AV549247 ( RZ05c09R )

[UP]


[1][TOP]
>UniRef100_UPI0001739340 ATHRGP1 (HYDROXYPROLINE-RICH GLYCOPROTEIN); structural constituent
           of cell wall n=1 Tax=Arabidopsis thaliana
           RepID=UPI0001739340
          Length = 699

 Score =  249 bits (637), Expect = 5e-65
 Identities = 106/106 (100%), Positives = 106/106 (100%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP
Sbjct: 594 SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 653

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY
Sbjct: 654 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 699

 Score =  187 bits (475), Expect = 3e-46
 Identities = 90/123 (73%), Positives = 94/123 (76%), Gaps = 17/123 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV+YKSPPPPY         YSPSPKV+YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 494 SPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV-YNSPPPPYYSPSPKVYYKSP 552

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YKSPPPP YSPSPK
Sbjct: 553 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPK 612

Query: 318 TEY 326
             Y
Sbjct: 613 VYY 615

 Score =  186 bits (471), Expect = 9e-46
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 394 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 452

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 453 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 512

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 513 PPYYSPSPKVHY 524

 Score =  185 bits (470), Expect = 1e-45
 Identities = 91/125 (72%), Positives = 94/125 (75%), Gaps = 19/125 (15%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV+YKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 519 SPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 577

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYVY+SPPPPYYSPSPKVYYKSPPPP YYSPSPKV YKS          PPPP YSPS
Sbjct: 578 PPPYVYSSPPPPYYSPSPKVYYKSPPPP-YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPS 636

Query: 312 PKTEY 326
           PK  Y
Sbjct: 637 PKVVY 641

 Score =  185 bits (469), Expect = 2e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 369 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 427

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 428 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 487

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 488 PPYYSPSPKVHY 499

 Score =  184 bits (466), Expect = 3e-45
 Identities = 94/140 (67%), Positives = 96/140 (68%), Gaps = 26/140 (18%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKV+YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 469 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV-YSSPPPPYYSPSPKVHYKSP 527

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVYNSPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 528 PPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 587

Query: 291 PPSYSPSPKTEY*ISRLPLY 350
           PP YSPSPK  Y     P Y
Sbjct: 588 PPYYSPSPKVYYKSPPPPYY 607

 Score =  183 bits (464), Expect = 6e-45
 Identities = 91/132 (68%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 419 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 477

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV+YKSP        PPP YYSPSPKV YK         SPP
Sbjct: 478 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPP 537

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 538 PPYYSPSPKVYY 549

 Score =  181 bits (460), Expect = 2e-44
 Identities = 91/132 (68%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 444 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVHYKSP 502

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV+YKSP        PPP YYSPSPKV YK         SPP
Sbjct: 503 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPP 562

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 563 PPYYSPSPKVYY 574

 Score =  181 bits (458), Expect = 3e-44
 Identities = 91/132 (68%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 344 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 402

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 403 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 462

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 463 PPYYSPSPKVYY 474

 Score =  178 bits (451), Expect = 2e-43
 Identities = 86/122 (70%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 329 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVYYKSPPPPYVYSSPP 387

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 388 PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 447

Query: 321 EY 326
            Y
Sbjct: 448 YY 449

 Score =  177 bits (448), Expect = 4e-43
 Identities = 85/122 (69%), Positives = 90/122 (73%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 204 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 262

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP+YSPSPK 
Sbjct: 263 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKV 322

Query: 321 EY 326
           +Y
Sbjct: 323 DY 324

 Score =  176 bits (446), Expect = 7e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 129 PPYVYNSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 187

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 188 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 247

Query: 321 EY 326
           +Y
Sbjct: 248 DY 249

 Score =  176 bits (446), Expect = 7e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 154 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 212

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 213 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 272

Query: 321 EY 326
           +Y
Sbjct: 273 DY 274

 Score =  176 bits (445), Expect = 9e-43
 Identities = 89/132 (67%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           +P+V YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 69  APEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSP 127

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVYNSPPPPYYSPSPKV YKSP        PPP YYSPSPKVEYK         SPP
Sbjct: 128 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 187

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK +Y
Sbjct: 188 PPYYSPSPKVDY 199

 Score =  176 bits (445), Expect = 9e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 179 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 237

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 238 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 297

Query: 321 EY 326
           +Y
Sbjct: 298 DY 299

 Score =  175 bits (444), Expect = 1e-42
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 104 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 162

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 163 PPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 222

Query: 321 EY 326
           +Y
Sbjct: 223 DY 224

 Score =  173 bits (439), Expect = 5e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 229 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 287

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP  YSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 288 PPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 347

Query: 321 EY 326
           EY
Sbjct: 348 EY 349

 Score =  173 bits (438), Expect = 6e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 254 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 312

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PP YSPSPKV YKSP        PPP YYSPSPKVEYK         SPPPP+YSPSPK 
Sbjct: 313 PPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKV 372

Query: 321 EY 326
            Y
Sbjct: 373 YY 374

 Score =  172 bits (437), Expect = 8e-42
 Identities = 89/132 (67%), Positives = 91/132 (68%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 294 SPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKSP 352

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 353 PPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 412

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 413 PPYYSPSPKVYY 424

 Score =  170 bits (430), Expect = 5e-41
 Identities = 84/122 (68%), Positives = 86/122 (70%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 279 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 337

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP  YSPSPKV YK         SPPPP YSPSPK 
Sbjct: 338 PPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 397

Query: 321 EY 326
            Y
Sbjct: 398 YY 399

 Score =  166 bits (421), Expect = 6e-40
 Identities = 81/125 (64%), Positives = 88/125 (70%), Gaps = 17/125 (13%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           +  P  Y  S PPP Y+P+P+V YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+
Sbjct: 51  KTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYV-YSSPPPPTYSPSPKVDYKSPPPPYVYS 109

Query: 183 SPPPPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYK---------SPPPPSYSPS 311
           SPPPPYYSPSPKV YKSPPPP         YYSPSPKV+YK         SPPPP YSPS
Sbjct: 110 SPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPS 169

Query: 312 PKTEY 326
           PK EY
Sbjct: 170 PKVEY 174

 Score =  151 bits (381), Expect = 2e-35
 Identities = 74/118 (62%), Positives = 83/118 (70%), Gaps = 17/118 (14%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y SPPP Y SP P+V YK+PP P+V     PPP Y+P+P+V YKSPPPPYVY+SPPPP Y
Sbjct: 34  YASPPPLYSSPLPEVEYKTPPLPYVD--SSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTY 91

Query: 204 SPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKTEY 326
           SPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK +Y
Sbjct: 92  SPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDY 149

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 16/69 (23%)
 Frame = +3

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPP-------PPSYYSPSPKVEYK---------SPPPPS 299
           P  Y SPPP Y SP P+V YK+PP       PP  Y+P+P+VEYK         SPPPP+
Sbjct: 31  PETYASPPPLYSSPLPEVEYKTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPT 90

Query: 300 YSPSPKTEY 326
           YSPSPK +Y
Sbjct: 91  YSPSPKVDY 99

[2][TOP]
>UniRef100_Q9M1G9 Extensin-2 n=1 Tax=Arabidopsis thaliana RepID=EXTN2_ARATH
          Length = 743

 Score =  249 bits (637), Expect = 5e-65
 Identities = 106/106 (100%), Positives = 106/106 (100%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP
Sbjct: 638 SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 697

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY
Sbjct: 698 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 743

 Score =  187 bits (475), Expect = 3e-46
 Identities = 90/123 (73%), Positives = 94/123 (76%), Gaps = 17/123 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV+YKSPPPPY         YSPSPKV+YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 538 SPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV-YNSPPPPYYSPSPKVYYKSP 596

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YKSPPPP YSPSPK
Sbjct: 597 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPK 656

Query: 318 TEY 326
             Y
Sbjct: 657 VYY 659

 Score =  186 bits (471), Expect = 9e-46
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 438 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 496

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 497 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 556

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 557 PPYYSPSPKVHY 568

 Score =  185 bits (470), Expect = 1e-45
 Identities = 91/125 (72%), Positives = 94/125 (75%), Gaps = 19/125 (15%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV+YKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 563 SPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 621

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYVY+SPPPPYYSPSPKVYYKSPPPP YYSPSPKV YKS          PPPP YSPS
Sbjct: 622 PPPYVYSSPPPPYYSPSPKVYYKSPPPP-YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPS 680

Query: 312 PKTEY 326
           PK  Y
Sbjct: 681 PKVVY 685

 Score =  185 bits (469), Expect = 2e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 413 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 471

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 472 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 531

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 532 PPYYSPSPKVHY 543

 Score =  184 bits (466), Expect = 3e-45
 Identities = 94/140 (67%), Positives = 96/140 (68%), Gaps = 26/140 (18%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKV+YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 513 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV-YSSPPPPYYSPSPKVHYKSP 571

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVYNSPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 572 PPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 631

Query: 291 PPSYSPSPKTEY*ISRLPLY 350
           PP YSPSPK  Y     P Y
Sbjct: 632 PPYYSPSPKVYYKSPPPPYY 651

 Score =  183 bits (464), Expect = 6e-45
 Identities = 91/132 (68%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 463 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 521

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV+YKSP        PPP YYSPSPKV YK         SPP
Sbjct: 522 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPP 581

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 582 PPYYSPSPKVYY 593

 Score =  181 bits (460), Expect = 2e-44
 Identities = 91/132 (68%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 488 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVHYKSP 546

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV+YKSP        PPP YYSPSPKV YK         SPP
Sbjct: 547 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPP 606

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 607 PPYYSPSPKVYY 618

 Score =  181 bits (458), Expect = 3e-44
 Identities = 91/132 (68%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 388 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 446

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 447 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 506

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 507 PPYYSPSPKVYY 518

 Score =  178 bits (451), Expect = 2e-43
 Identities = 86/122 (70%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 373 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVYYKSPPPPYVYSSPP 431

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 432 PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 491

Query: 321 EY 326
            Y
Sbjct: 492 YY 493

 Score =  177 bits (449), Expect = 3e-43
 Identities = 86/122 (70%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 123 PPYVYNSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 181

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKVEYK         SPPPP YSPSPK 
Sbjct: 182 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKV 241

Query: 321 EY 326
           +Y
Sbjct: 242 DY 243

 Score =  177 bits (448), Expect = 4e-43
 Identities = 85/122 (69%), Positives = 90/122 (73%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 248 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 306

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP+YSPSPK 
Sbjct: 307 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKV 366

Query: 321 EY 326
           +Y
Sbjct: 367 DY 368

 Score =  176 bits (447), Expect = 5e-43
 Identities = 86/122 (70%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 98  PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 156

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 157 PPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 216

Query: 321 EY 326
           EY
Sbjct: 217 EY 218

 Score =  176 bits (447), Expect = 5e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 148 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 206

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 207 PPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 266

Query: 321 EY 326
           +Y
Sbjct: 267 DY 268

 Score =  176 bits (446), Expect = 7e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 173 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 231

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 232 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 291

Query: 321 EY 326
           +Y
Sbjct: 292 DY 293

 Score =  176 bits (446), Expect = 7e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 198 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 256

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 257 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 316

Query: 321 EY 326
           +Y
Sbjct: 317 DY 318

 Score =  176 bits (445), Expect = 9e-43
 Identities = 89/132 (67%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           +P+V YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 63  APEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSP 121

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVYNSPPPPYYSPSPKV YKSP        PPP YYSPSPKVEYK         SPP
Sbjct: 122 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 181

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK +Y
Sbjct: 182 PPYYSPSPKVDY 193

 Score =  176 bits (445), Expect = 9e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 223 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 281

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 282 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 341

Query: 321 EY 326
           +Y
Sbjct: 342 DY 343

 Score =  173 bits (439), Expect = 5e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 273 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 331

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP  YSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 332 PPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 391

Query: 321 EY 326
           EY
Sbjct: 392 EY 393

 Score =  173 bits (438), Expect = 6e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 298 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 356

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PP YSPSPKV YKSP        PPP YYSPSPKVEYK         SPPPP+YSPSPK 
Sbjct: 357 PPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKV 416

Query: 321 EY 326
            Y
Sbjct: 417 YY 418

 Score =  172 bits (437), Expect = 8e-42
 Identities = 89/132 (67%), Positives = 91/132 (68%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 338 SPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKSP 396

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 397 PPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 456

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 457 PPYYSPSPKVYY 468

 Score =  170 bits (430), Expect = 5e-41
 Identities = 84/122 (68%), Positives = 86/122 (70%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 323 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 381

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP  YSPSPKV YK         SPPPP YSPSPK 
Sbjct: 382 PPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 441

Query: 321 EY 326
            Y
Sbjct: 442 YY 443

 Score =  166 bits (421), Expect = 6e-40
 Identities = 81/125 (64%), Positives = 88/125 (70%), Gaps = 17/125 (13%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           +  P  Y  S PPP Y+P+P+V YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+
Sbjct: 45  KTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYV-YSSPPPPTYSPSPKVDYKSPPPPYVYS 103

Query: 183 SPPPPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYK---------SPPPPSYSPS 311
           SPPPPYYSPSPKV YKSPPPP         YYSPSPKV+YK         SPPPP YSPS
Sbjct: 104 SPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPS 163

Query: 312 PKTEY 326
           PK EY
Sbjct: 164 PKVEY 168

 Score =  151 bits (381), Expect = 2e-35
 Identities = 74/118 (62%), Positives = 83/118 (70%), Gaps = 17/118 (14%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y SPPP Y SP P+V YK+PP P+V     PPP Y+P+P+V YKSPPPPYVY+SPPPP Y
Sbjct: 28  YASPPPLYSSPLPEVEYKTPPLPYVD--SSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTY 85

Query: 204 SPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKTEY 326
           SPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK +Y
Sbjct: 86  SPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDY 143

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 16/69 (23%)
 Frame = +3

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPP-------PPSYYSPSPKVEYK---------SPPPPS 299
           P  Y SPPP Y SP P+V YK+PP       PP  Y+P+P+VEYK         SPPPP+
Sbjct: 25  PETYASPPPLYSSPLPEVEYKTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPT 84

Query: 300 YSPSPKTEY 326
           YSPSPK +Y
Sbjct: 85  YSPSPKVDY 93

[3][TOP]
>UniRef100_Q9M1H0 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9M1H0_ARATH
          Length = 951

 Score =  218 bits (556), Expect = 1e-55
 Identities = 97/123 (78%), Positives = 101/123 (82%), Gaps = 17/123 (13%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
            SPKVYYKSPPPPY         YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP
Sbjct: 654  SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 713

Query: 162  PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSPK 317
            PPPYVY+SPPPP+YSPSPKVYYKSP        PPP YYSPSPKV YKSPPPP Y+P+PK
Sbjct: 714  PPPYVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPK 773

Query: 318  TEY 326
              Y
Sbjct: 774  VHY 776

 Score =  184 bits (468), Expect = 2e-45
 Identities = 90/123 (73%), Positives = 92/123 (74%), Gaps = 17/123 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 438 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 496

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYKSPPPPSYSPSPK 317
           PPPYVY+SPPPPYYSPSPKVYYKSPPPP         YYSPSPKV YKSPPPP YSPSPK
Sbjct: 497 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPK 556

Query: 318 TEY 326
             Y
Sbjct: 557 VYY 559

 Score =  184 bits (468), Expect = 2e-45
 Identities = 87/123 (70%), Positives = 95/123 (77%), Gaps = 17/123 (13%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
            SPKV+YKSPPPPYY+P+PKV+YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SP
Sbjct: 755  SPKVHYKSPPPPYYAPTPKVHYKSPPPPYV-YSSPPPPYYSPSPKVHYKSPPPPYVYSSP 813

Query: 189  PPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPK 317
            PPPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK
Sbjct: 814  PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPK 873

Query: 318  TEY 326
             +Y
Sbjct: 874  VDY 876

 Score =  184 bits (467), Expect = 3e-45
 Identities = 87/114 (76%), Positives = 89/114 (78%), Gaps = 9/114 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 473 PPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 531

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYK---------SPPPPSYSPSPKTEY 326
           PPYYSPSPKVYYKSPPPP YYSPSPKV YK         SPPPP YSPSPK  Y
Sbjct: 532 PPYYSPSPKVYYKSPPPP-YYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYY 584

 Score =  182 bits (463), Expect = 8e-45
 Identities = 92/147 (62%), Positives = 95/147 (64%), Gaps = 41/147 (27%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPP----------------------- 119
           SPKVYYKSPPPPYYSPSPKVYYKSPP P+V   PPPP                       
Sbjct: 538 SPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 597

