  S++T  + STS
Sbjct: 366 TSTSTSSSTSTSSSTSTSSSTS 387

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 48/148 (32%), Positives = 82/148 (55%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  ++ + + +S++  SSS S   S+ST+T  S+   SS+SSS   S+++S   SSS++
Sbjct: 260 SSTSTSTSTSSSSSSSSSSSTSSSSSTSTSTSTSTSSSSSSSSSTSTSSSTSTSTSSSSS 319

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  ST  S+S   ST++  ST  S+ +S   S S++T +   TST    S + +   S +
Sbjct: 320 SSSSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSSSTSTSSS 379

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS ++     ++  S +T  + STS
Sbjct: 380 TSTSSSTSTSTSTSTSTSTSTSTSTSTS 407

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 55/145 (37%), Positives = 80/145 (55%), Gaps = 2/145 (1%)
 Frame = -1

Query: 504 TGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTTGVST 325
           T A+   +  G ++S S   SSS++T  S+   SS+SSS  +ST+SS   S+ST+T  S+
Sbjct: 237 TIALEAINLPGVATSTSTSSSSSSSTSTSTSTSSSSSSSSSSSTSSSSSTSTSTSTSTSS 296

Query: 324 GASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSV-TGAGRDSETVVTS 148
            +SSS   ST+S  ST  SS SS   S S++T +   TST    S  T     + T  ++
Sbjct: 297 SSSSSSSTSTSSSTSTSTSSSSSSSSSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTST 356

Query: 147 SDSTAFGGGTS-MFSAATGVTCSTS 76
           S ST+    TS   S++T  + STS
Sbjct: 357 STSTSTSTSTSTSTSSSTSTSSSTS 381

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 51/148 (34%), Positives = 86/148 (58%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           +++ ST + + +ST+  +S++S   SSS+++ +SS   SSTS+S   ST+SS   SSST+
Sbjct: 249 ATSTSTSSSSSSSTSTSTSTSSSSSSSSSSSTSSS---SSTSTSTSTSTSSSSSSSSSTS 305

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           T  ST  S+S   S++S  ST  S+ +S   S S++T +   TST    S + +   S +
Sbjct: 306 TSSSTSTSTSSSSSSSSSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTS 365

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TS+ S+     ++  S++T  + STS
Sbjct: 366 TSTSTSSSTSTSSSTSTSSSTSTSTSTS 393

[18][TOP]
>UniRef100_Q816X4 Cell division protein ftsK n=1 Tax=Bacillus cereus ATCC 14579
           RepID=Q816X4_BACCR
          Length = 1388

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 61/180 (33%), Positives = 92/180 (51%), Gaps = 23/180 (12%)
 Frame = +2

Query: 50  STYIQMATIEVEQVTPVAA----------ENIEVPPPKAVESEEVTTVSESLPAPVTESQ 199
           +T I+  TIEVE+  P  +          E I V  P+ V   EV   +E L   V E++
Sbjct: 318 NTEIKQPTIEVEKQAPEESVIVKAEEKLEETIIVEIPEEVSKVEVIAETEELEEVVMETE 377

Query: 200 APVEVTTKDLVVEETEKPIE---ETEEAQV--ETPEV-VEIKKDEEAPVETPVVVEDESK 361
           AP EV  +  V+ ET++P E   ETEE +V  E  EV V ++ +E   VE     ++  +
Sbjct: 378 APEEVEEEVEVIAETKEPEEVVMETEEVEVIAEAEEVEVIVETEESEEVEVIAEAKESEE 437

Query: 362 TEEVVEAKKEEEVE----EKKTEEAPVVVEEEKKPEAE---EEKPAVEASVTAPVEKADE 520
            E + EAK+ EEVE     K++EE  V+ E ++  E E   E K + E  V A  ++++E
Sbjct: 438 VEVIAEAKESEEVEVIAEAKESEEVEVIAEAKESEEVEVIAEAKESEEVEVIAEAKESEE 497

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 53/167 (31%), Positives = 78/167 (46%), Gaps = 20/167 (11%)
 Frame = +2

Query: 77  EVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPV---TESQAPVEVTTKDLVVEETE 247
           EVE+   V AE  E P    +E+EEV  ++E+    V   TE    VEV  +    EE E
Sbjct: 381 EVEEEVEVIAETKE-PEEVVMETEEVEVIAEAEEVEVIVETEESEEVEVIAEAKESEEVE 439

Query: 248 KPIEETEEAQVETPEVVEIKKDEEAPV--------ETPVVVE--DESKTEEVVEAKKEEE 397
              E  E  +VE   + E K+ EE  V        E  V+ E  +  + E + EAK+ EE
Sbjct: 440 VIAEAKESEEVEV--IAEAKESEEVEVIAEAKESEEVEVIAEAKESEEVEVIAEAKESEE 497

Query: 398 V----EEKKTEEAPVVVEEEKKPEAE---EEKPAVEASVTAPVEKAD 517
           V    E +++EE  V+ E ++  E E   E + + E  V A  E+ +
Sbjct: 498 VEVIAETEESEEVEVIAEAKELEEVEVITETEESEEVEVIAETEEVE 544

[19][TOP]
>UniRef100_Q4X953 Putative uncharacterized protein (Fragment) n=1 Tax=Plasmodium
           chabaudi RepID=Q4X953_PLACH
          Length = 479

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 62/169 (36%), Positives = 87/169 (51%), Gaps = 20/169 (11%)
 Frame = +2

Query: 74  IEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTE-SQAPVEVTTKDLVVEETEK 250
           +E E+V PV  E ++V P + V+ E+V    E    PV E  +  VE   ++ V EE  +
Sbjct: 274 VEEEKVEPV--EEVKVEPVEEVKEEQV---EEEKVEPVEEVKEEQVEEVKEEQVEEEKVE 328

Query: 251 PIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEV----VEAKKEEEVEEKKTE 418
           P+EE +E QVE  EV E++  EE  VE PV  E E + EEV    VE +KEE++EE K E
Sbjct: 329 PVEEVKEEQVE--EVKEVEPVEEEKVE-PVEEEKEEQVEEVKVEPVEEEKEEQIEEVKEE 385

Query: 419 EAPVV---------------VEEEKKPEAEEEKPAVEASVTAPVEKADE 520
           +   V               V+EE+  E +E +P  E     PVE+  E
Sbjct: 386 QVEEVKEEQVEEVKVEPVEEVKEEQVEEVKEPEPVEEEKEPEPVEEEKE 434

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 54/153 (35%), Positives = 75/153 (49%)
 Frame = +2

Query: 62  QMATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEE 241
           Q+   +VE V  V  E +E    + VE E+V  V E     V E Q   EV   + V EE
Sbjct: 297 QVEEEKVEPVEEVKEEQVEEVKEEQVEEEKVEPVEE-----VKEEQVE-EVKEVEPVEEE 350

Query: 242 TEKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEE 421
             +P+EE +E QVE  +V  +++++E  +E     + E   EE VE  K E VEE K E+
Sbjct: 351 KVEPVEEEKEEQVEEVKVEPVEEEKEEQIEEVKEEQVEEVKEEQVEEVKVEPVEEVKEEQ 410

Query: 422 APVVVEEEKKPEAEEEKPAVEASVTAPVEKADE 520
              V E E   E +E +P  E     PVE+  E
Sbjct: 411 VEEVKEPEPVEEEKEPEPVEEEKEPEPVEEVKE 443

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 58/169 (34%), Positives = 85/169 (50%), Gaps = 16/169 (9%)
 Frame = +2

Query: 62  QMATIEVEQVTPVAAENIE-VPPPKAVESEEVTTVSESLPAPVTESQA-PVEVTTKDLVV 235
           Q+  ++ E V  V  E +E V   + VE E+   V E    PV E +  PVE   ++ V 
Sbjct: 240 QVEEVKEEPVEEVKEEQVEEVKEVEHVEEEKEEQVEEEKVEPVEEVKVEPVEEVKEEQVE 299

Query: 236 EETEKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVE-DESKTEEVVEAKKEEEVEEKK 412
           EE  +P+EE +E QVE  +  ++++++  PVE     + +E K  E VE +K E VEE+K
Sbjct: 300 EEKVEPVEEVKEEQVEEVKEEQVEEEKVEPVEEVKEEQVEEVKEVEPVEEEKVEPVEEEK 359

Query: 413 TEEAPVV----VEEEKKPEAEEEK---------PAVEASVTAPVEKADE 520
            E+   V    VEEEK+ + EE K           VE     PVE+  E
Sbjct: 360 EEQVEEVKVEPVEEEKEEQIEEVKEEQVEEVKEEQVEEVKVEPVEEVKE 408

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 54/151 (35%), Positives = 79/151 (52%), Gaps = 3/151 (1%)
 Frame = +2

Query: 77  EVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPI 256
           +VE+V     E  +V P + V+ E+V  V E  P    E   PVE   ++ V E   +P+
Sbjct: 313 QVEEVKEEQVEEEKVEPVEEVKEEQVEEVKEVEPVE-EEKVEPVEEEKEEQVEEVKVEPV 371

Query: 257 EETEEAQVETPEVVEIKKDEEAPV-ETPVVVEDESKTEEVVEAKKEEEVEEKKTEEAPVV 433
           EE +E Q+E  +  ++++ +E  V E  V   +E K E+V E K+ E VEE   E+ P  
Sbjct: 372 EEEKEEQIEEVKEEQVEEVKEEQVEEVKVEPVEEVKEEQVEEVKEPEPVEE---EKEPEP 428

Query: 434 VEEEKKPEAEEE--KPAVEASVTAPVEKADE 520
           VEEEK+PE  EE  +  VE      VE+  E
Sbjct: 429 VEEEKEPEPVEEVKEEQVEEVKEEQVEEVKE 459

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 54/156 (34%), Positives = 79/156 (50%), Gaps = 18/156 (11%)
 Frame = +2

Query: 62  QMATIEVEQVTPVAAENIE-VPPPKAVESEEVTTVSESLPAPVTESQA-PVEVTTKDLVV 235
           Q+   +VE V  V  E +E V   + VE E+V  V E     V E +  PVE   ++ + 
Sbjct: 321 QVEEEKVEPVEEVKEEQVEEVKEVEPVEEEKVEPVEEEKEEQVEEVKVEPVEEEKEEQIE 380

Query: 236 EETEKPIEETEEAQVETPEVV---EIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEE 406
           E  E+ +EE +E QVE  +V    E+K+++   V+ P  VE+E + E V E K+ E VEE
Sbjct: 381 EVKEEQVEEVKEEQVEEVKVEPVEEVKEEQVEEVKEPEPVEEEKEPEPVEEEKEPEPVEE 440

Query: 407 KKTEEAPVV-------------VEEEKKPEAEEEKP 475
            K E+   V             VEE K+ + EEE+P
Sbjct: 441 VKEEQVEEVKEEQVEEVKEVEPVEEVKEEQVEEEEP 476

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 52/148 (35%), Positives = 75/148 (50%), Gaps = 1/148 (0%)
 Frame = +2

Query: 80  VEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPIE 259
           VE+V     E ++V P + V+ E++  V E  P    +   PVE   ++ V E  E+ +E
Sbjct: 176 VEEVKEEQVEEVKVEPVEEVKEEQIEEVKEE-PVEEEKEPEPVEEVKEEQVEEVKEEQVE 234

Query: 260 ETEEAQVETPEVVEIKKDEEAPVETPVVVED-ESKTEEVVEAKKEEEVEEKKTEEAPVVV 436
           E +E QVE  +   +++ +E  VE    VE  E + EE VE +K E VEE K E     V
Sbjct: 235 EEKEEQVEEVKEEPVEEVKEEQVEEVKEVEHVEEEKEEQVEEEKVEPVEEVKVEP----V 290

Query: 437 EEEKKPEAEEEKPAVEASVTAPVEKADE 520
           EE K+ + EEEK         PVE+  E
Sbjct: 291 EEVKEEQVEEEK-------VEPVEEVKE 311