Query: 120 -PCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKV 272
            P +SPSPKV YKSPPPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV
Sbjct: 598 PPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 657

Query: 273 EYK---------SPPPPSYSPSPKTEY 326
            YK         SPPPP YSPSPK  Y
Sbjct: 658 YYKSPPPPYVYSSPPPPYYSPSPKVYY 684

 Score =  180 bits (457), Expect = 4e-44
 Identities = 92/147 (62%), Positives = 96/147 (65%), Gaps = 41/147 (27%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPP-------------- 119
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V   PPPP              
Sbjct: 488 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPP 547

Query: 120 -PCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKV 272
            P YSPSPKV YKSPPPPYVY+SPPPPYYSPSPKVYYKSP        PPP Y+SPSPKV
Sbjct: 548 PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKV 607

Query: 273 EYK---------SPPPPSYSPSPKTEY 326
           +YK         SPPPP YSPSPK  Y
Sbjct: 608 QYKSPPPPYVYSSPPPPYYSPSPKVYY 634

 Score =  179 bits (455), Expect = 6e-44
 Identities = 88/122 (72%), Positives = 90/122 (73%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 831  PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 889

Query: 192  PPYYSPSPKVYYKSP--------PPPSYYSPSPKVE---------YKSPPPPSYSPSPKT 320
            PPYYSPSP V YKSP        PPP YYSPSPKVE         YKSPPPPSYSPSPKT
Sbjct: 890  PPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYKSPPPPSYSPSPKT 949

Query: 321  EY 326
            EY
Sbjct: 950  EY 951

 Score =  179 bits (454), Expect = 8e-44
 Identities = 90/133 (67%), Positives = 93/133 (69%), Gaps = 27/133 (20%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         +SPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 579 SPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 637

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKS----------P 287
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YKS          P
Sbjct: 638 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPP 697

Query: 288 PPPSYSPSPKTEY 326
           PPP YSPSPK  Y
Sbjct: 698 PPPCYSPSPKVVY 710

 Score =  177 bits (450), Expect = 2e-43
 Identities = 88/130 (67%), Positives = 90/130 (69%), Gaps = 17/130 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 423 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 481

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 482 PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 541

Query: 321 EY*ISRLPLY 350
            Y     P Y
Sbjct: 542 YYKSPPPPYY 551

 Score =  177 bits (450), Expect = 2e-43
 Identities = 86/123 (69%), Positives = 88/123 (71%), Gaps = 18/123 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 614 PPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 672

Query: 192 PPYYSPSPKVYYKS---------PPPPSYYSPSPKVEYK---------SPPPPSYSPSPK 317
           PPYYSPSPKVYYKS         PPPP  YSPSPKV YK         SPPPP YSPSPK
Sbjct: 673 PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPK 732

Query: 318 TEY 326
             Y
Sbjct: 733 VYY 735

 Score =  177 bits (449), Expect = 3e-43
 Identities = 87/125 (69%), Positives = 92/125 (73%), Gaps = 19/125 (15%)
 Frame = +3

Query: 9    SPKVYYKS----------PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
            SPKVYYKS          PPPP YSPSPKV YKSPP P+V    PPPP YSPSPKV YKS
Sbjct: 679  SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV-YSSPPPPHYSPSPKVYYKS 737

Query: 159  PPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYK---------SPPPPSYSPS 311
            PPPPYVY+SPPPPYYSPSPKV+YKSPPPP YY+P+PKV YK         SPPPP YSPS
Sbjct: 738  PPPPYVYSSPPPPYYSPSPKVHYKSPPPP-YYAPTPKVHYKSPPPPYVYSSPPPPYYSPS 796

Query: 312  PKTEY 326
            PK  Y
Sbjct: 797  PKVHY 801

 Score =  177 bits (448), Expect = 4e-43
 Identities = 90/147 (61%), Positives = 96/147 (65%), Gaps = 41/147 (27%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPP-------------- 119
            SPKV YKSPPPPY         YSPSPKVYYKSPP P+V   PPPP              
Sbjct: 705  SPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPP 764

Query: 120  -PCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKV 272
             P Y+P+PKV YKSPPPPYVY+SPPPPYYSPSPKV+YKSP        PPP YYSPSPKV
Sbjct: 765  PPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKV 824

Query: 273  EYK---------SPPPPSYSPSPKTEY 326
            EYK         SPPPP YSPSPK +Y
Sbjct: 825  EYKSPPPPYVYSSPPPPYYSPSPKVDY 851

 Score =  176 bits (447), Expect = 5e-43
 Identities = 86/122 (70%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 248 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 306

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP  YSPSPKVEYK         SPPPP+YSPSPK 
Sbjct: 307 PPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKV 366

Query: 321 EY 326
           EY
Sbjct: 367 EY 368

 Score =  176 bits (445), Expect = 9e-43
 Identities = 89/132 (67%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 113 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVEYKSP 171

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKV YKSPPPP         YYSPSPKVEYK         SPP
Sbjct: 172 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 231

Query: 291 PPSYSPSPKTEY 326
           PP+YSPSPK +Y
Sbjct: 232 PPTYSPSPKVDY 243

 Score =  176 bits (445), Expect = 9e-43
 Identities = 89/132 (67%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 338 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVEYKSP 396

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKV YKSPPPP         YYSPSPKVEYK         SPP
Sbjct: 397 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 456

Query: 291 PPSYSPSPKTEY 326
           PP+YSPSPK +Y
Sbjct: 457 PPTYSPSPKVDY 468

 Score =  176 bits (445), Expect = 9e-43
 Identities = 89/132 (67%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
            SPKV+YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 796  SPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVDYKSP 854

Query: 162  PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
            PPPYVY+SPPPPYYSPSPKV YKSP        PPP YYSPSP V+YK         SPP
Sbjct: 855  PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPP 914

Query: 291  PPSYSPSPKTEY 326
            PP YSPSPK EY
Sbjct: 915  PPYYSPSPKVEY 926

 Score =  175 bits (444), Expect = 1e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV+YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 781  PPYVYSSPPPPYYSPSPKVHYKSPPPPYV-YSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 839

Query: 192  PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
            PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSP  
Sbjct: 840  PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVV 899

Query: 321  EY 326
            +Y
Sbjct: 900  DY 901

 Score =  175 bits (443), Expect = 2e-42
 Identities = 89/132 (67%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 163 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVEYKSP 221

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKV YKSP        PPP YYSPSPKVEYK         SPP
Sbjct: 222 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 281

Query: 291 PPSYSPSPKTEY 326
           PP+YSPSPK +Y
Sbjct: 282 PPTYSPSPKVDY 293

 Score =  174 bits (442), Expect = 2e-42
 Identities = 89/132 (67%), Positives = 92/132 (69%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 138 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVEYKSP 196

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV YKSP        PPP  YSPSPKV+YK         SPP
Sbjct: 197 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 256

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK EY
Sbjct: 257 PPYYSPSPKVEY 268

 Score =  174 bits (442), Expect = 2e-42
 Identities = 89/132 (67%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 213 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKSP 271

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKV YKSP        PPP YYSPSPKV+YK         SPP
Sbjct: 272 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 331

Query: 291 PPSYSPSPKTEY 326
           PP+YSPSPK EY
Sbjct: 332 PPTYSPSPKVEY 343

 Score =  173 bits (439), Expect = 5e-42
 Identities = 84/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 198 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 256

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP  YSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 257 PPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 316

Query: 321 EY 326
           +Y
Sbjct: 317 DY 318

 Score =  173 bits (439), Expect = 5e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 298 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 356

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PP YSPSPKV YKSP        PPP  YSPSPKVEYK         SPPPP+YSPSPK 
Sbjct: 357 PPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKV 416

Query: 321 EY 326
           EY
Sbjct: 417 EY 418

 Score =  172 bits (436), Expect = 1e-41
 Identities = 89/132 (67%), Positives = 91/132 (68%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 88  SPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVEYKSP 146

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKV YKSP        PPP  YSPSPKVEYK         SPP
Sbjct: 147 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 206

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK EY
Sbjct: 207 PPYYSPSPKVEY 218

 Score =  172 bits (436), Expect = 1e-41
 Identities = 89/132 (67%), Positives = 92/132 (69%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 263 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSP 321

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKV YKSP        PPP  YSPSPKVEYK         SPP
Sbjct: 322 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 381

Query: 291 PPSYSPSPKTEY 326
           PP+YSPSPK EY
Sbjct: 382 PPTYSPSPKVEY 393

 Score =  172 bits (435), Expect = 1e-41
 Identities = 89/132 (67%), Positives = 91/132 (68%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 313 SPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVEYKSP 371

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKV YKSP        PPP  YSPSPKVEYK         SPP
Sbjct: 372 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 431

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK EY
Sbjct: 432 PPYYSPSPKVEY 443

 Score =  172 bits (435), Expect = 1e-41
 Identities = 88/132 (66%), Positives = 91/132 (68%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 363 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVEYKSP 421

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV YKSP        PPP  YSPSPKV+YK         SPP
Sbjct: 422 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 481

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 482 PPYYSPSPKVYY 493

 Score =  171 bits (432), Expect = 3e-41
 Identities = 87/132 (65%), Positives = 92/132 (69%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           +P+V YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 63  APEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV-YSSPPPPTYSPSPKVEYKSP 121

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKV YKSP        PPP  YSPSPKVEYK         SPP
Sbjct: 122 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 181

Query: 291 PPSYSPSPKTEY 326
           PP+YSPSPK EY
Sbjct: 182 PPTYSPSPKVEY 193

 Score =  169 bits (429), Expect = 7e-41
 Identities = 88/132 (66%), Positives = 90/132 (68%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 388 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVEYKSP 446

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPP YSPSPKV YKSP        PPP YYSPSPKV YK         SPP
Sbjct: 447 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 506

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 507 PPYYSPSPKVYY 518

 Score =  164 bits (416), Expect = 2e-39
 Identities = 83/130 (63%), Positives = 90/130 (69%), Gaps = 25/130 (19%)
 Frame = +3

Query: 12  PKVYYKSPP--------PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP 167
           PK+ YK+PP        PP YSP+P+V YKSPP P+V    PPPP YSPSPKV YKSPPP
Sbjct: 40  PKIEYKTPPLPYIDSSPPPTYSPAPEVEYKSPPPPYV-YSSPPPPTYSPSPKVEYKSPPP 98

Query: 168 PYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPP 296
           PYVY+SPPPP YSPSPKV YKSP        PPP  YSPSPKVEYK         SPPPP
Sbjct: 99  PYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 158

Query: 297 SYSPSPKTEY 326
           +YSPSPK EY
Sbjct: 159 TYSPSPKVEY 168

 Score =  151 bits (381), Expect = 2e-35
 Identities = 74/116 (63%), Positives = 82/116 (70%), Gaps = 17/116 (14%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPP Y SP PK+ YK+PP P++     PPP YSP+P+V YKSPPPPYVY+SPPPP YSP
Sbjct: 30  SPPPLYSSPLPKIEYKTPPLPYID--SSPPPTYSPAPEVEYKSPPPPYVYSSPPPPTYSP 87

Query: 210 SPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKTEY 326
           SPKV YKSP        PPP  YSPSPKVEYK         SPPPP+YSPSPK EY
Sbjct: 88  SPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEY 143

[4][TOP]
>UniRef100_Q9LJK0 Genomic DNA, chromosome 3, P1 clone: MZN14 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LJK0_ARATH
          Length = 1018

 Score =  206 bits (523), Expect = 8e-52
 Identities = 93/123 (75%), Positives = 98/123 (79%), Gaps = 17/123 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPKVYYKSPP PY++PSPKV YKSPPHPHVCVCPPPPPCYSPSPKVVYKS PPPYVY+SP
Sbjct: 605 SPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSP 664

Query: 189 PPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPK 317
           PPPY+SPSPKV+YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK
Sbjct: 665 PPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPK 724

Query: 318 TEY 326
             Y
Sbjct: 725 VVY 727

 Score =  183 bits (464), Expect = 6e-45
 Identities = 87/114 (76%), Positives = 91/114 (79%), Gaps = 9/114 (7%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSP+PKV YKSPPPPYVY+SPP
Sbjct: 907  PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPAPKVDYKSPPPPYVYSSPP 965

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYK---------SPPPPSYSPSPKTEY 326
            PPYYSPSPKV YKSPPPP YYSPSPKV+YK         SPPPPSYSPSPKTEY
Sbjct: 966  PPYYSPSPKVDYKSPPPP-YYSPSPKVDYKSPPPPYVYSSPPPPSYSPSPKTEY 1018

 Score =  182 bits (462), Expect = 1e-44
 Identities = 84/113 (74%), Positives = 89/113 (78%), Gaps = 8/113 (7%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 882  PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 940

Query: 192  PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            PPYYSP+PKV YKSP        PPP YYSPSPKV+YKSPPPP YSPSPK +Y
Sbjct: 941  PPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDY 993

 Score =  180 bits (456), Expect = 5e-44
 Identities = 86/122 (70%), Positives = 90/122 (73%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSPPPPYVY+SPP
Sbjct: 782  PPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 840

Query: 192  PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
            PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 841  PPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 900

Query: 321  EY 326
            +Y
Sbjct: 901  DY 902

 Score =  179 bits (454), Expect = 8e-44
 Identities = 90/132 (68%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
            SPKV+YKSPPPPY         YSPSPKV+YKSPP P+V    PPPP YSPSPKVVYKSP
Sbjct: 672  SPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV-YSSPPPPYYSPSPKVVYKSP 730

Query: 162  PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
            PPPYVY+SPPPPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPP
Sbjct: 731  PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 790

Query: 291  PPSYSPSPKTEY 326
            PP YSPSPK  Y
Sbjct: 791  PPYYSPSPKVVY 802

 Score =  179 bits (454), Expect = 8e-44
 Identities = 86/122 (70%), Positives = 90/122 (73%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSPPPPYVY+SPP
Sbjct: 807  PPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 865

Query: 192  PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
            PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 866  PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 925

Query: 321  EY 326
            +Y
Sbjct: 926  DY 927

 Score =  178 bits (452), Expect = 1e-43
 Identities = 86/122 (70%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSPPPPYVY+SPP
Sbjct: 757  PPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 815

Query: 192  PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
            PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 816  PPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKV 875

Query: 321  EY 326
            +Y
Sbjct: 876  DY 877

 Score =  178 bits (451), Expect = 2e-43
 Identities = 83/113 (73%), Positives = 87/113 (76%), Gaps = 8/113 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSPPPPYVY+SPP
Sbjct: 515 PPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 573

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPYYSPSPKV YKSP        PPP YYSPSPKV YKSPP P ++PSPK  Y
Sbjct: 574 PPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLY 626

 Score =  178 bits (451), Expect = 2e-43
 Identities = 90/132 (68%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
            SPKV+YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSP
Sbjct: 697  SPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVVYKSP 755

Query: 162  PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
            PPPYVY+SPPPPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPP
Sbjct: 756  PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 815

Query: 291  PPSYSPSPKTEY 326
            PP YSPSPK  Y
Sbjct: 816  PPYYSPSPKVVY 827

 Score =  177 bits (449), Expect = 3e-43
 Identities = 89/123 (72%), Positives = 93/123 (75%), Gaps = 17/123 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           +PKV YKSPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SP
Sbjct: 64  APKVDYKSPPPPYYSPSPKVEYKSPPPPYV-YNSPPPPYYSPSPKVDYKSPPPPYVYSSP 122

Query: 189 PPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSP--------PPPS-YSPSPK 317
           PPP YSPSPKV YKSP        PPP YYSPSPKVEYKSP        PPPS YSPSPK
Sbjct: 123 PPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPSPYVYNSPPPSYYSPSPK 182

Query: 318 TEY 326
            +Y
Sbjct: 183 VDY 185

 Score =  177 bits (448), Expect = 4e-43
 Identities = 86/122 (70%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 90  PPYVYNSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPIYSPSPKVDYKSPPPPYVYSSPP 148

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPPSYYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 149 PPYYSPSPKVEYKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 208

Query: 321 EY 326
            Y
Sbjct: 209 VY 210

 Score =  177 bits (448), Expect = 4e-43
 Identities = 86/122 (70%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSPPPPYVY+SPP
Sbjct: 490 PPYVYSSPPPPYYSPSPKVLYKSPPPPYV-YSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 548