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 59/166 (35%), Positives = 80/166 (48%), Gaps = 13/166 (7%)
 Frame = +2

Query: 62  QMATIEVEQVTPVAAENIEVPPPKAVESEE----VTTVSESLPAPVTESQAPVEVTTKDL 229
           Q+  ++VE V  V  E IE    + VE E+    V  V E     V E Q  VE   ++ 
Sbjct: 183 QVEEVKVEPVEEVKEEQIEEVKEEPVEEEKEPEPVEEVKEEQVEEVKEEQ--VEEEKEEQ 240

Query: 230 VVEETEKPIEETEEAQVETPEVVE---------IKKDEEAPVETPVVVEDESKTEEVVEA 382
           V E  E+P+EE +E QVE  + VE         +++++  PVE   V   E   EE VE 
Sbjct: 241 VEEVKEEPVEEVKEEQVEEVKEVEHVEEEKEEQVEEEKVEPVEEVKVEPVEEVKEEQVEE 300

Query: 383 KKEEEVEEKKTEEAPVVVEEEKKPEAEEEKPAVEASVTAPVEKADE 520
           +K E VEE K E+    VEE K+ + EEEK         PVE+  E
Sbjct: 301 EKVEPVEEVKEEQ----VEEVKEEQVEEEK-------VEPVEEVKE 335

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 53/150 (35%), Positives = 73/150 (48%), Gaps = 2/150 (1%)
 Frame = +2

Query: 77  EVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTE--SQAPVEVTTKDLVVEETEK 250
           E E V  V  E +E    + VE E+   V E    PV E   +   EV   + V EE E+
Sbjct: 213 EPEPVEEVKEEQVEEVKEEQVEEEKEEQVEEVKEEPVEEVKEEQVEEVKEVEHVEEEKEE 272

Query: 251 PIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEAPV 430
            +EE +   VE  +V  +++ +E  VE   V   E   EE VE  KEE+VEE+K E  PV
Sbjct: 273 QVEEEKVEPVEEVKVEPVEEVKEEQVEEEKVEPVEEVKEEQVEEVKEEQVEEEKVE--PV 330

Query: 431 VVEEEKKPEAEEEKPAVEASVTAPVEKADE 520
              +E++ E  +E   VE     PVE+  E
Sbjct: 331 EEVKEEQVEEVKEVEPVEEEKVEPVEEEKE 360

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 49/148 (33%), Positives = 75/148 (50%)
 Frame = +2

Query: 77  EVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPI 256
           +VE+      E ++  P + V+ E+V  V E +     E +  VE    + V E   +P+
Sbjct: 232 QVEEEKEEQVEEVKEEPVEEVKEEQVEEVKE-VEHVEEEKEEQVEEEKVEPVEEVKVEPV 290

Query: 257 EETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEAPVVV 436
           EE +E QVE  +V  +++ +E  VE     + E +  E VE  KEE+VEE K  E   V 
Sbjct: 291 EEVKEEQVEEEKVEPVEEVKEEQVEEVKEEQVEEEKVEPVEEVKEEQVEEVK--EVEPVE 348

Query: 437 EEEKKPEAEEEKPAVEASVTAPVEKADE 520
           EE+ +P  EE++  VE     PVE+  E
Sbjct: 349 EEKVEPVEEEKEEQVEEVKVEPVEEEKE 376

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 55/171 (32%), Positives = 80/171 (46%), Gaps = 23/171 (13%)
 Frame = +2

Query: 77  EVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPI 256
           E+++++  A++++E P   + +  + T V             PVE   ++ V E   +P+
Sbjct: 145 EIDEISTNASDSVEAPEEISEQDSDSTVVE------------PVEEVKEEQVEEVKVEPV 192

Query: 257 EETEEAQVETPEVVEIKKDEEAPVE---TPVVVED------ESKTEEVVEAKKEEEVEEK 409
           EE +E Q+E     E+K   E PVE    P  VE+      E   EE VE +KEE+VEE 
Sbjct: 193 EEVKEEQIE-----EVK---EEPVEEEKEPEPVEEVKEEQVEEVKEEQVEEEKEEQVEEV 244

Query: 410 KTEEAPVV-------------VEEEKKPEAEEEK-PAVEASVTAPVEKADE 520
           K E    V             VEEEK+ + EEEK   VE     PVE+  E
Sbjct: 245 KEEPVEEVKEEQVEEVKEVEHVEEEKEEQVEEEKVEPVEEVKVEPVEEVKE 295

[20][TOP]
>UniRef100_C5L0G7 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC
           50983 RepID=C5L0G7_9ALVE
          Length = 645

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 59/155 (38%), Positives = 73/155 (47%), Gaps = 4/155 (2%)
 Frame = +2

Query: 68  ATIEVEQVTPVAAEN---IEVPPPKAVESEEVTTVSESLPAPV-TESQAPVEVTTKDLVV 235
           A +E     PV A     +EV     V++     V  +  APV   ++APVEVTT+  V 
Sbjct: 381 APVEATTEAPVEATTEAPVEVTTEAPVDATTEAPVDATTEAPVDATTEAPVEVTTEAPVD 440

Query: 236 EETEKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKT 415
             TE P+E T EA VE      ++   EAPV+       E  TE  V+A  E  VE   T
Sbjct: 441 ATTEAPVEATTEAPVEATTGAPVEATTEAPVDATTEAPVEVTTEAPVDATTEAPVE--AT 498

Query: 416 EEAPVVVEEEKKPEAEEEKPAVEASVTAPVEKADE 520
            EAPV    E   EA  E P VEA+  APVE   E
Sbjct: 499 TEAPVEATTEAPVEATTEAP-VEATTEAPVEATTE 532

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 61/164 (37%), Positives = 75/164 (45%)
 Frame = +2

Query: 29  SVLLTLFSTYIQMATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPV 208
           +V  T  ST+  + TIE        AE+     P    +E VTT + +     T +  PV
Sbjct: 245 AVEATTTSTFAAVTTIEA-----YIAESSATGAP----TEYVTTTTVTPLLVFTTTGVPV 295

Query: 209 EVTTKDLVVEETEKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKK 388
           E TT+  V   TE P+E T EA VE      +    EAPVE       ++ TE  VEA  
Sbjct: 296 EATTEAPVEATTEAPVEATTEAPVEATTEAPVDATTEAPVEATTEAPVDATTEAPVEATT 355

Query: 389 EEEVEEKKTEEAPVVVEEEKKPEAEEEKPAVEASVTAPVEKADE 520
           E  VE   T EAPV    E   EA  E P VEA+  APVE   E
Sbjct: 356 EAPVE--ATTEAPVEATTEAPVEATTEAP-VEATTEAPVEATTE 396

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 56/149 (37%), Positives = 70/149 (46%)
 Frame = +2

Query: 74  IEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKP 253
           + VE  T    E     P +A     V   +E+ P   T ++APVE TT+  V   TE P
Sbjct: 293 VPVEATTEAPVEATTEAPVEATTEAPVEATTEA-PVDAT-TEAPVEATTEAPVDATTEAP 350

Query: 254 IEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEAPVV 433
           +E T EA VE      ++   EAPVE       E+ TE  VEA  E  VE   T EAPV 
Sbjct: 351 VEATTEAPVEATTEAPVEATTEAPVEATTEAPVEATTEAPVEATTEAPVE--VTTEAPVD 408

Query: 434 VEEEKKPEAEEEKPAVEASVTAPVEKADE 520
              E   +A  E P V+A+  APVE   E
Sbjct: 409 ATTEAPVDATTEAP-VDATTEAPVEVTTE 436

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 61/170 (35%), Positives = 74/170 (43%), Gaps = 19/170 (11%)
 Frame = +2

Query: 68  ATIEVEQVTPVAAEN---IEVPPPKAVESEEVTTVSESLPAPV-TESQAPVEVTTKDLVV 235
           A +EV    PV A     +E      VE+     V  +  APV   ++APVEVTT+  V 
Sbjct: 429 APVEVTTEAPVDATTEAPVEATTEAPVEATTGAPVEATTEAPVDATTEAPVEVTTEAPVD 488

Query: 236 EETEKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKT 415
             TE P+E T EA VE      ++   EAPVE       E+ TE  VEA  E  V+   T
Sbjct: 489 ATTEAPVEATTEAPVEATTEAPVEATTEAPVEATTEAPVEATTEAPVEAITEVPVD--AT 546

Query: 416 EEAPVVVEEEKKPEAEEEKP---------------AVEASVTAPVEKADE 520
            E PV    E   EA  E P               AVEA+  APVE   E
Sbjct: 547 TEVPVEAITEAPEEATTEDPTDATTEVPREATTEAAVEATTEAPVEATTE 596

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 55/152 (36%), Positives = 69/152 (45%), Gaps = 1/152 (0%)
 Frame = +2

Query: 68  ATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPV-TESQAPVEVTTKDLVVEET 244
           A +E     PV A   E P    VE+     V  +  APV   ++APVE TT+  V   T
Sbjct: 333 APVEATTEAPVDATT-EAP----VEATTEAPVEATTEAPVEATTEAPVEATTEAPVEATT 387

Query: 245 EKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEA 424
           E P+E T EA VE      +    EAPV+       ++ TE  VE   E  V+   T EA
Sbjct: 388 EAPVEATTEAPVEVTTEAPVDATTEAPVDATTEAPVDATTEAPVEVTTEAPVD--ATTEA 445

Query: 425 PVVVEEEKKPEAEEEKPAVEASVTAPVEKADE 520
           PV    E   EA    P VEA+  APV+   E
Sbjct: 446 PVEATTEAPVEATTGAP-VEATTEAPVDATTE 476

[21][TOP]
>UniRef100_A2DFD4 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3
            RepID=A2DFD4_TRIVA
          Length = 919

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 67/163 (41%), Positives = 78/163 (47%), Gaps = 17/163 (10%)
 Frame = +2

Query: 83   EQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPIEE 262
            E+ TPVA E  E   P   E +E  T  E      T ++   E  T     +E E P EE
Sbjct: 700  EEETPVAEEKKEEETPAVEEKKEEETPVEEKKEEETPAEEKKEEETPVEEKKEEETPAEE 759

Query: 263  -------TEEAQVETPEVVEIKKDEEAPV-------ETPVVVEDESKTEEVVEAKKEEEV 400
                   TEE + E   V E KK+EE PV       ETP V E++ + E  VE KKEEE 
Sbjct: 760  KKEETPATEEKKEEESPVAEEKKEEETPVAEEKKEEETPAV-EEKKEEETPVEEKKEEET 818

Query: 401  --EEKKTEEAPVVVEEEKKPEAEEEKPAVE-ASVTAPVEKADE 520
              EEKK EE PV   EEKK   EEE PA E      PVE+  E
Sbjct: 819  PAEEKKEEETPV---EEKK---EEETPAEEKKEEETPVEEKKE 855

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 68/170 (40%), Positives = 78/170 (45%), Gaps = 19/170 (11%)
 Frame = +2

Query: 68  ATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLP--APVTESQAPVEVTTKDLVVEE 241
           A  E ++ TP   E  E  P    + EE   V E      P  E +   E    +   EE
Sbjct: 510 AVEEKKEETPAVEEKKEETPAVEEKKEETPAVEEKKKEETPAVEEKKKEETPAVEEKKEE 569

Query: 242 T--------EKPIEETEEAQVETPEVVEIKKDEEAPVE-----TPVVVEDESKTEEVVEA 382
           T        E P+EE +E   ETP V E KK+E   VE     TP V  +E K E  VE 
Sbjct: 570 TPAVEEKKEETPVEEKKEE--ETPAVEEKKKEETPAVEEKKEETPAV--EEKKEETPVEE 625