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 549 PPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKV 608

Query: 321 EY 326
            Y
Sbjct: 609 YY 610

 Score =  177 bits (448), Expect = 4e-43
 Identities = 86/122 (70%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSPPPPYVY+SPP
Sbjct: 732  PPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 790

Query: 192  PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
            PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 791  PPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKV 850

Query: 321  EY 326
             Y
Sbjct: 851  VY 852

 Score =  176 bits (447), Expect = 5e-43
 Identities = 84/115 (73%), Positives = 88/115 (76%), Gaps = 10/115 (8%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSPPPPYVY+SPP
Sbjct: 540 PPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 598

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKS----------PPPPSYSPSPKTEY 326
           PPYYSPSPKVYYKSPP P Y++PSPKV YKS          PPPP YSPSPK  Y
Sbjct: 599 PPYYSPSPKVYYKSPPSP-YHAPSPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVY 652

 Score =  176 bits (446), Expect = 7e-43
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPK+VYKSPPPPYVY+SPP
Sbjct: 340 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKIVYKSPPPPYVYSSPP 398

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYY+PSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 399 PPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 458

Query: 321 EY 326
            Y
Sbjct: 459 VY 460

 Score =  176 bits (446), Expect = 7e-43
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK+ YKSPP P+V    PPPP Y+PSPKVVYKSPPPPYVY+SPP
Sbjct: 365 PPYVYSSPPPPYYSPSPKIVYKSPPPPYV-YSSPPPPYYTPSPKVVYKSPPPPYVYSSPP 423

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 424 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKV 483

Query: 321 EY 326
           +Y
Sbjct: 484 DY 485

 Score =  176 bits (445), Expect = 9e-43
 Identities = 83/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK+ YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 240 PPYVYSSPPPPYYSPSPKIVYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 298

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSP+PKV+YK         SPPPP YSPSPK 
Sbjct: 299 PPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKV 358

Query: 321 EY 326
           +Y
Sbjct: 359 DY 360

 Score =  175 bits (444), Expect = 1e-42
 Identities = 84/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 190 PPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 248

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK+ YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 249 PPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 308

Query: 321 EY 326
            Y
Sbjct: 309 VY 310

 Score =  175 bits (444), Expect = 1e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPK+VYKSPPPPYVY+SPP
Sbjct: 215 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKIVYKSPPPPYVYSSPP 273

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSP+PK 
Sbjct: 274 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKV 333

Query: 321 EY 326
           +Y
Sbjct: 334 DY 335

 Score =  175 bits (444), Expect = 1e-42
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSPPPPYVY+SPP
Sbjct: 265 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 323

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSP+PKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 324 PPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKI 383

Query: 321 EY 326
            Y
Sbjct: 384 VY 385

 Score =  175 bits (444), Expect = 1e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 832  PPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 890

Query: 192  PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
            PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSP+PK 
Sbjct: 891  PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKV 950

Query: 321  EY 326
            +Y
Sbjct: 951  DY 952

 Score =  175 bits (443), Expect = 2e-42
 Identities = 86/122 (70%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSPPPPYVY+SPP
Sbjct: 415 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 473

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 474 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKV 533

Query: 321 EY 326
            Y
Sbjct: 534 VY 535

 Score =  175 bits (443), Expect = 2e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV+YKSPPPPYVY+SPP
Sbjct: 465 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVLYKSPPPPYVYSSPP 523

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 524 PPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKV 583

Query: 321 EY 326
            Y
Sbjct: 584 VY 585

 Score =  175 bits (443), Expect = 2e-42
 Identities = 86/130 (66%), Positives = 91/130 (70%), Gaps = 17/130 (13%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 857  PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 915

Query: 192  PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
            PPYYSPSPKV YKSP        PPP YYSP+PKV+YK         SPPPP YSPSPK 
Sbjct: 916  PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKV 975

Query: 321  EY*ISRLPLY 350
            +Y     P Y
Sbjct: 976  DYKSPPPPYY 985

 Score =  174 bits (441), Expect = 3e-42
 Identities = 84/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYY+PSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 390 PPYVYSSPPPPYYTPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 448

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 449 PPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 508

Query: 321 EY 326
            Y
Sbjct: 509 LY 510

 Score =  174 bits (441), Expect = 3e-42
 Identities = 85/122 (69%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 440 PPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 498

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 499 PPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKV 558

Query: 321 EY 326
            Y
Sbjct: 559 VY 560

 Score =  173 bits (438), Expect = 6e-42
 Identities = 88/132 (66%), Positives = 92/132 (69%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPP PY         YSPSPKV YKSPP P+V    PPPP YSPSPKVVYKSP
Sbjct: 155 SPKVEYKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVVYKSP 213

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV YKSP        PPP YYSPSPK+ YK         SPP
Sbjct: 214 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPP 273

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK +Y
Sbjct: 274 PPYYSPSPKVDY 285

 Score =  172 bits (436), Expect = 1e-41
 Identities = 82/122 (67%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSP+PKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 315 PPYVYSSPPPPYYSPTPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 373

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK+ YKSP        PPP YY+PSPKV YK         SPPPP YSPSPK 
Sbjct: 374 PPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKV 433

Query: 321 EY 326
           +Y
Sbjct: 434 DY 435

 Score =  171 bits (434), Expect = 2e-41
 Identities = 84/122 (68%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPP  YSPSPKV YKSPPPPYVY+SPP
Sbjct: 140 PPYVYSSPPPPYYSPSPKVEYKSPPSPYV-YNSPPPSYYSPSPKVDYKSPPPPYVYSSPP 198

Query: 192 PPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSPPPP         YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 199 PPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKI 258

Query: 321 EY 326
            Y
Sbjct: 259 VY 260

 Score =  171 bits (432), Expect = 3e-41
 Identities = 82/122 (67%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSP+PKV YKSPPPPYVY+SPP
Sbjct: 290 PPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 348

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPK+ YK         SPPPP Y+PSPK 
Sbjct: 349 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKV 408

Query: 321 EY 326
            Y
Sbjct: 409 VY 410

 Score =  169 bits (429), Expect = 7e-41
 Identities = 88/132 (66%), Positives = 90/132 (68%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 105 SPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKSP 163

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           P PYVYNSPPP YYSPSPKV YKSP        PPP YYSPSPKV YK         SPP
Sbjct: 164 PSPYVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 223

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK +Y
Sbjct: 224 PPYYSPSPKVDY 235

 Score =  157 bits (398), Expect = 3e-37
 Identities = 83/140 (59%), Positives = 86/140 (61%), Gaps = 33/140 (23%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPP----------------PCYSPS 137
           A+ + Y  S PPPY  P PKV YKSPP P V   PPPP                P YSPS
Sbjct: 21  AAYEPYTDSSPPPYSVPLPKVEYKSPPLPDVYSSPPPPLEYSPAPKVDYKSPPPPYYSPS 80

Query: 138 PKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---- 281
           PKV YKSPPPPYVYNSPPPPYYSPSPKV YKSP        PPP  YSPSPKV+YK    
Sbjct: 81  PKVEYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPP 140

Query: 282 -----SPPPPSYSPSPKTEY 326
                SPPPP YSPSPK EY
Sbjct: 141 PYVYSSPPPPYYSPSPKVEY 160

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 32/62 (51%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +3

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP-SYSPSPKTEY*ISRLP 344
           PY  +S PPPY  P PKV YKSPP P  YS        SPPPP  YSP+PK +Y     P
Sbjct: 25  PYT-DSSPPPYSVPLPKVEYKSPPLPDVYS--------SPPPPLEYSPAPKVDYKSPPPP 75

Query: 345 LY 350
            Y
Sbjct: 76  YY 77

[5][TOP]
>UniRef100_Q9SK35 Putative uncharacterized protein At2g24980 n=1 Tax=Arabidopsis
           thaliana RepID=Q9SK35_ARATH
          Length = 559

 Score =  186 bits (472), Expect = 7e-46
 Identities = 93/132 (70%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 340 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 398

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVYNSPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 399 PPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 458

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 459 PPYYSPSPKVYY 470

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 190 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 248

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 249 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 308

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 309 PPYYSPSPKVYY 320

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 215 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 273

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 274 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 333

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 334 PPYYSPSPKVYY 345

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 240 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 298

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 299 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 358

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 359 PPYYSPSPKVYY 370

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 265 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 323

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 324 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 383

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 384 PPYYSPSPKVYY 395

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 290 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 348

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 349 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPP 408

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 409 PPYYSPSPKVYY 420

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 315 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 373

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 374 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPP 433

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 434 PPYYSPSPKVYY 445

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 390 SPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 448

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 449 PPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPP 508

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 509 PPYYSPSPKVYY 520

 Score =  183 bits (465), Expect = 4e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 365 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YNSPPPPYYSPSPKVYYKSP 423

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 424 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPP 483

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 484 PPYYSPSPKVYY 495

 Score =  181 bits (460), Expect = 2e-44
 Identities = 91/132 (68%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 415 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 473

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PP YVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 474 PPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 533

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 534 PPYYSPSPKVTY 545

 Score =  181 bits (459), Expect = 2e-44
 Identities = 87/122 (71%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 175 PPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 233

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 234 PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 293

Query: 321 EY 326
            Y
Sbjct: 294 YY 295

 Score =  177 bits (449), Expect = 3e-43
 Identities = 86/122 (70%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 150 PPYVYNSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 208

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 209 PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 268

Query: 321 EY 326
            Y
Sbjct: 269 YY 270

 Score =  176 bits (445), Expect = 9e-43
 Identities = 86/122 (70%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 125 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 183

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 184 PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 243

Query: 321 EY 326
            Y
Sbjct: 244 YY 245

 Score =  174 bits (442), Expect = 2e-42
 Identities = 86/122 (70%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVYNSPP
Sbjct: 100 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 158

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 159 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 218

Query: 321 EY 326
            Y
Sbjct: 219 YY 220

 Score =  174 bits (441), Expect = 3e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 75  PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 133

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 134 PPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 193

Query: 321 EY 326
            Y
Sbjct: 194 YY 195

 Score =  173 bits (438), Expect = 6e-42
 Identities = 84/119 (70%), Positives = 86/119 (72%), Gaps = 17/119 (14%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P      PPPP YSPSPKV YKSP
Sbjct: 440 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPP-PSYVYSSPPPPYYSPSPKVYYKSP 498

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP YVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YKSPPPP    +P
Sbjct: 499 PPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPPPYVYKTP 557

 Score =  171 bits (433), Expect = 2e-41
 Identities = 85/123 (69%), Positives = 90/123 (73%), Gaps = 18/123 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPP-YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           PK Y KS PPP YY+PSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SP
Sbjct: 49  PKPYVKSSPPPQYYTPSPKVNYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSP 107

Query: 189 PPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPK 317
           PPPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK
Sbjct: 108 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPK 167

Query: 318 TEY 326
            +Y
Sbjct: 168 VDY 170

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 56/113 (49%), Positives = 62/113 (54%), Gaps = 18/113 (15%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKV 221
           PY SP    Y  SP + H        P Y+P PK        PYV +SPPP YY+PSPKV
Sbjct: 24  PYSSPQTPSY-NSPSYEH------KGPKYAPHPK--------PYVKSSPPPQYYTPSPKV 68

Query: 222 YYKSPPPPSY---------YSPSPKVEYK---------SPPPPSYSPSPKTEY 326
            YKSPPPP Y         YSPSPKV+YK         SPPPP YSPSPK +Y
Sbjct: 69  NYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDY 120

[6][TOP]
>UniRef100_Q9FG07 Gb|AAD23015.1 n=2 Tax=Arabidopsis thaliana RepID=Q9FG07_ARATH
          Length = 434

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 115 SPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 173

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 174 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 233

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 234 PPYYSPSPKVYY 245

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 140 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 198

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 199 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 258

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 259 PPYYSPSPKVYY 270

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 165 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 223

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 224 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 283

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 284 PPYYSPSPKVYY 295

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/132 (69%), Positives = 94/132 (71%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 190 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 248

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 249 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 308

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 309 PPYYSPSPKVYY 320

 Score =  184 bits (466), Expect = 3e-45
 Identities = 91/132 (68%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 265 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 323

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSP VYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 324 PPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 383

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 384 PPYYSPSPKVHY 395

 Score =  183 bits (464), Expect = 6e-45
 Identities = 91/132 (68%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 240 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 298

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSP V YK         SPP
Sbjct: 299 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPP 358

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 359 PPYYSPSPKVHY 370

 Score =  182 bits (462), Expect = 1e-44
 Identities = 91/132 (68%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 215 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSP 273

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 274 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 333

Query: 291 PPSYSPSPKTEY 326
           PP YSPSP   Y
Sbjct: 334 PPYYSPSPNVYY 345

 Score =  181 bits (460), Expect = 2e-44
 Identities = 90/132 (68%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPPP YSPSP V YKSP
Sbjct: 290 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPNVYYKSP 348

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV+YKSP        PPP YYSPSPKV YK         SPP
Sbjct: 349 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 408

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 409 PPYYSPSPKVTY 420

 Score =  180 bits (457), Expect = 4e-44
 Identities = 91/132 (68%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKVYYKSPP P+V    PPP  YSPSPKV YKSP
Sbjct: 90  SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPLYYSPSPKVYYKSP 148

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPP
Sbjct: 149 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 208

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 209 PPYYSPSPKVYY 220

 Score =  177 bits (449), Expect = 3e-43
 Identities = 86/122 (70%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 75  PPYVYNSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 133

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           P YYSPSPKVYYKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 134 PLYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 193

Query: 321 EY 326
            Y
Sbjct: 194 YY 195

 Score =  176 bits (445), Expect = 9e-43
 Identities = 87/123 (70%), Positives = 90/123 (73%), Gaps = 18/123 (14%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           PK Y Y SPPPPYY+PSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SP
Sbjct: 49  PKPYVYSSPPPPYYTPSPKVNYKSPPPPYV-YNSPPPPYYSPSPKVYYKSPPPPYVYSSP 107

Query: 189 PPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPK 317
           PPPYYSPSPKVYYKSP        PPP YYSPSPKV YK         SPPPP YSPSPK
Sbjct: 108 PPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPK 167

Query: 318 TEY 326
             Y
Sbjct: 168 VYY 170

 Score =  174 bits (441), Expect = 3e-42
 Identities = 84/119 (70%), Positives = 88/119 (73%), Gaps = 17/119 (14%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSP VYYKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 315 SPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYV-YSSPPPPYYSPSPKVHYKSP 373

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPYVY+SPPPPYYSPSPKV+YKSP        PPP YYSPSPKV YKSPPPP    +P
Sbjct: 374 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPPPYVYKTP 432

 Score =  146 bits (368), Expect = 8e-34
 Identities = 77/122 (63%), Positives = 79/122 (64%), Gaps = 21/122 (17%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSP---PHPHVCV-CPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           Y SP  P Y  SP   +K P   PHP   V   PPPP Y+PSPKV YKSPPPPYVYNSPP
Sbjct: 25  YSSPHTPAYD-SPSYEHKGPKYAPHPKPYVYSSPPPPYYTPSPKVNYKSPPPPYVYNSPP 83

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPP---------SYSPSPKT 320
           PPYYSPSPKVYYKSP        PPP YYSPSPKV YKSPPPP          YSPSPK 
Sbjct: 84  PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKV 143

Query: 321 EY 326
            Y
Sbjct: 144 YY 145

[7][TOP]
>UniRef100_Q9ZUC3 F5O8.27 protein n=1 Tax=Arabidopsis thaliana RepID=Q9ZUC3_ARATH
          Length = 895

 Score =  183 bits (465), Expect = 4e-45
 Identities = 88/124 (70%), Positives = 92/124 (74%), Gaps = 19/124 (15%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 762  PPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPP 821

Query: 192  PP-YYSPSPKVYYK---------SPPPPSYYSPSPKVEYK---------SPPPPSYSPSP 314
            PP YYSPSPKV YK         SPPPP+YYSPSPK+EYK         SPPPPSYSPSP
Sbjct: 822  PPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSPSP 881

Query: 315  KTEY 326
            K EY
Sbjct: 882  KAEY 885

 Score =  182 bits (463), Expect = 8e-45
 Identities = 87/124 (70%), Positives = 89/124 (71%), Gaps = 19/124 (15%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPK  YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 711  PPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPP 770

Query: 192  PPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKSPPPP----------SYSPSP 314
            PPYYSPSPKV YK         SPPPP YYSPSPKVEYKSPPPP           YSPSP
Sbjct: 771  PPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSP 830