Query: 383 KKEEE---VEEKKTEEAPVVVEEEKKPEAEEEKPAV-EASVTAPVEKADE 520
           KKEEE   VEEKK EE P V  EEKK    EE PAV E     PVE+  E
Sbjct: 626 KKEEETPAVEEKKKEETPAV--EEKK----EETPAVEEKKEETPVEEKKE 669

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 66/177 (37%), Positives = 84/177 (47%), Gaps = 26/177 (14%)
 Frame = +2

Query: 68   ATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETE 247
            A  E ++ TP   E  E  P +  + EE     +    P TE +   E    +   EE E
Sbjct: 644  AVEEKKEETPAVEEKKEETPVEEKKEEETPAQEKKEETPATEEKKEEESPVAEEKKEE-E 702

Query: 248  KPIEETEEAQVETPEVVEIKKDEEAPV------ETPVVVEDESKTEEVVEAKKEEE---- 397
             P+ E E+ + ETP V E KK+EE PV      ETP   E++ + E  VE KKEEE    
Sbjct: 703  TPVAE-EKKEEETPAVEE-KKEEETPVEEKKEEETP--AEEKKEEETPVEEKKEEETPAE 758

Query: 398  --------VEEKKTEEAPVVVE--EEKKPEAEEEK----PAVE--ASVTAPVEKADE 520
                     EEKK EE+PV  E  EE+ P AEE+K    PAVE       PVE+  E
Sbjct: 759  EKKEETPATEEKKEEESPVAEEKKEEETPVAEEKKEEETPAVEEKKEEETPVEEKKE 815

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 64/160 (40%), Positives = 77/160 (48%), Gaps = 14/160 (8%)
 Frame = +2

Query: 83   EQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPIEE 262
            E+ +PVA E  E   P A E +E  T       P  E +   E   ++   EET  P EE
Sbjct: 689  EEESPVAEEKKEEETPVAEEKKEEET-------PAVEEKKEEETPVEEKKEEET--PAEE 739

Query: 263  TEEAQVETPEVVEIKKDEEAPVE-----TPVVVEDESKTEEVVEAKKEEEV---EEKKTE 418
             +E   ETP  VE KK+EE P E     TP   E + +   V E KKEEE    EEKK E
Sbjct: 740  KKEE--ETP--VEEKKEEETPAEEKKEETPATEEKKEEESPVAEEKKEEETPVAEEKKEE 795

Query: 419  EAPVVVE--EEKKP---EAEEEKPAVE-ASVTAPVEKADE 520
            E P V E  EE+ P   + EEE PA E      PVE+  E
Sbjct: 796  ETPAVEEKKEEETPVEEKKEEETPAEEKKEEETPVEEKKE 835

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 69/178 (38%), Positives = 83/178 (46%), Gaps = 27/178 (15%)
 Frame = +2

Query: 68   ATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEET- 244
            A  E ++ TP   E  E  P +  + EE   V E       E+ A  E   +   VEE  
Sbjct: 562  AVEEKKEETPAVEEKKEETPVEEKKEEETPAVEEKKKE---ETPAVEEKKEETPAVEEKK 618

Query: 245  -EKPIEETEEAQVETPEVVEIKKDEEAPVE-----TPVVVEDESKTEEVVEAKKEEE--- 397
             E P+EE +E   ETP V E KK+E   VE     TP V  +E K E  VE KKEEE   
Sbjct: 619  EETPVEEKKEE--ETPAVEEKKKEETPAVEEKKEETPAV--EEKKEETPVEEKKEEETPA 674

Query: 398  ---------VEEKKTEEAPVVVE--EEKKPEAEEEK----PAVE--ASVTAPVEKADE 520
                      EEKK EE+PV  E  EE+ P AEE+K    PAVE       PVE+  E
Sbjct: 675  QEKKEETPATEEKKEEESPVAEEKKEEETPVAEEKKEEETPAVEEKKEEETPVEEKKE 732

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 64/175 (36%), Positives = 86/175 (49%), Gaps = 13/175 (7%)
 Frame = +2

Query: 83  EQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPIEE 262
           E+ TPV  +  E P  +  + EE   V E       E+ A  E   +   VEE ++    
Sbjct: 477 EEETPVEEKKEETPAEE--KKEETQAVEEKKE----ETPAVEEKKEETPAVEEKKEETPA 530

Query: 263 TEEAQVETPEVVEIKKDEEAPVE------TPVVVEDESKTEEVVEAKKEE-EVEEKKTEE 421
            EE + ETP V E KK+E   VE      TP V E + +T   VE KKEE  VEEKK EE
Sbjct: 531 VEEKKEETPAVEEKKKEETPAVEEKKKEETPAVEEKKEETP-AVEEKKEETPVEEKKEEE 589

Query: 422 APVVVEEEKK-----PEAEEEKPAV-EASVTAPVEKADE*M*RKKLSFERQKKKK 568
            P V E++K+      E +EE PAV E     PVE+  E    +  + E +KK++
Sbjct: 590 TPAVEEKKKEETPAVEEKKEETPAVEEKKEETPVEEKKE---EETPAVEEKKKEE 641

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 63/171 (36%), Positives = 77/171 (45%), Gaps = 25/171 (14%)
 Frame = +2

Query: 83   EQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPIEE 262
            E+ TP   E  +   P   E +E T   E       + + PVE   ++      EK  EE
Sbjct: 587  EEETPAVEEKKKEETPAVEEKKEETPAVEE-----KKEETPVEEKKEEETPAVEEKKKEE 641

Query: 263  T---EEAQVETPEV--------VEIKKDEEAPV-----ETPVVVEDESKTEEVVEAKKEE 394
            T   EE + ETP V        VE KK+EE P      ETP   E + +   V E KKEE
Sbjct: 642  TPAVEEKKEETPAVEEKKEETPVEEKKEEETPAQEKKEETPATEEKKEEESPVAEEKKEE 701

Query: 395  EV---EEKKTEEAPVVVE--EEKKP---EAEEEKPAVE-ASVTAPVEKADE 520
            E    EEKK EE P V E  EE+ P   + EEE PA E      PVE+  E
Sbjct: 702  ETPVAEEKKEEETPAVEEKKEEETPVEEKKEEETPAEEKKEEETPVEEKKE 752

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 62/154 (40%), Positives = 75/154 (48%), Gaps = 11/154 (7%)
 Frame = +2

Query: 83   EQVTPVAAENIEVPPPKAVESEEVTTVSESLP---APVTESQAPVEVTTKDLVVEETEKP 253
            E+ TPV  +  E  P  A E +E T  +E      +PV E +   E    +   EE    
Sbjct: 742  EEETPVEEKKEEETP--AEEKKEETPATEEKKEEESPVAEEKKEEETPVAEEKKEEETPA 799

Query: 254  IEETEEAQVETPEVVEIKKDEEAPVE------TPVVVEDESKTEEVVEAKKEEE--VEEK 409
            +EE +E   ETP  VE KK+EE P E      TPV  E++ + E   E KKEEE  VEEK
Sbjct: 800  VEEKKEE--ETP--VEEKKEEETPAEEKKEEETPV--EEKKEEETPAEEKKEEETPVEEK 853

Query: 410  KTEEAPVVVEEEKKPEAEEEKPAVEASVTAPVEK 511
            K EE P    EEKK   EEE PA E     P  K
Sbjct: 854  KEEETPA---EEKK---EEETPAQEKKEETPAVK 881

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 56/141 (39%), Positives = 70/141 (49%), Gaps = 6/141 (4%)
 Frame = +2

Query: 77   EVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPI 256
            E ++ TP   E  E   P A E +E  T       PV E +   E    +   EE E P+
Sbjct: 759  EKKEETPATEEKKEEESPVAEEKKEEET-------PVAEEKKEEETPAVEEKKEE-ETPV 810

Query: 257  EETEEAQVETPEVVEIKKDEEAPVETPVVVE---DESKTEEV-VEAKKEEEV--EEKKTE 418
            EE +E   ETP   E KK+EE PVE     E   +E K EE  VE KKEEE   EEKK E
Sbjct: 811  EEKKEE--ETP--AEEKKEEETPVEEKKEEETPAEEKKEEETPVEEKKEEETPAEEKKEE 866

Query: 419  EAPVVVEEEKKPEAEEEKPAV 481
            E P   ++E+ P  +E+K  V
Sbjct: 867  ETPAQEKKEETPAVKEKKEEV 887

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 66/177 (37%), Positives = 84/177 (47%), Gaps = 15/177 (8%)
 Frame = +2

Query: 83  EQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTES---QAPVEVTTKDLVVEETEKP 253
           E+V PV  EN E     AV  E      +    PV E    + PVE   ++   EE ++ 
Sbjct: 440 EEVVPVE-ENKE-DNTSAVAQETTVEEKKEEETPVEEKKEEETPVEEKKEETPAEEKKEE 497

Query: 254 IEETEEAQVETPEV---------VEIKKDEEAPVETPVVVEDESKTEEVVEAKKEE--EV 400
            +  EE + ETP V         VE KK+E     TP V E + +T  V E KKEE   V
Sbjct: 498 TQAVEEKKEETPAVEEKKEETPAVEEKKEE-----TPAVEEKKEETPAVEEKKKEETPAV 552

Query: 401 EEKKTEEAPVVVEEEKKPEAEEEKPAV-EASVTAPVEKADE*M*RKKLSFERQKKKK 568
           EEKK EE P V  EEKK    EE PAV E     PVE+  E    +  + E +KK++
Sbjct: 553 EEKKKEETPAV--EEKK----EETPAVEEKKEETPVEEKKE---EETPAVEEKKKEE 600

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 63/150 (42%), Positives = 70/150 (46%), Gaps = 11/150 (7%)
 Frame = +2

Query: 68  ATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETE 247
           A  E ++ TP   E  E  P    + EE   V E       E    VE   K+      E
Sbjct: 500 AVEEKKEETPAVEEKKEETPAVEEKKEETPAVEEK-----KEETPAVEEKKKEETPAVEE 554

Query: 248 KPIEET---EEAQVETPEVVEIKKDEEAPVE------TPVVVEDESKTEEVVEAKKEEE- 397
           K  EET   EE + ETP V E  K EE PVE      TP V E + +    VE KKEE  
Sbjct: 555 KKKEETPAVEEKKEETPAVEE--KKEETPVEEKKEEETPAVEEKKKEETPAVEEKKEETP 612

Query: 398 -VEEKKTEEAPVVVEEEKKPEAEEEKPAVE 484
            VEEKK EE PV   EEKK   EEE PAVE
Sbjct: 613 AVEEKK-EETPV---EEKK---EEETPAVE 635

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 57/166 (34%), Positives = 74/166 (44%), Gaps = 20/166 (12%)
 Frame = +2

Query: 83   EQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPIEE 262
            ++ TP   E  +   P   E +E T   E       + + PVE   ++      EK  EE
Sbjct: 546  KEETPAVEEKKKEETPAVEEKKEETPAVEE-----KKEETPVEEKKEEETPAVEEKKKEE 600

Query: 263  T---EEAQVETPEVVEIKKDEEAPV------ETPVVVEDESKTEEVVEAKKEE------- 394
            T   EE + ETP V E  K EE PV      ETP V E + +    VE KKEE       
Sbjct: 601  TPAVEEKKEETPAVEE--KKEETPVEEKKEEETPAVEEKKKEETPAVEEKKEETPAVEEK 658

Query: 395  ----EVEEKKTEEAPVVVEEEKKPEAEEEKPAVEASVTAPVEKADE 520
                 VEEKK EE P   ++E+ P  EE+K   E S  A  +K +E
Sbjct: 659  KEETPVEEKKEEETPAQEKKEETPATEEKKE--EESPVAEEKKEEE 702

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 46/118 (38%), Positives = 56/118 (47%), Gaps = 3/118 (2%)
 Frame = +2