Query: 315  KTEY 326
            K EY
Sbjct: 831  KVEY 834

 Score =  179 bits (455), Expect = 6e-44
 Identities = 86/124 (69%), Positives = 89/124 (71%), Gaps = 19/124 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPPHPHVCVCPPPPPCYS SPK+ YKSPP PYVY+SPP
Sbjct: 509 PPYVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPP 568

Query: 192 PP-YYSPSPKVYYK---------SPPPPSYYSPSPKVEYK---------SPPPPSYSPSP 314
           PP YYSPSPK  YK         SPPPP YYSP+PK  YK         SPPPP YSPSP
Sbjct: 569 PPPYYSPSPKPAYKSSPPPYVYSSPPPP-YYSPAPKPVYKSPPPPYVYNSPPPPYYSPSP 627

Query: 315 KTEY 326
           K  Y
Sbjct: 628 KPTY 631

 Score =  175 bits (444), Expect = 1e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 59  PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 117

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPKVEYK         SPPPP YSPSPK 
Sbjct: 118 PPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKV 177

Query: 321 EY 326
           +Y
Sbjct: 178 DY 179

 Score =  175 bits (444), Expect = 1e-42
 Identities = 85/122 (69%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPK  YKSPPPPYVYNSPP
Sbjct: 84  PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKPTYKSPPPPYVYNSPP 142

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 143 PPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKP 202

Query: 321 EY 326
            Y
Sbjct: 203 TY 204

 Score =  173 bits (439), Expect = 5e-42
 Identities = 87/125 (69%), Positives = 90/125 (72%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P VY   PPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 737  PYVYSSPPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 795

Query: 192  PP-YYSPSPKVYYKSPPPP---------SYYSPSPKVEYKSPPPP----------SYSPS 311
            PP YYSPSPKV YKSPPPP         +YYSPSPKVEYKSPPPP           YSPS
Sbjct: 796  PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPS 855

Query: 312  PKTEY 326
            PK EY
Sbjct: 856  PKIEY 860

 Score =  171 bits (434), Expect = 2e-41
 Identities = 88/133 (66%), Positives = 91/133 (68%), Gaps = 27/133 (20%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           +PKV YKSPPPPY          YSPSPKV YKSPP P+V    PPPP YSPSPKV YKS
Sbjct: 23  TPKVDYKSPPPPYVYSSPPPPLSYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKS 81

Query: 159 PPPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SP 287
           PPPPYVY+SPPPPYYSPSPKV YKSP        PPP YYSPSPK  YK         SP
Sbjct: 82  PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSP 141

Query: 288 PPPSYSPSPKTEY 326
           PPP YSPSPK EY
Sbjct: 142 PPPYYSPSPKVEY 154

 Score =  171 bits (434), Expect = 2e-41
 Identities = 83/123 (67%), Positives = 86/123 (69%), Gaps = 18/123 (14%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSP+PK  YKSPPPPYVY+SPP
Sbjct: 661  PPYVYSSPPPPYYSPSPKPTYKSPPPPYV-YSSPPPPYYSPAPKPTYKSPPPPYVYSSPP 719

Query: 192  PPYYSPSPKVYYKSPPPP---------SYYSPSPKVEYK---------SPPPPSYSPSPK 317
            PPYYSPSPK  YKSPPPP          YYSPSPKVEYK         SPPPP YSPSPK
Sbjct: 720  PPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPK 779

Query: 318  TEY 326
             EY
Sbjct: 780  VEY 782

 Score =  171 bits (432), Expect = 3e-41
 Identities = 84/122 (68%), Positives = 85/122 (69%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVYNSPP
Sbjct: 134 PPYVYNSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 192

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPK  YK         SPPPP YSPSPK 
Sbjct: 193 PPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKP 252

Query: 321 EY 326
            Y
Sbjct: 253 AY 254

 Score =  170 bits (430), Expect = 5e-41
 Identities = 82/122 (67%), Positives = 85/122 (69%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSPSPK VYKSPPPPY+YNSPP
Sbjct: 359 PPYVYSSPPPPYYSPSPKPTYKSPPPPYV-YSSPPPPYYSPSPKPVYKSPPPPYIYNSPP 417

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPK+ YK         SPPPP YSPSPK 
Sbjct: 418 PPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKV 477

Query: 321 EY 326
            Y
Sbjct: 478 VY 479

 Score =  169 bits (429), Expect = 7e-41
 Identities = 85/128 (66%), Positives = 89/128 (69%), Gaps = 20/128 (15%)
 Frame = +3

Query: 3   RASPKVY-YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           ++SP  Y Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPK  YKSPPPPYVY
Sbjct: 455 KSSPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV-YSSPPPPYYSPSPKPSYKSPPPPYVY 513

Query: 180 NSPPPPYYSPSPKVYYKS---------PPPPSYYSPSPKVEYKS----------PPPPSY 302
           NSPPPPYYSPSPKV YKS         PPPP  YS SPK+EYKS          PPPP Y
Sbjct: 514 NSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYY 573

Query: 303 SPSPKTEY 326
           SPSPK  Y
Sbjct: 574 SPSPKPAY 581

 Score =  169 bits (428), Expect = 9e-41
 Identities = 84/124 (67%), Positives = 87/124 (70%), Gaps = 19/124 (15%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSP+PK  YKSPP P+V    PPPP YSPSPK  YKSPPPPYVY+SPP
Sbjct: 686  PPYVYSSPPPPYYSPAPKPTYKSPPPPYV-YSSPPPPYYSPSPKPTYKSPPPPYVYSSPP 744

Query: 192  PP-YYSPSPKVYYKSPPPP--------SYYSPSPKVEYKS----------PPPPSYSPSP 314
            PP YYSPSPKV YKSPPPP         YYSPSPKVEYKS          PPPP YSPSP
Sbjct: 745  PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSP 804

Query: 315  KTEY 326
            K EY
Sbjct: 805  KVEY 808

 Score =  168 bits (426), Expect = 1e-40
 Identities = 82/122 (67%), Positives = 84/122 (68%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSPSPK +YKSPPPPYVYNSPP
Sbjct: 234 PPYVYSSPPPPYYSPSPKPAYKSPPPPYV-YSSPPPPYYSPSPKPIYKSPPPPYVYNSPP 292

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPK  YK         SPPPP YSPSPK 
Sbjct: 293 PPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKP 352

Query: 321 EY 326
            Y
Sbjct: 353 AY 354

 Score =  168 bits (425), Expect = 2e-40
 Identities = 83/122 (68%), Positives = 85/122 (69%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 109 PPYVYSSPPPPYYSPSPKPTYKSPPPPYV-YNSPPPPYYSPSPKVEYKSPPPPYVYSSPP 167

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPK  YK         SPPPP YSPSPK 
Sbjct: 168 PPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKP 227

Query: 321 EY 326
            Y
Sbjct: 228 VY 229

 Score =  168 bits (425), Expect = 2e-40
 Identities = 83/123 (67%), Positives = 86/123 (69%), Gaps = 18/123 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK+ YKS P P+V    PPPP YSPSPKVVYKSPPPPYVY+SPP
Sbjct: 434 PPYVYSSPPPPYYSPSPKLTYKSSPPPYV-YSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 492

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKS----------PPPPSYSPSPK 317
           PPYYSPSPK  YKSP        PPP YYSPSPKV YKS          PPPP YS SPK
Sbjct: 493 PPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSPK 552

Query: 318 TEY 326
            EY
Sbjct: 553 IEY 555

 Score =  167 bits (424), Expect = 3e-40
 Identities = 83/122 (68%), Positives = 84/122 (68%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V   PPPP  YSPSPK VYKSPPPPYVYNSPP
Sbjct: 284 PPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPP-YYSPSPKPVYKSPPPPYVYNSPP 342

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPK  YK         SPPPP YSPSPK 
Sbjct: 343 PPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKP 402

Query: 321 EY 326
            Y
Sbjct: 403 VY 404

 Score =  167 bits (423), Expect = 3e-40
 Identities = 82/119 (68%), Positives = 86/119 (72%), Gaps = 18/119 (15%)
 Frame = +3

Query: 24  YKSPPPPYY-SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           Y SPPPP Y SP+PKV YKSPP P+V   PPPP  YSPSPKV YKSPPPPYVY+SPPPPY
Sbjct: 11  YSSPPPPLYDSPTPKVDYKSPPPPYVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPPY 70

Query: 201 YSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKTEY 326
           YSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK  Y
Sbjct: 71  YSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTY 129

 Score =  166 bits (421), Expect = 6e-40
 Identities = 81/122 (66%), Positives = 83/122 (68%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSPSPK  YKSPPPPYVY+SPP
Sbjct: 334 PPYVYNSPPPPYYSPSPKPAYKSPPPPYV-YSSPPPPYYSPSPKPTYKSPPPPYVYSSPP 392

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPK  YK         SPPPP YSPSPK 
Sbjct: 393 PPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKL 452

Query: 321 EY 326
            Y
Sbjct: 453 TY 454

 Score =  166 bits (421), Expect = 6e-40
 Identities = 81/122 (66%), Positives = 84/122 (68%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSPSPK+ YKS PPPYVY+SPP
Sbjct: 409 PPYIYNSPPPPYYSPSPKPSYKSPPPPYV-YSSPPPPYYSPSPKLTYKSSPPPYVYSSPP 467

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPK  YK         SPPPP YSPSPK 
Sbjct: 468 PPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKV 527

Query: 321 EY 326
            Y
Sbjct: 528 IY 529

 Score =  166 bits (420), Expect = 7e-40
 Identities = 81/122 (66%), Positives = 84/122 (68%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPK  YKSPPPPY+Y+SPP
Sbjct: 159 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YNSPPPPYYSPSPKPTYKSPPPPYIYSSPP 217

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPK  YK         SPPPP YSPSPK 
Sbjct: 218 PPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKP 277

Query: 321 EY 326
            Y
Sbjct: 278 IY 279

 Score =  166 bits (420), Expect = 7e-40
 Identities = 81/122 (66%), Positives = 84/122 (68%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P++    PPPP YSPSPK VYKSPPPPYVY+SPP
Sbjct: 184 PPYVYNSPPPPYYSPSPKPTYKSPPPPYI-YSSPPPPYYSPSPKPVYKSPPPPYVYSSPP 242

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPK  YK         SPPPP YSPSPK 
Sbjct: 243 PPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKP 302

Query: 321 EY 326
            Y
Sbjct: 303 AY 304

 Score =  166 bits (420), Expect = 7e-40
 Identities = 81/122 (66%), Positives = 83/122 (68%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSPSPK  YKSPPPPYVY+SPP
Sbjct: 209 PPYIYSSPPPPYYSPSPKPVYKSPPPPYV-YSSPPPPYYSPSPKPAYKSPPPPYVYSSPP 267

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKS---------PPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPK  YKS         PPPP YSPSPK 
Sbjct: 268 PPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKP 327

Query: 321 EY 326
            Y
Sbjct: 328 VY 329

 Score =  166 bits (419), Expect = 1e-39
 Identities = 80/123 (65%), Positives = 84/123 (68%), Gaps = 18/123 (14%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPPYYSP+PK  YKSPP P+V    PPPP YSPSPK  YKSPPPPYVY+SPP
Sbjct: 636  PPYVYSSPPPPYYSPTPKPTYKSPPPPYV-YSSPPPPYYSPSPKPTYKSPPPPYVYSSPP 694

Query: 192  PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKS----------PPPPSYSPSPK 317
            PPYYSP+PK  YKSP        PPP YYSPSPK  YKS          PPPP YSPSPK
Sbjct: 695  PPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPK 754

Query: 318  TEY 326
             EY
Sbjct: 755  VEY 757

 Score =  164 bits (416), Expect = 2e-39
 Identities = 80/122 (65%), Positives = 84/122 (68%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P++    PPPP YSPSPK  YKSPPPPYVY+SPP
Sbjct: 384 PPYVYSSPPPPYYSPSPKPVYKSPPPPYI-YNSPPPPYYSPSPKPSYKSPPPPYVYSSPP 442

Query: 192 PPYYSPSPKVYYK--------SPPPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK+ YK        S PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 443 PPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKP 502

Query: 321 EY 326
            Y
Sbjct: 503 SY 504

 Score =  163 bits (413), Expect = 5e-39
 Identities = 80/122 (65%), Positives = 82/122 (67%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSPSPK  YKSPPPPYVY+ PP
Sbjct: 259 PPYVYSSPPPPYYSPSPKPIYKSPPPPYV-YNSPPPPYYSPSPKPAYKSPPPPYVYSFPP 317

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPK  YK         SPPPP YSPSPK 
Sbjct: 318 PPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKP 377

Query: 321 EY 326
            Y
Sbjct: 378 TY 379

 Score =  163 bits (413), Expect = 5e-39
 Identities = 79/122 (64%), Positives = 83/122 (68%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSP+PK  YKSPPPPYVY+SPP
Sbjct: 611 PPYVYNSPPPPYYSPSPKPTYKSPPPPYV-YSSPPPPYYSPTPKPTYKSPPPPYVYSSPP 669

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSP+PK  YK         SPPPP YSPSPK 
Sbjct: 670 PPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKP 729

Query: 321 EY 326
            Y
Sbjct: 730 TY 731

 Score =  163 bits (412), Expect = 6e-39
 Identities = 80/122 (65%), Positives = 82/122 (67%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y  PPPPYYSPSPK  YKSPP P+V    PPPP YSPSPK  YKSPPPPYVY+SPP
Sbjct: 309 PPYVYSFPPPPYYSPSPKPVYKSPPPPYV-YNSPPPPYYSPSPKPAYKSPPPPYVYSSPP 367

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK  YKSP        PPP YYSPSPK  YK         SPPPP YSPSPK 
Sbjct: 368 PPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKP 427

Query: 321 EY 326
            Y
Sbjct: 428 SY 429

 Score =  162 bits (411), Expect = 8e-39
 Identities = 80/126 (63%), Positives = 87/126 (69%), Gaps = 18/126 (14%)
 Frame = +3

Query: 3   RASPKVY-YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           ++SP  Y Y SPPPPYYSP+PK  YKSPP P+V    PPPP YSPSPK  YKSPPPPYVY
Sbjct: 582 KSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYV-YNSPPPPYYSPSPKPTYKSPPPPYVY 640

Query: 180 NSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSP 308
           +SPPPPYYSP+PK  YKSP        PPP YYSPSPK  YK         SPPPP YSP
Sbjct: 641 SSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSP 700

Query: 309 SPKTEY 326
           +PK  Y
Sbjct: 701 APKPTY 706

 Score =  142 bits (358), Expect = 1e-32
 Identities = 66/92 (71%), Positives = 69/92 (75%), Gaps = 10/92 (10%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
            SPKV YKSPPPPY          YSPSPKV YKSPP P+V   PPPP  YSPSPK+ YKS
Sbjct: 803  SPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKS 862

Query: 159  PPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYY 254
            PPPPYVY+SPPPP YSPSPK  YKSPPPPS Y
Sbjct: 863  PPPPYVYSSPPPPSYSPSPKAEYKSPPPPSLY 894

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 43/79 (54%), Positives = 45/79 (56%), Gaps = 9/79 (11%)
 Frame = +3

Query: 117 PPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYK----- 281
           P  YS  P  +Y SP P   Y SPPPPY        Y SPPPP  YSPSPKV+YK     
Sbjct: 8   PYTYSSPPPPLYDSPTPKVDYKSPPPPYV-------YSSPPPPLSYSPSPKVDYKSPPPP 60

Query: 282 ----SPPPPSYSPSPKTEY 326
               SPPPP YSPSPK EY
Sbjct: 61  YVYSSPPPPYYSPSPKVEY 79

[8][TOP]
>UniRef100_Q2A9D3 Extensin, putative n=1 Tax=Brassica oleracea RepID=Q2A9D3_BRAOL
          Length = 509

 Score =  182 bits (462), Expect = 1e-44
 Identities = 88/125 (70%), Positives = 91/125 (72%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPPPYYSPSPKVYYKSPP P+V   PPPPP YSPSPK+VYKSPPPPYVY+SPP
Sbjct: 318 PYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPP 377

Query: 192 PP-YYSPSPKVYYK---------SPPPPSYYSPSPKVEYKSPPPP----------SYSPS 311
           PP YYSPSPKV YK         SPPPP YYSPSPKV YKSPPPP           YSPS
Sbjct: 378 PPPYYSPSPKVNYKYPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPQFYSPS 437