Query: 83   EQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPIEE 262
            E+ TPVA E  E   P   E +E  T  E      T ++   E  T     +E E P EE
Sbjct: 783  EEETPVAEEKKEEETPAVEEKKEEETPVEEKKEEETPAEEKKEEETPVEEKKEEETPAEE 842

Query: 263  TEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEE---VEEKKTEEAP 427
             +E   ETP  VE KK+EE P E       E K EE    +K+EE   V+EKK E AP
Sbjct: 843  KKEE--ETP--VEEKKEEETPAE-------EKKEEETPAQEKKEETPAVKEKKEEVAP 889

[22][TOP]
>UniRef100_A9UXC9 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9UXC9_MONBE
          Length = 3047

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 52/148 (35%), Positives = 85/148 (57%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS+ ST + +  S+   SSS S   S+S+T+  SS   SS++SS  +++++S   SSS+T
Sbjct: 180 SSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSSSST 239

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +S+S   ST+S  ST ++S SS   S SST+ +   +ST +  S +     S T
Sbjct: 240 SSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSST 299

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     ++  +++T  T STS
Sbjct: 300 SSTSSTSSTSSTSSTSSTSSTSSTSSTS 327

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 51/148 (34%), Positives = 86/148 (58%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  ST + +  S+   SSS S   S+S+T+ +SS   +S++SS  +S+++S   S+S+T
Sbjct: 219 SSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSST 278

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +S+S   ST+S  ST ++S +S   S SST+ +   +ST +  S + +   S T
Sbjct: 279 SSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSSSSTSST 338

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     T+  +++T  T STS
Sbjct: 339 SSTSSTSSTSSTSTTSSTSSTSSTSSTS 366

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 56/144 (38%), Positives = 82/144 (56%)
 Frame = -1

Query: 507 STGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTTGVS 328
           ST + T  S+   +SS S   SSS+T+  SS   SSTSSS   S+TSS   S+S+T+  S
Sbjct: 160 STSSTTSTSSTSSTSSTSSTSSSSSTSSTSST--SSTSSSSSTSSTSSTS-STSSTSSTS 216

Query: 327 TGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETVVTS 148
           + +S+S   ST+S  ST +SS +S   S SST+ S   +ST +  S + +   S T  TS
Sbjct: 217 SSSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTS 276

Query: 147 SDSTAFGGGTSMFSAATGVTCSTS 76
           S S+     ++  +++T  T STS
Sbjct: 277 STSSTSSTSSTSSTSSTSSTSSTS 300

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 51/148 (34%), Positives = 85/148 (57%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  ST + + +S+   +SS S   SSS+T+  SS   +S+SSS  +++++S   S+S+T
Sbjct: 225 SSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSST 284

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +S+S   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T
Sbjct: 285 SSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSSSSTSSTSSTSST 344

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS ST     ++  +++T  T STS
Sbjct: 345 SSTSSTSTTSSTSSTSSTSSTSSTSSTS 372

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 60/154 (38%), Positives = 87/154 (56%), Gaps = 6/154 (3%)
 Frame = -1

Query: 519 SSAFSTGAVTE-ASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSST 343
           SS  ST + +  +ST+  SSS+S   +SST++ +SS   SSTSS+   S+TSS   SSST
Sbjct: 162 SSTTSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSTSSSSST 221

Query: 342 -----TTGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGA 178
                T+  S+ +SSS   ST+S  ST +SS +S   S SST+ S   +ST +  S +  
Sbjct: 222 SSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSST 281

Query: 177 GRDSETVVTSSDSTAFGGGTSMFSAATGVTCSTS 76
              S T  TSS S+     ++  +++T  T STS
Sbjct: 282 SSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTS 315

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 51/148 (34%), Positives = 85/148 (57%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS+ ST + +  S+   +SS S   S+S+T+  SS   +S+SSS  +++++S   SSS+T
Sbjct: 195 SSSSSTSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSST 254

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +S+S   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T
Sbjct: 255 SSTSSTSSTSSSSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSST 314

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     ++  S++T  T STS
Sbjct: 315 SSTSSTSSTSSTSSTSSSSSTSSTSSTS 342

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 51/148 (34%), Positives = 85/148 (57%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  ST + +  S+   +SS+S   S+S+T+  SS   SS++SS  +++++S   S+S+T
Sbjct: 198 SSTSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSST 257

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +SSS   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T
Sbjct: 258 SSTSSTSSSSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSST 317

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     +S  +++T  T STS
Sbjct: 318 SSTSSTSSTSSTSSSSSTSSTSSTSSTS 345

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 50/148 (33%), Positives = 84/148 (56%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  ST + +  S+   SSS S   S+S+T+  SS   +S++SS  ++++SS   S+S+T
Sbjct: 201 SSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSST 260

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +S+S   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T
Sbjct: 261 SSTSSSSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSST 320

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     ++  +++T  T STS
Sbjct: 321 SSTSSTSSTSSSSSTSSTSSTSSTSSTS 348

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 56/148 (37%), Positives = 85/148 (57%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  ST + + +S+   +SS S   S+S+T+ +SS   SSTSS+   S+TSS   +SST+
Sbjct: 186 SSTSSTSSTSSSSSTSSTSSTSSTSSTSSTSSSSST--SSTSSTSSTSSTSSSSSTSSTS 243

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  ST +SSS   ST+S  ST +SS +S   S SST+ +   +ST +  S +     S T
Sbjct: 244 STSSTSSSSS-TSSTSSTSSTSSSSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSST 302

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     ++  +++T  T STS
Sbjct: 303 SSTSSTSSTSSTSSTSSTSSTSSTSSTS 330

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 51/148 (34%), Positives = 84/148 (56%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  ST   +  S+   +SS S   S+S+T+ +SS   +S++SS  +S+++S   S+S+T
Sbjct: 150 SSTSSTSITSSTSSTTSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSST 209

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +SSS   ST+S  ST ++S SS   S SST+ +   +ST +  S +     S T
Sbjct: 210 SSTSSTSSSSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSST 269

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     ++  +++T  T STS
Sbjct: 270 SSTSSTSSTSSTSSTSSTSSTSSTSSTS 297