Query: 312 PKTEY 326
           PK EY
Sbjct: 438 PKAEY 442

 Score =  178 bits (451), Expect = 2e-43
 Identities = 90/128 (70%), Positives = 93/128 (72%), Gaps = 22/128 (17%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           SPKV YKSPPPPY          YSPSPKV YKSPP P+V   PPPPP YSPSPKV YKS
Sbjct: 159 SPKVEYKSPPPPYVYSSPPLPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKS 218

Query: 159 PPPPYVYNS-PPPPYYSPSPKVYYKS-PPPPSYYSPSPKVEYKS----------PPPPSY 302
           PPPPYVY+S PPPPYYSPSP+V YKS PPPP YYSPSPKVEY S          PPPP Y
Sbjct: 219 PPPPYVYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYNSPPPPYVYSSPPPPPYY 278

Query: 303 SPSPKTEY 326
           SPSPK EY
Sbjct: 279 SPSPKVEY 286

 Score =  176 bits (446), Expect = 7e-43
 Identities = 88/128 (68%), Positives = 94/128 (73%), Gaps = 22/128 (17%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           SP+V YKSPPPP  YYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+
Sbjct: 115 SPEVDYKSPPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVEYKSPPPPYVYS 174

Query: 183 SPP-PPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSY 302
           SPP PPYYSPSPKV YK         SPPPP YYSPSPKV+YKS          PPPP Y
Sbjct: 175 SPPLPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSLPPPPYY 234

Query: 303 SPSPKTEY 326
           SPSP+ +Y
Sbjct: 235 SPSPEVDY 242

 Score =  176 bits (445), Expect = 9e-43
 Identities = 85/117 (72%), Positives = 89/117 (76%), Gaps = 12/117 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSPP P+V   PP PP YSPSPKV YKSPPPPYVY+S P
Sbjct: 144 PYVYNSPPPPPYYSPSPKVEYKSPPPPYVYSSPPLPPYYSPSPKVDYKSPPPPYVYSSPP 203

Query: 189 PPPYYSPSPKVYYKSP---------PPPSYYSPSPKVEYKSPPPPS--YSPSPKTEY 326
           PPPYYSPSPKV YKSP         PPP YYSPSP+V+YKSPPPP   YSPSPK EY
Sbjct: 204 PPPYYSPSPKVDYKSPPPPYVYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEY 260

 Score =  176 bits (445), Expect = 9e-43
 Identities = 88/136 (64%), Positives = 93/136 (68%), Gaps = 30/136 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           SPKVYYKSPPPPY          YSPSPK+ YKSPP P+V   PPPPP YSPSPKV YK 
Sbjct: 333 SPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNYKY 392

Query: 159 PPPPYVYNS-PPPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS-------- 284
           PPPPYVY+S PPPPYYSPSPKV YK         SPPPP +YSPSPK EYKS        
Sbjct: 393 PPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPQFYSPSPKAEYKSPPPPYVYS 452

Query: 285 --PPPPSYSPSPKTEY 326
             PPPP YSPSPK +Y
Sbjct: 453 SPPPPPYYSPSPKVDY 468

 Score =  174 bits (441), Expect = 3e-42
 Identities = 85/125 (68%), Positives = 88/125 (70%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP Y PSPKV YKSPPPPYVY+S P
Sbjct: 266 PYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYFPSPKVDYKSPPPPYVYSSPP 325

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYYSPSPKVYYK         SPPPP YYSPSPK+ YKS          PPPP YSPS
Sbjct: 326 PPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPS 385

Query: 312 PKTEY 326
           PK  Y
Sbjct: 386 PKVNY 390

 Score =  172 bits (436), Expect = 1e-41
 Identities = 88/128 (68%), Positives = 90/128 (70%), Gaps = 22/128 (17%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           SP+V YKSPPPP  YYSPSPKV Y SPP P+V   PPPPP YSPSPKV YKSPPPPYVYN
Sbjct: 237 SPEVDYKSPPPPPPYYSPSPKVEYNSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYN 296

Query: 183 S-PPPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSY 302
           S PPPPYY PSPKV YK         SPPPP YYSPSPKV YKS          PPPP Y
Sbjct: 297 SPPPPPYYFPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPYY 356

Query: 303 SPSPKTEY 326
           SPSPK  Y
Sbjct: 357 SPSPKMVY 364

 Score =  171 bits (432), Expect = 3e-41
 Identities = 83/125 (66%), Positives = 86/125 (68%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPPPYY PSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 292 PYVYNSPPPPPYYFPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPP 351

Query: 192 PP-YYSPSPKVYYKSPPPP---------SYYSPSPKVEYK----------SPPPPSYSPS 311
           PP YYSPSPK+ YKSPPPP          YYSPSPKV YK           PPPP YSPS
Sbjct: 352 PPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNYKYPPPPYVYSSPPPPPYYSPS 411

Query: 312 PKTEY 326
           PK  Y
Sbjct: 412 PKVNY 416

 Score =  170 bits (430), Expect = 5e-41
 Identities = 83/125 (66%), Positives = 87/125 (69%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPPPYYSPSPKV YK PP P+V   PPPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 370 PYVYSSPPPPPYYSPSPKVNYKYPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPP 429

Query: 192 PP-YYSPSPKVYYKSPPPP---------SYYSPSPKVEYKS----------PPPPSYSPS 311
           PP +YSPSPK  YKSPPPP          YYSPSPKV+YKS          PPPP YSPS
Sbjct: 430 PPQFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPS 489

Query: 312 PKTEY 326
           PK  Y
Sbjct: 490 PKVYY 494

 Score =  165 bits (418), Expect = 1e-39
 Identities = 78/107 (72%), Positives = 80/107 (74%), Gaps = 10/107 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPP  YSPSPK  YKSPPPPYVY+S P
Sbjct: 396 PYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPQFYSPSPKAEYKSPPPPYVYSSPP 455

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKSPPPPSY 302
           PPPYYSPSPKV YK         SPPPP YYSPSPKV YKSPPPP Y
Sbjct: 456 PPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPY 502

 Score =  165 bits (417), Expect = 2e-39
 Identities = 87/136 (63%), Positives = 90/136 (66%), Gaps = 30/136 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           SPKV YKSPPPPY          YSPSP+V YKSPP        PPPP YSPSPKV YKS
Sbjct: 89  SPKVEYKSPPPPYIYSSLPPPPYYSPSPEVDYKSPP--------PPPPYYSPSPKVEYKS 140

Query: 159 PPPPYVYNSPPPP-YYSPSPKVYYKSPPP---------PSYYSPSPKVEYKS-------- 284
           PPPPYVYNSPPPP YYSPSPKV YKSPPP         P YYSPSPKV+YKS        
Sbjct: 141 PPPPYVYNSPPPPPYYSPSPKVEYKSPPPPYVYSSPPLPPYYSPSPKVDYKSPPPPYVYS 200

Query: 285 --PPPPSYSPSPKTEY 326
             PPPP YSPSPK +Y
Sbjct: 201 SPPPPPYYSPSPKVDY 216

 Score =  160 bits (404), Expect = 5e-38
 Identities = 84/143 (58%), Positives = 87/143 (60%), Gaps = 38/143 (26%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVC------------------PPPPPCYSPS 137
           P VY   PPPPYYSPSPKV YKSPP P+V                     PPPPP YSPS
Sbjct: 196 PYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPS 255

Query: 138 PKVVYKSPPPPYVYNS-PPPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS- 284
           PKV Y SPPPPYVY+S PPPPYYSPSPKV YK         SPPPP YY PSPKV+YKS 
Sbjct: 256 PKVEYNSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYFPSPKVDYKSP 315

Query: 285 ---------PPPPSYSPSPKTEY 326
                    PPPP YSPSPK  Y
Sbjct: 316 PPPYVYSSPPPPPYYSPSPKVYY 338

 Score =  147 bits (371), Expect = 4e-34
 Identities = 73/111 (65%), Positives = 78/111 (70%), Gaps = 12/111 (10%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-PPPPYYS 206
           SPPP Y    PK  Y   P P++   PPPP  YSPSPKV YKSPPPPY+Y+S PPPPYYS
Sbjct: 56  SPPPQYRRQGPK--YTPHPKPYIYSSPPPPSYYSPSPKVEYKSPPPPYIYSSLPPPPYYS 113

Query: 207 PSPKVYYKSPPPPS-YYSPSPKVEYKS----------PPPPSYSPSPKTEY 326
           PSP+V YKSPPPP  YYSPSPKVEYKS          PPPP YSPSPK EY
Sbjct: 114 PSPEVDYKSPPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVEY 164

 Score =  147 bits (371), Expect = 4e-34
 Identities = 70/97 (72%), Positives = 72/97 (74%), Gaps = 11/97 (11%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           SPKV YKSPPPPY          YSPSPK  YKSPP P+V   PPPPP YSPSPKV YKS
Sbjct: 411 SPKVNYKSPPPPYVYSSPPPPQFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKS 470

Query: 159 PPPPYVYNSPPPP-YYSPSPKVYYKSPPPPSYYSPSP 266
           PPPPYVY+SPPPP YYSPSPKVYYKSPPPP Y    P
Sbjct: 471 PPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKMP 507

 Score =  110 bits (276), Expect = 4e-23
 Identities = 63/123 (51%), Positives = 68/123 (55%), Gaps = 17/123 (13%)
 Frame = +3

Query: 9   SPKVYYKSPP-----PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
           SP    K PP      PY       YY +PP P       PP      PK  Y   P PY
Sbjct: 25  SPPTTQKYPPVHKTKSPYQPKKNSPYYSAPPSP-------PPQYRRQGPK--YTPHPKPY 75

Query: 174 VYNSPPPP-YYSPSPKVYYKSP---------PPPSYYSPSPKVEYKSPPPPS--YSPSPK 317
           +Y+SPPPP YYSPSPKV YKSP         PPP YYSPSP+V+YKSPPPP   YSPSPK
Sbjct: 76  IYSSPPPPSYYSPSPKVEYKSPPPPYIYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPK 135

Query: 318 TEY 326
            EY
Sbjct: 136 VEY 138

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 44/108 (40%), Positives = 48/108 (44%), Gaps = 23/108 (21%)
 Frame = +3

Query: 72  YKSPP----HPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPP 239
           Y+SPP    +P V     P   Y P     Y S PP     SPPP Y    PK  Y   P
Sbjct: 23  YESPPTTQKYPPVHKTKSP---YQPKKNSPYYSAPP-----SPPPQYRRQGPK--YTPHP 72

Query: 240 PPSYY---------SPSPKVEYKS----------PPPPSYSPSPKTEY 326
            P  Y         SPSPKVEYKS          PPPP YSPSP+ +Y
Sbjct: 73  KPYIYSSPPPPSYYSPSPKVEYKSPPPPYIYSSLPPPPYYSPSPEVDY 120

[9][TOP]
>UniRef100_Q2A9D1 Extensin-like region containing protein n=1 Tax=Brassica oleracea
           RepID=Q2A9D1_BRAOL
          Length = 543

 Score =  182 bits (462), Expect = 1e-44
 Identities = 88/125 (70%), Positives = 91/125 (72%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKVYYKSPP P+V   PPPPP YSPSPK+VYKSPPPPYVY+S P
Sbjct: 352 PYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPP 411

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYYSPSPKV YK         SPPPP YYSPSPKV YKS          PPPP YSPS
Sbjct: 412 PPPYYSPSPKVNYKSPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPPPPFYSPS 471

Query: 312 PKTEY 326
           PK EY
Sbjct: 472 PKAEY 476

 Score =  178 bits (452), Expect = 1e-43
 Identities = 87/125 (69%), Positives = 89/125 (71%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVYNS P
Sbjct: 100 PYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPP 159

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYYSPSPK  YK         SPPPP YYSPSPKVEYKS          PPPP YSPS
Sbjct: 160 PPPYYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPQPPYVYSSPPPPPYYSPS 219

Query: 312 PKTEY 326
           PK +Y
Sbjct: 220 PKVDY 224

 Score =  177 bits (450), Expect = 2e-43
 Identities = 89/136 (65%), Positives = 94/136 (69%), Gaps = 30/136 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           SPKVYYKSPPPPY          YSPSPK+ YKSPP P+V   PPPPP YSPSPKV YKS
Sbjct: 367 SPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNYKS 426

Query: 159 PPPPYVYNSPPPP-YYSPSPKVYYKSPPPP---------SYYSPSPKVEYKS-------- 284
           PPPPYVY+SPPPP YYSPSPKV YKSPPPP          +YSPSPK EYKS        
Sbjct: 427 PPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPPYVYS 486

Query: 285 --PPPPSYSPSPKTEY 326
             PPPP YSPSPK +Y
Sbjct: 487 SPPPPPYYSPSPKVDY 502

 Score =  177 bits (449), Expect = 3e-43
 Identities = 86/117 (73%), Positives = 89/117 (76%), Gaps = 12/117 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSP  P+V   PPPPP YSPSPKV YKSPPPPYVY+S P
Sbjct: 178 PYVYSSPPPPPYYSPSPKVEYKSPQPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPP 237

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKSPPPPS--YSPSPKTEY 326
           PPPYYSPSPKV YK         SPPPP YYSPSPKV+YKSPPPP   YSPSPK EY
Sbjct: 238 PPPYYSPSPKVDYKSPPPPYVCSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKFEY 294

 Score =  176 bits (447), Expect = 5e-43
 Identities = 86/125 (68%), Positives = 89/125 (71%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+S P
Sbjct: 300 PYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVDYKSPPPPYVYSSPP 359

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYYSPSPKVYYK         SPPPP YYSPSPK+ YKS          PPPP YSPS
Sbjct: 360 PPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPS 419

Query: 312 PKTEY 326
           PK  Y
Sbjct: 420 PKVNY 424

 Score =  176 bits (446), Expect = 7e-43
 Identities = 86/117 (73%), Positives = 88/117 (75%), Gaps = 12/117 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYV +S P
Sbjct: 204 PYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVCSSPP 263

Query: 189 PPPYYSPSPKVYYKS-PPPPSYYSPSPKVEYKS----------PPPPSYSPSPKTEY 326
           PPPYYSPSPKV YKS PPPP YYSPSPK EYKS          PPPP YSPSPK EY
Sbjct: 264 PPPYYSPSPKVDYKSPPPPPPYYSPSPKFEYKSPPPPYVYSSPPPPPYYSPSPKVEY 320

 Score =  176 bits (446), Expect = 7e-43
 Identities = 90/128 (70%), Positives = 91/128 (71%), Gaps = 22/128 (17%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           SPKV YKSPPPP  YYSPSPK  YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVYN
Sbjct: 271 SPKVDYKSPPPPPPYYSPSPKFEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYN 330

Query: 183 S-PPPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSY 302
           S PPPPYYSPSPKV YK         SPPPP YYSPSPKV YKS          PPPP Y
Sbjct: 331 SPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPYY 390

Query: 303 SPSPKTEY 326
           SPSPK  Y
Sbjct: 391 SPSPKMVY 398

 Score =  175 bits (444), Expect = 1e-42
 Identities = 85/125 (68%), Positives = 89/125 (71%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPK  YKSPPPPYVY+SPP
Sbjct: 126 PYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPP 185

Query: 192 PP-YYSPSPKVYYKSP---------PPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PP YYSPSPKV YKSP         PPP YYSPSPKV+YKS          PPPP YSPS
Sbjct: 186 PPPYYSPSPKVEYKSPQPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPS 245

Query: 312 PKTEY 326
           PK +Y
Sbjct: 246 PKVDY 250

 Score =  175 bits (443), Expect = 2e-42
 Identities = 85/125 (68%), Positives = 88/125 (70%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 326 PYVYNSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPP 385

Query: 192 PP-YYSPSPKVYYKSPPPP---------SYYSPSPKVEYKS----------PPPPSYSPS 311
           PP YYSPSPK+ YKSPPPP          YYSPSPKV YKS          PPPP YSPS
Sbjct: 386 PPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYYSPS 445

Query: 312 PKTEY 326
           PK  Y
Sbjct: 446 PKVNY 450

 Score =  172 bits (436), Expect = 1e-41
 Identities = 84/125 (67%), Positives = 88/125 (70%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPK  YKSPP P+V   PPPPP YSPSPKV YKSP PPYVY+S P
Sbjct: 152 PYVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPQPPYVYSSPP 211

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYYSPSPKV YK         SPPPP YYSPSPKV+YKS          PPPP YSPS
Sbjct: 212 PPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVCSSPPPPPYYSPS 271