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 50/148 (33%), Positives = 84/148 (56%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  ST + +  S+   +SS S   SSS+T+  SS   +S+SSS  +++++S   SSS+T
Sbjct: 210 SSTSSTSSSSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSST 269

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +S+S   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T
Sbjct: 270 SSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSST 329

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             +SS S+     ++  +++T  T STS
Sbjct: 330 SSSSSTSSTSSTSSTSSTSSTSTTSSTS 357

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 53/148 (35%), Positives = 87/148 (58%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ++   T +ST+  SS++    +SSTT+ +S+   SSTSS+  +S+TSS   +SST+
Sbjct: 136 STSSTSSTSTTSSTSSTSSTSITSSTSSTTSTSSTSSTSSTSSTSSSSSTSSTSSTSSTS 195

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  ST ++SS   ST+S  ST +SS +S   S SST+ +   +ST +  S +     S T
Sbjct: 196 SSSSTSSTSS-TSSTSSTSSTSSSSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSST 254

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     ++  +++T  T STS
Sbjct: 255 SSTSSTSSTSSSSSTSSTSSTSSTSSTS 282

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 50/148 (33%), Positives = 86/148 (58%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  +T + +  S+   +SS S   S+S+T+  SS   +S+SSS  +++++S   SSS+T
Sbjct: 141 SSTSTTSSTSSTSSTSITSSTSSTTSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSST 200

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +S+S   ST+S  ST ++S +S   S SST+ S   +ST +  S + +   S T
Sbjct: 201 SSTSSTSSTSSTSSTSSSSSTSSTSSTS---STSSTSSSSSTSSTSSTSSTSSSSSTSST 257

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S++    ++  +++T  T STS
Sbjct: 258 SSTSSTSSSSSTSSTSSTSSTSSTSSTS 285

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 49/148 (33%), Positives = 87/148 (58%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  ST + +  S++  +SS S   S+S+T+ +SS   +S++SS  +S+++S   S+S+T
Sbjct: 204 SSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSST 263

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +S+S   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T
Sbjct: 264 SSSSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSST 323

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S++    ++  +++T  T STS
Sbjct: 324 SSTSSTSSSSSTSSTSSTSSTSSTSSTS 351

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 49/148 (33%), Positives = 86/148 (58%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS+ ST + +  S+   +SS+S   S+S+T+  SS   +S++SS  ++++SS   S+S+T
Sbjct: 216 SSSSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSSTSSTSST 275

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +S+S   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T
Sbjct: 276 SSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSSSST 335

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     ++  +++T  T STS
Sbjct: 336 SSTSSTSSTSSTSSTSTTSSTSSTSSTS 363

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 52/148 (35%), Positives = 88/148 (59%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           S++ ++ + + +ST+  SS++S   +SST++ +S+   SSTSSS   S+TSS   +SST+
Sbjct: 175 STSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTS 234

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  ST ++SS   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T
Sbjct: 235 SSSSTSSTSS-TSSTSSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSTSSTSSTSST 293

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     ++  +++T  T STS
Sbjct: 294 SSTSSTSSTSSTSSTSSTSSTSSTSSTS 321

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 53/148 (35%), Positives = 84/148 (56%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  S+ + +  S+   +SS S   SSS+T+  SS   SSTSS+  +S+TSS   +SST+
Sbjct: 192 SSTSSSSSTSSTSSTSSTSSTSSTSSSSSTSSTSST--SSTSSTSSSSSTSSTSSTSSTS 249

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  ST ++SS   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T
Sbjct: 250 SSSSTSSTSS-TSSTSSSSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSST 308

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     ++  +++T  + STS
Sbjct: 309 SSTSSTSSTSSTSSTSSTSSTSSSSSTS 336

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 48/148 (32%), Positives = 83/148 (56%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS  ST + +  ST   +SS S    +S+T+  +S   +S++SS  ++++SS   S+S+T
Sbjct: 132 SSTSSTSSTSSTSTTSSTSSTSSTSITSSTSSTTSTSSTSSTSSTSSTSSSSSTSSTSST 191

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  S+ +S+S   ST+S  ST ++S SS   S SST+ +   +S+ +  S +     S +
Sbjct: 192 SSTSSSSSTSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSS 251

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCSTS 76
             TSS S+     +S  +++T  T STS
Sbjct: 252 SSTSSTSSTSSTSSSSSTSSTSSTSSTS 279

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 53/146 (36%), Positives = 83/146 (56%)
 Frame = -1

Query: 519 SSAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTT 340
           SS+ ST + +  S+   SSS S   S+S+T+ +SS   SSTSS+   S+TSS   +SST+
Sbjct: 234 SSSSSTSSTSSTSSTSSSSSTSSTSSTSSTSSSSST--SSTSSTSSTSSTSSTSSTSSTS 291

Query: 339 TGVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSET 160
           +  ST ++SS   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T
Sbjct: 292 STSSTSSTSS-TSSTSSTSSTSSTSSTSSTSSTSSTSSTSSSSSTSSTSSTSSTSSTSST 350

Query: 159 VVTSSDSTAFGGGTSMFSAATGVTCS 82
             TSS S+     ++  +++T  T S
Sbjct: 351 STTSSTSSTSSTSSTSSTSSTSTTTS 376

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 48/147 (32%), Positives = 82/147 (55%)
 Frame = -1

Query: 516 SAFSTGAVTEASTAGFSSSASGFFSSSTTTGASSVFFSSTSSSFFASTTSSVLLSSSTTT 337
           S  ST + +  S+   +SS S   S+S T+  SS   +S++SS  +++++S   S+S+T+
Sbjct: 130 STSSTSSTSSTSSTSTTSSTSSTSSTSITSSTSSTTSTSSTSSTSSTSSTSSSSSTSSTS 189

Query: 336 GVSTGASSSFLISTTSGVST*ASSVSSIGFSVSSTTKSLVVTSTGA*DSVTGAGRDSETV 157
             S+ +SSS   ST+S  ST ++S +S   S SST+ +   +ST +  S +     S T 
Sbjct: 190 STSSTSSS