Query: 312 PKTEY 326
           PK +Y
Sbjct: 272 PKVDY 276

 Score =  171 bits (434), Expect = 2e-41
 Identities = 87/127 (68%), Positives = 89/127 (70%), Gaps = 22/127 (17%)
 Frame = +3

Query: 12  PKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           PK Y  S PPP  YYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+S
Sbjct: 72  PKPYIYSSPPPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSS 131

Query: 186 -PPPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYS 305
            PPPPYYSPSPKV YK         SPPPP YYSPSPK EYKS          PPPP YS
Sbjct: 132 PPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPPPPPYYS 191

Query: 306 PSPKTEY 326
           PSPK EY
Sbjct: 192 PSPKVEY 198

 Score =  170 bits (431), Expect = 4e-41
 Identities = 83/125 (66%), Positives = 88/125 (70%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYV++S P
Sbjct: 404 PYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPP 463

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPP+YSPSPK  YK         SPPPP YYSPSPKV+YKS          PPPP YSPS
Sbjct: 464 PPPFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPS 523

Query: 312 PKTEY 326
           PK  Y
Sbjct: 524 PKVYY 528

 Score =  168 bits (426), Expect = 1e-40
 Identities = 87/143 (60%), Positives = 90/143 (62%), Gaps = 38/143 (26%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV--------------- 146
           P VY   PPPPYYSPSPKV YKSPP P+VC  PPPPP YSPSPKV               
Sbjct: 230 PYVYSSPPPPPYYSPSPKVDYKSPPPPYVCSSPPPPPYYSPSPKVDYKSPPPPPPYYSPS 289

Query: 147 ---VYKSPPPPYVYNS-PPPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS- 284
               YKSPPPPYVY+S PPPPYYSPSPKV YK         SPPPP YYSPSPKV+YKS 
Sbjct: 290 PKFEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVDYKSP 349

Query: 285 ---------PPPPSYSPSPKTEY 326
                    PPPP YSPSPK  Y
Sbjct: 350 PPPYVYSSPPPPPYYSPSPKVYY 372

 Score =  168 bits (425), Expect = 2e-40
 Identities = 79/107 (73%), Positives = 81/107 (75%), Gaps = 10/107 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPK  YKSPPPPYVY+S P
Sbjct: 430 PYVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPPYVYSSPP 489

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKSPPPPSY 302
           PPPYYSPSPKV YK         SPPPP YYSPSPKV YKSPPPP Y
Sbjct: 490 PPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPY 536

 Score =  147 bits (371), Expect = 4e-34
 Identities = 70/97 (72%), Positives = 72/97 (74%), Gaps = 11/97 (11%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           SPKV YKSPPPPY          YSPSPK  YKSPP P+V   PPPPP YSPSPKV YKS
Sbjct: 445 SPKVNYKSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKS 504

Query: 159 PPPPYVYNSPPPP-YYSPSPKVYYKSPPPPSYYSPSP 266
           PPPPYVY+SPPPP YYSPSPKVYYKSPPPP Y    P
Sbjct: 505 PPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKMP 541

 Score =  143 bits (360), Expect = 7e-33
 Identities = 74/119 (62%), Positives = 77/119 (64%), Gaps = 20/119 (16%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP-YYS 206
           SPPP Y    PK  Y   P P++   PPP   YSPSPKV YKSPPPPYVY+SPPPP YYS
Sbjct: 56  SPPPQYRRQGPK--YTPHPKPYIYSSPPPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYS 113

Query: 207 PSPKVYYKSPPPP---------SYYSPSPKVEYKS----------PPPPSYSPSPKTEY 326
           PSPKV YKSPPPP          YYSPSPKVEYKS          PPPP YSPSPK EY
Sbjct: 114 PSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKAEY 172

 Score =  105 bits (263), Expect = 1e-21
 Identities = 64/126 (50%), Positives = 69/126 (54%), Gaps = 25/126 (19%)
 Frame = +3

Query: 24  YKSPPPPY-YSPSPKVYYKSPPH---PHVCVCPPPPPCYS-PSPKVVYKSPPPPYVYNSP 188
           Y+SPP    Y P  K     PP    P+    P PPP Y    PK  Y   P PY+Y+SP
Sbjct: 23  YESPPTTQKYPPVHKTKSPYPPKMNSPYYSAPPSPPPQYRRQGPK--YTPHPKPYIYSSP 80

Query: 189 PPP-YYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSP 308
           PP  YYSPSPKV YK         SPPPP YYSPSPKV+YKS          PPPP YSP
Sbjct: 81  PPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSP 140

Query: 309 SPKTEY 326
           SPK EY
Sbjct: 141 SPKVEY 146

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 48/114 (42%), Positives = 49/114 (42%), Gaps = 19/114 (16%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKV 221
           PY SP     Y   P  H    P PP   SP     Y S PP     SPPP Y    PK 
Sbjct: 22  PYESPPTTQKY---PPVHKTKSPYPPKMNSP-----YYSAPP-----SPPPQYRRQGPK- 67

Query: 222 YYKSPPPPSYY---------SPSPKVEYKS----------PPPPSYSPSPKTEY 326
            Y   P P  Y         SPSPKVEYKS          PPPP YSPSPK +Y
Sbjct: 68  -YTPHPKPYIYSSPPPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDY 120

[10][TOP]
>UniRef100_Q9STM8 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STM8_ARATH
          Length = 513

 Score =  179 bits (453), Expect = 1e-43
 Identities = 85/125 (68%), Positives = 93/125 (74%), Gaps = 17/125 (13%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           ++ P  YY+SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+
Sbjct: 256 KSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYS 314

Query: 183 SPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPS 311
           SPPPPYYSP+PKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPS
Sbjct: 315 SPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPS 374

Query: 312 PKTEY 326
           PK +Y
Sbjct: 375 PKVDY 379

 Score =  176 bits (446), Expect = 7e-43
 Identities = 86/122 (70%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVYNSPP
Sbjct: 334 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 392

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 393 PPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKV 452

Query: 321 EY 326
            Y
Sbjct: 453 NY 454

 Score =  175 bits (444), Expect = 1e-42
 Identities = 84/121 (69%), Positives = 89/121 (73%), Gaps = 16/121 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSP+PKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 185 PPYVYSSPPPPYYSPTPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 243

Query: 192 PPYYSPSPKVYYKSP-------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKTE 323
           PPYYSPSPKV YKSP       PPP YYSPSPKV+YK         SPPPP YSPSPK +
Sbjct: 244 PPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVD 303

Query: 324 Y 326
           Y
Sbjct: 304 Y 304

 Score =  174 bits (442), Expect = 2e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSP+PKV YKSPPPPYVY+SPP
Sbjct: 284 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 342

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 343 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKV 402

Query: 321 EY 326
           +Y
Sbjct: 403 DY 404

 Score =  174 bits (441), Expect = 3e-42
 Identities = 84/121 (69%), Positives = 88/121 (72%), Gaps = 16/121 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSP+PKV YKSPPPPYVY+SPP
Sbjct: 160 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 218

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK--------SPPPPSYSPSPKTE 323
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK        SPPPP YSPSPK +
Sbjct: 219 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVD 278

Query: 324 Y 326
           Y
Sbjct: 279 Y 279

 Score =  174 bits (440), Expect = 4e-42
 Identities = 84/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSP+PKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 309 PPYVYSSPPPPYYSPTPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 367

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 368 PPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKV 427

Query: 321 EY 326
            Y
Sbjct: 428 NY 429

 Score =  173 bits (438), Expect = 6e-42
 Identities = 83/122 (68%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPY+YNSPP
Sbjct: 359 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YNSPPPPYYSPSPKVDYKSPPPPYIYNSPP 417

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YK+P        PPP YYSPSPKV YK         SPPPP YSPSP  
Sbjct: 418 PPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPNV 477

Query: 321 EY 326
           +Y
Sbjct: 478 DY 479

 Score =  172 bits (436), Expect = 1e-41
 Identities = 83/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPK  YKSPPPPYVY+SPP
Sbjct: 110 PPYVYSSPPPPYYSPSPKVNYKSPPPPYV-YSSPPPPYYSPSPKGDYKSPPPPYVYSSPP 168

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSP+PKV+YK         SPPPP YSPSPK 
Sbjct: 169 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKV 228

Query: 321 EY 326
           +Y
Sbjct: 229 DY 230

 Score =  172 bits (436), Expect = 1e-41
 Identities = 83/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+     PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 235 PPYVYSSPPPPYYSPSPKVNYKSPPPPYYR--SPPPPYYSPSPKVDYKSPPPPYVYSSPP 292

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSP+PKV+YK         SPPPP YSPSPK 
Sbjct: 293 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKV 352

Query: 321 EY 326
           +Y
Sbjct: 353 DY 354

 Score =  171 bits (434), Expect = 2e-41
 Identities = 85/130 (65%), Positives = 89/130 (68%), Gaps = 17/130 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 135 PPYVYSSPPPPYYSPSPKGDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 193

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSP+PKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 194 PPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 253

Query: 321 EY*ISRLPLY 350
            Y     P Y
Sbjct: 254 NYKSPPPPYY 263

 Score =  169 bits (429), Expect = 7e-41
 Identities = 79/113 (69%), Positives = 84/113 (74%), Gaps = 8/113 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P++    PPPP YSPSPKV YK+PPPPYVY+SPP
Sbjct: 384 PPYVYNSPPPPYYSPSPKVDYKSPPPPYI-YNSPPPPYYSPSPKVNYKTPPPPYVYSSPP 442

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPYYSPSPKV YKSP        PPP YYSPSP V+YKSPPPP    SP T Y
Sbjct: 443 PPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPPYVYSSPPTPY 495

 Score =  168 bits (426), Expect = 1e-40
 Identities = 82/122 (67%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKS P P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 85  PSYVYSSPPPPYYSPSPKVDYKSLPPPYV-YSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 143

Query: 192 PPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYKSPPPPS---------YSPSPKT 320
           PPYYSPSPK  YKSPPPP         YYSPSPKV+YKSPPPP          YSP+PK 
Sbjct: 144 PPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKV 203

Query: 321 EY 326
           +Y
Sbjct: 204 DY 205

 Score =  168 bits (425), Expect = 2e-40
 Identities = 83/122 (68%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPY Y SPP
Sbjct: 210 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVNYKSPPPPY-YRSPP 267

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSP+PK 
Sbjct: 268 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKV 327

Query: 321 EY 326
           +Y
Sbjct: 328 DY 329

 Score =  165 bits (418), Expect = 1e-39
 Identities = 81/122 (66%), Positives = 85/122 (69%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P +Y  SPPP YYSPSPKV YKSPP P      PPPP YSPSPKV YKS PPPYVY+SPP
Sbjct: 60  PSIYSSSPPPSYYSPSPKVDYKSPP-PSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPP 118

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPK +YK         SPPPP YSPSPK 
Sbjct: 119 PPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKV 178

Query: 321 EY 326
           +Y
Sbjct: 179 DY 180

 Score =  160 bits (406), Expect = 3e-38
 Identities = 75/103 (72%), Positives = 78/103 (75%), Gaps = 8/103 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YK+PP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 409 PPYIYNSPPPPYYSPSPKVNYKTPPPPYV-YSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 467

Query: 192 PPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYKSPPPP 296
           PPYYSPSP V YKSPPPP         YYSPS KV YKSPPPP
Sbjct: 468 PPYYSPSPNVDYKSPPPPYVYSSPPTPYYSPSSKVTYKSPPPP 510

 Score =  134 bits (338), Expect = 2e-30
 Identities = 61/81 (75%), Positives = 63/81 (77%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSP V YKSPPPPYVY+SPP
Sbjct: 434 PPYVYSSPPPPYYSPSPKVNYKSPPPPYV-YSSPPPPYYSPSPNVDYKSPPPPYVYSSPP 492

Query: 192 PPYYSPSPKVYYKSPPPPSYY 254
            PYYSPS KV YKSPPPP  Y
Sbjct: 493 TPYYSPSSKVTYKSPPPPYVY 513

 Score =  134 bits (337), Expect = 3e-30
 Identities = 71/123 (57%), Positives = 77/123 (62%), Gaps = 22/123 (17%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSP-----PHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           Y SP  P+Y+ SP   +K P     P P +    PPP  YSPSPKV YKSPPP YVY+SP
Sbjct: 34  YTSPQTPHYN-SPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYSSP 92

Query: 189 PPPYYSPSPKVYYK--------SPPPPSYYSPSPKVEYK---------SPPPPSYSPSPK 317
           PPPYYSPSPKV YK        S PPP YYSPSPKV YK         SPPPP YSPSPK
Sbjct: 93  PPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPK 152

Query: 318 TEY 326
            +Y
Sbjct: 153 GDY 155

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 56/113 (49%), Positives = 61/113 (53%), Gaps = 18/113 (15%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP-YYSPSPK 218
           PY SP    +Y SP H H        P Y+P PK        P +Y+S PPP YYSPSPK
Sbjct: 33  PYTSPQTP-HYNSPSHEHKI------PKYTPHPK--------PSIYSSSPPPSYYSPSPK 77

Query: 219 VYYKSPPPPS-Y-------YSPSPKVEYK---------SPPPPSYSPSPKTEY 326
           V YKSPPP   Y       YSPSPKV+YK         SPPPP YSPSPK  Y
Sbjct: 78  VDYKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNY 130

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/66 (66%), Positives = 45/66 (68%), Gaps = 9/66 (13%)
 Frame = +3

Query: 9   SPKVYYK---------SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YK         SPPPPYYSPSP V YKSPP P+V    PP P YSPS KV YKSP
Sbjct: 449 SPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPPYV-YSSPPTPYYSPSSKVTYKSP 507

Query: 162 PPPYVY 179
           PPPYVY
Sbjct: 508 PPPYVY 513

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/75 (45%), Positives = 39/75 (52%), Gaps = 23/75 (30%)
 Frame = +3

Query: 171 YVYNSPPPPYYSPSPKVYYKSP-----PPPSYY---------SPSPKVEYK--------- 281
           Y Y SP  P+Y+ SP   +K P     P PS Y         SPSPKV+YK         
Sbjct: 32  YPYTSPQTPHYN-SPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYS 90

Query: 282 SPPPPSYSPSPKTEY 326
           SPPPP YSPSPK +Y
Sbjct: 91  SPPPPYYSPSPKVDY 105

[11][TOP]
>UniRef100_Q9FG06 Genomic DNA, chromosome 5, BAC clone:F15M7 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FG06_ARATH
          Length = 689

 Score =  179 bits (453), Expect = 1e-43
 Identities = 91/132 (68%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 370 SPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYV-YSSPPPPYYSPSPKVAYKSP 428

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV YKSP        PPP YYSPSPKVEYK         SPP
Sbjct: 429 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 488

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK EY
Sbjct: 489 PPYYSPSPKVEY 500

 Score =  178 bits (452), Expect = 1e-43
 Identities = 86/122 (70%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK+ YKSPP P+V    PPPP YSPSPKV YKSPPPPYVYNSPP
Sbjct: 180 PPYVYNSPPPPYYSPSPKIEYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 238

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP Y+SPSPKVEYK         SPPPP YSPSPK 
Sbjct: 239 PPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKV 298

Query: 321 EY 326
           EY
Sbjct: 299 EY 300

 Score =  178 bits (451), Expect = 2e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVYNSPP
Sbjct: 130 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKSPPPPYVYNSPP 188

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPK+ YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 189 PPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKV 248

Query: 321 EY 326
           +Y
Sbjct: 249 DY 250

 Score =  178 bits (451), Expect = 2e-43
 Identities = 85/122 (69%), Positives = 90/122 (73%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPY+SPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 255 PPYVYSSPPPPYFSPSPKVEYKSPPPPYV-YNSPPPPYYSPSPKVEYKSPPPPYVYSSPP 313

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKVYYKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 314 PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 373

Query: 321 EY 326
           +Y
Sbjct: 374 DY 375

 Score =  177 bits (450), Expect = 2e-43
 Identities = 86/122 (70%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKVYYKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 305 PPYVYSSPPPPYYSPSPKVYYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 363

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 364 PPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKV 423

Query: 321 EY 326
            Y
Sbjct: 424 AY 425

 Score =  176 bits (447), Expect = 5e-43
 Identities = 89/132 (67%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPP---------YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPP         YYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 95  SPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSP 153

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV YKSP        PPP YYSPSPK+EYK         SPP
Sbjct: 154 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPP 213

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK +Y
Sbjct: 214 PPYYSPSPKVDY 225

 Score =  176 bits (445), Expect = 9e-43
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 280 PPYVYNSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 338

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPP---------SYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YKSPPPP          YSPSPK 
Sbjct: 339 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKV 398

Query: 321 EY 326
            Y
Sbjct: 399 AY 400

 Score =  175 bits (444), Expect = 1e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP +SPSPKV YKSPPPPYVYNSPP
Sbjct: 230 PPYVYNSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYFSPSPKVEYKSPPPPYVYNSPP 288

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 289 PPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 348

Query: 321 EY 326
           +Y
Sbjct: 349 DY 350

 Score =  175 bits (444), Expect = 1e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPP  YSPSPKV YKSPPPPYVY+SPP
Sbjct: 355 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPQYYSPSPKVAYKSPPPPYVYSSPP 413

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 414 PPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 473

Query: 321 EY 326
           EY
Sbjct: 474 EY 475

 Score =  175 bits (443), Expect = 2e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPK+ YKSPPPPYVY+SPP
Sbjct: 155 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YNSPPPPYYSPSPKIEYKSPPPPYVYSSPP 213

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP +SPSPK 
Sbjct: 214 PPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKV 273

Query: 321 EY 326
           EY
Sbjct: 274 EY 275

 Score =  175 bits (443), Expect = 2e-42
 Identities = 89/132 (67%), Positives = 92/132 (69%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKVYYKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 320 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSP 378

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPP YYSPSPKV YKSP        PPP YYSPSPKV YK         SPP
Sbjct: 379 PPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPP 438

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK +Y
Sbjct: 439 PPYYSPSPKVDY 450

 Score =  175 bits (443), Expect = 2e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 405 PPYVYSSPPPPYYSPSPKVAYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 463

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKVEYK         SPPPP +SPSPK 
Sbjct: 464 PPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKV 523

Query: 321 EY 326
            Y
Sbjct: 524 NY 525

 Score =  173 bits (439), Expect = 5e-42
 Identities = 86/122 (70%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPP YYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 80  PYVYISPPPPSYYSPSPKVNYKSPPPPNV-YNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 138

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKVEYK         SPPPP YSPSPK 
Sbjct: 139 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKI 198

Query: 321 EY 326
           EY
Sbjct: 199 EY 200

 Score =  173 bits (439), Expect = 5e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 205 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 263

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPY+SPSPKV YKSP        PPP YYSPSPKVEYK         SPPPP YSPSPK 
Sbjct: 264 PPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKV 323

Query: 321 EY 326
            Y
Sbjct: 324 YY 325

 Score =  173 bits (439), Expect = 5e-42
 Identities = 84/122 (68%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 455 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 513

Query: 192 PPYYSPSPKVYYKSPP--------PPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPY+SPSPKV YKSPP        PP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 514 PPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKV 573

Query: 321 EY 326
            Y
Sbjct: 574 NY 575

 Score =  173 bits (438), Expect = 6e-42
 Identities = 84/122 (68%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 430 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 488

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSP---------PPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP Y+SPSPKV YKSP         PPP YSPSPK 
Sbjct: 489 PPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKV 548

Query: 321 EY 326
            Y
Sbjct: 549 NY 550

 Score =  168 bits (425), Expect = 2e-40
 Identities = 82/122 (67%), Positives = 86/122 (70%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP +SPSPKV YKSPPPPYVY+S P
Sbjct: 480 PPYVYSSPPPPYYSPSPKVEYKSPPPPYV-YSSPPPPYHSPSPKVNYKSPPPPYVYSSHP 538

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSP  
Sbjct: 539 PPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMV 598

Query: 321 EY 326
           +Y
Sbjct: 599 DY 600

 Score =  166 bits (421), Expect = 6e-40
 Identities = 83/128 (64%), Positives = 88/128 (68%), Gaps = 17/128 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPY+SPSPKV YKSPP P+V     PPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 505 PPYVYSSPPPPYHSPSPKVNYKSPPPPYV-YSSHPPPYYSPSPKVNYKSPPPPYVYSSPP 563

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPP---------PSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSP V+YKS PP         P YSPSPK 
Sbjct: 564 PPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPPLPYYSPSPKV 623

Query: 321 EY*ISRLP 344
           +Y    LP
Sbjct: 624 DYKSPPLP 631

 Score =  166 bits (419), Expect = 1e-39
 Identities = 86/132 (65%), Positives = 89/132 (67%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 520 SPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPPYV-YSSPPPPYYSPSPKVNYKSP 578

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSP V YKS PPP         YYSPSPKV+YK         SPP
Sbjct: 579 PPPYVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPPLPYYSPSPKVDYKSPPLPYVYSSPP 638

Query: 291 PPSYSPSPKTEY 326
           P  YSPSPK  Y
Sbjct: 639 PLYYSPSPKVHY 650

 Score =  162 bits (410), Expect = 1e-38
 Identities = 81/122 (66%), Positives = 83/122 (68%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSP V YKS PPPYVY+ PP
Sbjct: 555 PPYVYSSPPPPYYSPSPKVNYKSPPPPYV-YSSPPPPYYSPSPMVDYKSTPPPYVYSFPP 613

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
            PYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 614 LPYYSPSPKVDYKSPPLPYVYSSPPPLYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKV 673

Query: 321 EY 326
            Y
Sbjct: 674 TY 675

 Score =  150 bits (380), Expect = 3e-35
 Identities = 77/123 (62%), Positives = 83/123 (67%), Gaps = 22/123 (17%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSP-----PHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           Y SP  P+Y+ SP   +KSP     P P+V + PPPP  YSPSPKV YKSPPPP VYNSP
Sbjct: 54  YSSPQTPHYN-SPSHEHKSPKYAPHPKPYVYISPPPPSYYSPSPKVNYKSPPPPNVYNSP 112

Query: 189 PPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPK 317
           PPPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK
Sbjct: 113 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPK 172

Query: 318 TEY 326
            EY
Sbjct: 173 VEY 175

 Score =  134 bits (336), Expect = 4e-30
 Identities = 62/81 (76%), Positives = 63/81 (77%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y  PP PYYSPSPKV YKSPP P+V    PPP  YSPSPKV YKSPPPPYVYNSPP
Sbjct: 605 PPYVYSFPPLPYYSPSPKVDYKSPPLPYV-YSSPPPLYYSPSPKVHYKSPPPPYVYNSPP 663

Query: 192 PPYYSPSPKVYYKSPPPPSYY 254
           PPYYSPSPKV YKSPPPP  Y
Sbjct: 664 PPYYSPSPKVTYKSPPPPYVY 684

 Score =  104 bits (259), Expect = 3e-21
 Identities = 62/116 (53%), Positives = 68/116 (58%), Gaps = 21/116 (18%)
 Frame = +3

Query: 42  PYYSP--SPKV-YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP-YYSP 209
           PY SP  SP+  +Y SP H H        P Y+P PK        PYVY SPPPP YYSP
Sbjct: 49  PYSSPYSSPQTPHYNSPSHEH------KSPKYAPHPK--------PYVYISPPPPSYYSP 94

Query: 210 SPKVYYKSPPPPS--------YYSPSPKVEYK---------SPPPPSYSPSPKTEY 326
           SPKV YKSPPPP+        YYSPSPKV+YK         SPPPP YSPSPK +Y
Sbjct: 95  SPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDY 150

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/69 (68%), Positives = 50/69 (72%), Gaps = 9/69 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPP PY         YSPSPKV+YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 620 SPKVDYKSPPLPYVYSSPPPLYYSPSPKVHYKSPPPPYV-YNSPPPPYYSPSPKVTYKSP 678

Query: 162 PPPYVYNSP 188
           PPPYVY +P
Sbjct: 679 PPPYVYKAP 687

[12][TOP]
>UniRef100_Q9FH26 Genomic DNA, chromosome 5, TAC clone: K20J1 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FH26_ARATH
          Length = 609

 Score =  177 bits (450), Expect = 2e-43
 Identities = 86/122 (70%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVYNSPP
Sbjct: 400 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 458

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 459 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 518

Query: 321 EY 326
           +Y
Sbjct: 519 DY 520

 Score =  176 bits (445), Expect = 9e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 375 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 433

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 434 PPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 493

Query: 321 EY 326
           +Y
Sbjct: 494 DY 495

 Score =  176 bits (445), Expect = 9e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 450 PPYVYNSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 508

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 509 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKV 568

Query: 321 EY 326
           +Y
Sbjct: 569 DY 570

 Score =  175 bits (443), Expect = 2e-42
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 425 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 483

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 484 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 543

Query: 321 EY 326
           +Y
Sbjct: 544 DY 545

 Score =  174 bits (442), Expect = 2e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 175 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 233

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSP+PKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 234 PPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSPKV 293

Query: 321 EY 326
           +Y
Sbjct: 294 DY 295

 Score =  174 bits (442), Expect = 2e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSP+PKV YKSPPPPYVY+SPP
Sbjct: 200 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 258

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 259 PPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 318

Query: 321 EY 326
           +Y
Sbjct: 319 DY 320

 Score =  174 bits (442), Expect = 2e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 300 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 358

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSP+PKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 359 PPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 418

Query: 321 EY 326
           +Y
Sbjct: 419 DY 420

 Score =  174 bits (442), Expect = 2e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSP+PKV YKSPPPPYVY+SPP
Sbjct: 325 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 383

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 384 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 443

Query: 321 EY 326
           +Y
Sbjct: 444 DY 445

 Score =  174 bits (442), Expect = 2e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSP+PKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 350 PPYVYSSPPPPYYSPTPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 408

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 409 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKV 468

Query: 321 EY 326
           +Y
Sbjct: 469 DY 470

 Score =  174 bits (442), Expect = 2e-42
 Identities = 85/122 (69%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 475 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 533

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 534 PPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 593

Query: 321 EY 326
            Y
Sbjct: 594 TY 595

 Score =  174 bits (441), Expect = 3e-42
 Identities = 85/128 (66%), Positives = 91/128 (71%), Gaps = 17/128 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSP+PKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 150 PPYVYSSPPPPYYSPTPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 208

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSP+PKV+YK         SPPPP YSPSPK 
Sbjct: 209 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKV 268

Query: 321 EY*ISRLP 344
           +Y    LP
Sbjct: 269 DYKSPPLP 276

 Score =  174 bits (441), Expect = 3e-42
 Identities = 84/122 (68%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 250 PPYVYSSPPPPYYSPSPKVDYKSPPLPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 308

Query: 192 PPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSPPPP         YYSPSPKV+YK         SPPPP YSP+PK 
Sbjct: 309 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKV 368

Query: 321 EY 326
           +Y
Sbjct: 369 DY 370

 Score =  174 bits (440), Expect = 4e-42
 Identities = 88/132 (66%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPP---------PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPP         PPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 265 SPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSP 323

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV YKSP        PPP YYSP+PKV+YK         SPP
Sbjct: 324 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 383

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK +Y
Sbjct: 384 PPYYSPSPKVDY 395

 Score =  172 bits (436), Expect = 1e-41
 Identities = 86/132 (65%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPK+ YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSP+PKV YKSP
Sbjct: 115 SPKIDYKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPTPKVDYKSP 173

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPP
Sbjct: 174 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 233

Query: 291 PPSYSPSPKTEY 326
           PP YSP+PK +Y
Sbjct: 234 PPYYSPTPKVDY 245

 Score =  171 bits (432), Expect = 3e-41
 Identities = 83/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSP+PKV YKSPP P+V    PPPP YSPSPKV YKSPP PYVY+SPP
Sbjct: 225 PPYVYSSPPPPYYSPTPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPLPYVYSSPP 283

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 284 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 343

Query: 321 EY 326
           +Y
Sbjct: 344 DY 345

 Score =  170 bits (430), Expect = 5e-41
 Identities = 82/122 (67%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK+ YKSPP P+V    PP P YSPSPKV YKSPPPPYVY+SPP
Sbjct: 100 PPYEYSSPPPPYYSPSPKIDYKSPPPPYV-YSSPPLPYYSPSPKVDYKSPPPPYVYSSPP 158

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSP+PKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 159 PPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 218

Query: 321 EY 326
           +Y
Sbjct: 219 DY 220

 Score =  169 bits (429), Expect = 7e-41
 Identities = 80/118 (67%), Positives = 87/118 (73%), Gaps = 17/118 (14%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y SPPPPYYSPSPKV YKSPP P+V    PPPP Y+PSPKV YKSPPPPY Y+SPPPPYY
Sbjct: 54  YNSPPPPYYSPSPKVNYKSPPPPYV-YSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYY 112

Query: 204 SPSPKVYYKSPPPP--------SYYSPSPKVEYK---------SPPPPSYSPSPKTEY 326
           SPSPK+ YKSPPPP         YYSPSPKV+YK         SPPPP YSP+PK +Y
Sbjct: 113 SPSPKIDYKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDY 170

 Score =  167 bits (422), Expect = 4e-40
 Identities = 80/122 (65%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYY+PSPKV YKSPP P+     PPPP YSPSPK+ YKSPPPPYVY+SPP
Sbjct: 75  PPYVYSSPPPPYYTPSPKVDYKSPPPPYE-YSSPPPPYYSPSPKIDYKSPPPPYVYSSPP 133

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
            PYYSPSPKV YKSP        PPP YYSP+PKV+YK         SPPPP YSPSPK 
Sbjct: 134 LPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKV 193

Query: 321 EY 326
           +Y
Sbjct: 194 DY 195

 Score =  165 bits (418), Expect = 1e-39
 Identities = 79/109 (72%), Positives = 81/109 (74%), Gaps = 8/109 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVYNSPP
Sbjct: 500 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 558

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPYYSPSPKV YKSP        PPP YYSPSPKV YKS PPP    +P
Sbjct: 559 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVTYKSLPPPYVYKAP 607

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 57/112 (50%), Positives = 62/112 (55%), Gaps = 17/112 (15%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKV 221
           PY SP     Y  P H H        P Y+P  K        PY+YNSPPPPYYSPSPKV
Sbjct: 24  PYSSPQTP-QYNFPSHQH------KSPKYTPHSK--------PYIYNSPPPPYYSPSPKV 68

Query: 222 YYKSPPPPS-Y-------YSPSPKVEYK---------SPPPPSYSPSPKTEY 326
            YKSPPPP  Y       Y+PSPKV+YK         SPPPP YSPSPK +Y
Sbjct: 69  NYKSPPPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSPSPKIDY 120

[13][TOP]
>UniRef100_Q9T0L0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0L0_ARATH
          Length = 429

 Score =  176 bits (446), Expect = 7e-43
 Identities = 87/135 (64%), Positives = 93/135 (68%), Gaps = 29/135 (21%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           SPKV YKSPPPPY          YSPSPKV YKSPP P+V   PPPPP YSPSPKV YKS
Sbjct: 194 SPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKS 253

Query: 159 PPPPYVYNSPPPPYYSPSPKV---------YYKSPPPPSYYSPSPKVEYKSPPPP----- 296
           PPPPYVY+SPPPP YSPSPKV          Y SPPPPSYYSPSPK++YKSPPPP     
Sbjct: 254 PPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSS 313

Query: 297 -----SYSPSPKTEY 326
                 YSPSP+ +Y
Sbjct: 314 PPPPTYYSPSPRVDY 328

 Score =  174 bits (440), Expect = 4e-42
 Identities = 84/124 (67%), Positives = 88/124 (70%), Gaps = 19/124 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN-SP 188
           P +Y   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+  P
Sbjct: 153 PYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPP 212

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYK---------SPPPPSYSPSP 314
           PPPYYSPSPKV YK         SPPPP YYSPSPKV YK         SPPPP YSPSP
Sbjct: 213 PPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSP 272

Query: 315 KTEY 326
           K E+
Sbjct: 273 KVEF 276

 Score =  172 bits (437), Expect = 8e-42
 Identities = 88/136 (64%), Positives = 91/136 (66%), Gaps = 30/136 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           SPKV YKSPPPPY          YSPSPKV Y SPP P++   PPPPP YSPSPKV YKS
Sbjct: 116 SPKVEYKSPPPPYVYSSLPPLTYYSPSPKVIYNSPPPPYIYSSPPPPPYYSPSPKVDYKS 175

Query: 159 PPPPYVYNS-PPPPYYSPSPKVYYKS---------PPPPSYYSPSPKVEYKS-------- 284
           PPPPYVY+S PPPPYYSPSPKV YKS         PPPP YYSPSPKV YKS        
Sbjct: 176 PPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYS 235

Query: 285 --PPPPSYSPSPKTEY 326
             PPPP YSPSPK  Y
Sbjct: 236 SPPPPPYYSPSPKVNY 251

 Score =  169 bits (429), Expect = 7e-41
 Identities = 84/124 (67%), Positives = 88/124 (70%), Gaps = 19/124 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPP PYVY+S P
Sbjct: 179 PYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPP 238

Query: 189 PPPYYSPSPKVYYKSPPPPSY--------YSPSPKVEYKSPPPP----------SYSPSP 314
           PPPYYSPSPKV YKSPPPP          YSPSPKVE+KSPPPP           YSPSP
Sbjct: 239 PPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSP 298

Query: 315 KTEY 326
           K +Y
Sbjct: 299 KIDY 302

 Score =  166 bits (420), Expect = 7e-40
 Identities = 82/135 (60%), Positives = 90/135 (66%), Gaps = 29/135 (21%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           +P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV +KSPPPPY+YNSP
Sbjct: 230 APYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPP-YSPSPKVEFKSPPPPYIYNSP 288

Query: 189 PPP-YYSPSPKVYYKSPPPP---------SYYSPSPKVEYKS------------------ 284
           PPP YYSPSPK+ YKSPPPP         +YYSPSP+V+YKS                  
Sbjct: 289 PPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNS 348

Query: 285 -PPPPSYSPSPKTEY 326
            PPPP YSPSP   Y
Sbjct: 349 PPPPPYYSPSPTVNY 363

 Score =  164 bits (414), Expect = 4e-39
 Identities = 86/145 (59%), Positives = 90/145 (62%), Gaps = 39/145 (26%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           SPKV +KSPPPPY          YSPSPK+ YKSPP P+V   PPPP  YSPSP+V YKS
Sbjct: 271 SPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKS 330

Query: 159 PPPPYVYNS----------PPPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYK 281
           PPPPYVYNS          PPPPYYSPSP V YK         SPPPP YYSP PKVEYK
Sbjct: 331 PPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYK 390

Query: 282 S----------PPPPSYSPSPKTEY 326
           S          PPPP YSPSPK  Y
Sbjct: 391 SPPPPYIYNSPPPPPYYSPSPKITY 415

 Score =  160 bits (404), Expect = 5e-38
 Identities = 81/125 (64%), Positives = 85/125 (68%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY  SPP  YYSPSPKV YKSPP P+V    PP   YSPSPKV+Y SPPPPY+Y+S P
Sbjct: 101 PSVYTFSPPQLYYSPSPKVEYKSPPPPYVYSSLPPLTYYSPSPKVIYNSPPPPYIYSSPP 160

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYYSPSPKV YK         SPPPP YYSPSPKVEYKS          PPPP YSPS
Sbjct: 161 PPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPS 220

Query: 312 PKTEY 326
           PK  Y
Sbjct: 221 PKVGY 225

 Score =  155 bits (392), Expect = 1e-36
 Identities = 80/131 (61%), Positives = 85/131 (64%), Gaps = 29/131 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY----------YSPSPKVYYKSPPHPHVCVC---------PPPPPCYS 131
           SPK+ YKSPPPPY          YSPSP+V YKSPP P+V            PPPPP YS
Sbjct: 297 SPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYS 356

Query: 132 PSPKVVYKSPPPPYVYNSPPPP-YYSPSPKVYYKSPPPP---------SYYSPSPKVEYK 281
           PSP V YKSPPPPYVYNSPPPP YYSP PKV YKSPPPP          YYSPSPK+ YK
Sbjct: 357 PSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSPSPKITYK 416

Query: 282 SPPPPSYSPSP 314
           SPPPP    +P
Sbjct: 417 SPPPPYIYKTP 427

 Score =  143 bits (361), Expect = 5e-33
 Identities = 75/125 (60%), Positives = 78/125 (62%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY    P PYY P PK+  KSPP P V    PP   YSPSPKV YKSPPPPYVY+S P
Sbjct: 75  PNVYDSPTPLPYYFPFPKLDIKSPPPPSVYTFSPPQLYYSPSPKVEYKSPPPPYVYSSLP 134

Query: 189 PPPYYSPSPKV---------YYKSPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           P  YYSPSPKV          Y SPPPP YYSPSPKV+YKS          PPPP YSPS
Sbjct: 135 PLTYYSPSPKVIYNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPS 194

Query: 312 PKTEY 326
           PK EY
Sbjct: 195 PKVEY 199

 Score =  115 bits (289), Expect = 1e-24
 Identities = 64/118 (54%), Positives = 68/118 (57%), Gaps = 20/118 (16%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN-SPPPPYYSP 209
           PPP Y    PK  Y   P P+V   P P P Y P PK+  KSPPPP VY  SPP  YYSP
Sbjct: 58  PPPQYRRQEPK--YTPHPEPNVYDSPTPLPYYFPFPKLDIKSPPPPSVYTFSPPQLYYSP 115

Query: 210 SPKVYYKSPPPP---------SYYSPSPKVEYKS----------PPPPSYSPSPKTEY 326
           SPKV YKSPPPP         +YYSPSPKV Y S          PPPP YSPSPK +Y
Sbjct: 116 SPKVEYKSPPPPYVYSSLPPLTYYSPSPKVIYNSPPPPYIYSSPPPPPYYSPSPKVDY 173

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 59/123 (47%), Positives = 64/123 (52%), Gaps = 22/123 (17%)
 Frame = +3

Query: 24  YKSPP--PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP- 194
           Y SP   P Y SP P   Y     P++   PPPPP      +  Y   P P VY+SP P 
Sbjct: 29  YDSPSSTPQYTSPYPPKNYS----PYLSESPPPPPPQYRRQEPKYTPHPEPNVYDSPTPL 84

Query: 195 PYYSPSPKVYYKSPPPPS---------YYSPSPKVEYKSPPPP----------SYSPSPK 317
           PYY P PK+  KSPPPPS         YYSPSPKVEYKSPPPP           YSPSPK
Sbjct: 85  PYYFPFPKLDIKSPPPPSVYTFSPPQLYYSPSPKVEYKSPPPPYVYSSLPPLTYYSPSPK 144

Query: 318 TEY 326
             Y
Sbjct: 145 VIY 147

[14][TOP]
>UniRef100_Q9STM7 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STM7_ARATH
          Length = 707

 Score =  176 bits (445), Expect = 9e-43
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 253 PPYVYSSPPPPYYSPSPKVNYKSPPPPYV-YGSPPPPYYSPSPKVDYKSPPPPYVYSSPP 311

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 312 PPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 371

Query: 321 EY 326
           +Y
Sbjct: 372 DY 373

 Score =  175 bits (444), Expect = 1e-42
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 303 PPYVYSSPPPPYYSPSPKVNYKSPPPPYV-YGSPPPPYYSPSPKVDYKSPPPPYVYSSPP 361

Query: 192 PPYYSPSPKVYYKSPP--------PPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSPP        PP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 362 PPYYSPSPKVDYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 421

Query: 321 EY 326
           +Y
Sbjct: 422 DY 423

 Score =  175 bits (443), Expect = 2e-42
 Identities = 89/132 (67%), Positives = 92/132 (69%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 268 SPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVNYKSP 326

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSP---------P 290
           PPPYVY SPPPPYYSPSPKV YKSP        PPP YYSPSPKV+YKSP         P
Sbjct: 327 PPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSTP 386

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK +Y
Sbjct: 387 PPYYSPSPKVDY 398

 Score =  175 bits (443), Expect = 2e-42
 Identities = 85/122 (69%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V   PPPP  YSPSPKV YKSPPPPYVY+SPP
Sbjct: 478 PPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPP-YYSPSPKVDYKSPPPPYVYSSPP 536

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKVEYK         SPPPP Y+PSPK 
Sbjct: 537 PPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKV 596

Query: 321 EY 326
           +Y
Sbjct: 597 DY 598

 Score =  174 bits (442), Expect = 2e-42
 Identities = 85/122 (69%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY SPP
Sbjct: 228 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVNYKSPPPPYVYGSPP 286

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 287 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKV 346

Query: 321 EY 326
           +Y
Sbjct: 347 DY 348

 Score =  174 bits (441), Expect = 3e-42
 Identities = 84/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSP+PKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 203 PPYVYSSPPPPYYSPTPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 261

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 262 PPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 321

Query: 321 EY 326
            Y
Sbjct: 322 NY 323

 Score =  174 bits (441), Expect = 3e-42
 Identities = 88/132 (66%), Positives = 93/132 (70%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 493 SPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVNYKSP 551

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV YKSP        PPP YY+PSPKV+YK         SPP
Sbjct: 552 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPP 611

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK +Y
Sbjct: 612 PPYYSPSPKVDY 623

 Score =  174 bits (441), Expect = 3e-42
 Identities = 83/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPY+Y+SPP
Sbjct: 528 PPYVYSSPPPPYYSPSPKVNYKSPPPPYV-YSSPPPPYYSPSPKVEYKSPPPPYIYSSPP 586

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYY+PSPKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 587 PPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 646

Query: 321 EY 326
            Y
Sbjct: 647 NY 648

 Score =  174 bits (440), Expect = 4e-42
 Identities = 84/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSP+PKV YKSPPPPYVY+SPP
Sbjct: 178 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 236

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 237 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKV 296

Query: 321 EY 326
           +Y
Sbjct: 297 DY 298

 Score =  174 bits (440), Expect = 4e-42
 Identities = 83/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P++    PPPP Y+PSPKV YKSPPPPYVY+SPP
Sbjct: 553 PPYVYSSPPPPYYSPSPKVEYKSPPPPYI-YSSPPPPYYAPSPKVDYKSPPPPYVYSSPP 611

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 612 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKV 671

Query: 321 EY 326
           +Y
Sbjct: 672 DY 673

 Score =  172 bits (437), Expect = 8e-42
 Identities = 84/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V     PPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 353 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSTPPPYYSPSPKVDYKSPPPPYVYSSPP 411

Query: 192 PPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSPPPP         YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 412 PPYYSPSPKVDYKSPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 471

Query: 321 EY 326
           +Y
Sbjct: 472 DY 473

 Score =  172 bits (436), Expect = 1e-41
 Identities = 83/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPK  YKSPPPPYVY+SPP
Sbjct: 128 PPYVYSSPPPPYYSPSPKVNYKSPPPPYV-YSSPPPPYYSPSPKGDYKSPPPPYVYSSPP 186

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSP+PKV+YK         SPPPP YSPSPK 
Sbjct: 187 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKV 246

Query: 321 EY 326
           +Y
Sbjct: 247 DY 248

 Score =  172 bits (436), Expect = 1e-41
 Identities = 88/132 (66%), Positives = 92/132 (69%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 318 SPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSP 376

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPP-------- 293
           PPPYVY+S PPPYYSPSPKV YKSP        PPP YYSPSPKV+YKSPPP        
Sbjct: 377 PPPYVYSSTPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYIYSSTP 436

Query: 294 -PSYSPSPKTEY 326
            P YSPSPK +Y
Sbjct: 437 LPYYSPSPKVDY 448

 Score =  172 bits (436), Expect = 1e-41
 Identities = 88/132 (66%), Positives = 91/132 (68%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YK P
Sbjct: 418 SPKVDYKSPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKPP 476

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPYVY+SPPPPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPP
Sbjct: 477 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYVYSSPP 536

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK  Y
Sbjct: 537 PPYYSPSPKVNY 548

 Score =  172 bits (435), Expect = 1e-41
 Identities = 84/122 (68%), Positives = 86/122 (70%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YK PP P+V    PPPP YSPSPKV YKSPPPPYVY+ PP
Sbjct: 453 PPYVYSSPPPPYYSPSPKVDYKPPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSFPP 511

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV YK         SPPPP YSPSPK 
Sbjct: 512 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKV 571

Query: 321 EY 326
           EY
Sbjct: 572 EY 573

 Score =  171 bits (433), Expect = 2e-41
 Identities = 83/122 (68%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPK  YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 153 PPYVYSSPPPPYYSPSPKGDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 211

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSP+PKV YKSP        PPP YYSPSPKV+YK         SPPPP YSPSPK 
Sbjct: 212 PPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 271

Query: 321 EY 326
            Y
Sbjct: 272 NY 273

 Score =  171 bits (432), Expect = 3e-41
 Identities = 83/122 (68%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYY+PSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 578 PPYIYSSPPPPYYAPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 636

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPP P YSPSPK 
Sbjct: 637 PPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSSPPQYVYSSPPTPYYSPSPKV 696

Query: 321 EY 326
            Y
Sbjct: 697 TY 698

 Score =  168 bits (426), Expect = 1e-40
 Identities = 82/122 (67%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKS P P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 103 PSYVYSSPPPPYYSPSPKVDYKSLPPPYV-YSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 161

Query: 192 PPYYSPSPKVYYKSPPPP--------SYYSPSPKVEYKSPPPPS---------YSPSPKT 320
           PPYYSPSPK  YKSPPPP         YYSPSPKV+YKSPPPP          YSP+PK 
Sbjct: 162 PPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKV 221

Query: 321 EY 326
           +Y
Sbjct: 222 DY 223

 Score =  167 bits (424), Expect = 3e-40
 Identities = 86/132 (65%), Positives = 91/132 (68%), Gaps = 26/132 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YKSPPPPY         YSPSPKV YKSPP P+V    PPPP YSPSPKV YKSP
Sbjct: 368 SPKVDYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKSP 426

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPP 290
           PPPY+Y+S P PYYSPSPKV YKSP        PPP YYSPSPKV+YK         SPP
Sbjct: 427 PPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPP 486

Query: 291 PPSYSPSPKTEY 326
           PP YSPSPK +Y
Sbjct: 487 PPYYSPSPKVDY 498

 Score =  166 bits (421), Expect = 6e-40
 Identities = 81/122 (66%), Positives = 86/122 (70%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P++     P P YSPSPKV YKSPPPPYVY+SPP
Sbjct: 403 PPYVYSSPPPPYYSPSPKVDYKSPPPPYI-YSSTPLPYYSPSPKVDYKSPPPPYVYSSPP 461

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKS---------PPPPSYSPSPKT 320
           PPYYSPSPKV YK P        PPP YYSPSPKV+YKS         PPPP YSPSPK 
Sbjct: 462 PPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKV 521

Query: 321 EY 326
           +Y
Sbjct: 522 DY 523

 Score =  165 bits (418), Expect = 1e-39
 Identities = 81/122 (66%), Positives = 85/122 (69%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P +Y  SPPP YYSPSPKV YKSPP P      PPPP YSPSPKV YKS PPPYVY+SPP
Sbjct: 78  PSIYSSSPPPSYYSPSPKVDYKSPP-PSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPP 136

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YKSP        PPP YYSPSPK +YK         SPPPP YSPSPK 
Sbjct: 137 PPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKV 196

Query: 321 EY 326
           +Y
Sbjct: 197 DY 198

 Score =  160 bits (405), Expect = 4e-38
 Identities = 76/103 (73%), Positives = 78/103 (75%), Gaps = 8/103 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 603 PPYVYSSPPPPYYSPSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 661

Query: 192 PPYYSPSPKVYYK--------SPPPPSYYSPSPKVEYKSPPPP 296
           PPYYSPSPKV YK        S PP  YYSPSPKV YKSPPPP
Sbjct: 662 PPYYSPSPKVDYKSSPPQYVYSSPPTPYYSPSPKVTYKSPPPP 704

 Score =  134 bits (337), Expect = 3e-30
 Identities = 71/123 (57%), Positives = 77/123 (62%), Gaps = 22/123 (17%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSP-----PHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           Y SP  P+Y+ SP   +K P     P P +    PPP  YSPSPKV YKSPPP YVY+SP
Sbjct: 52  YTSPQTPHYN-SPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYSSP 110

Query: 189 PPPYYSPSPKVYYK--------SPPPPSYYSPSPKVEYK---------SPPPPSYSPSPK 317
           PPPYYSPSPKV YK        S PPP YYSPSPKV YK         SPPPP YSPSPK
Sbjct: 111 PPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPK 170

Query: 318 TEY 326
            +Y
Sbjct: 171 GDY 173

 Score =  133 bits (335), Expect = 5e-30
 Identities = 61/81 (75%), Positives = 63/81 (77%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKS PP YVY+SPP
Sbjct: 628 PPYVYSSPPPPYYSPSPKVNYKSPPPPYV-YSSPPPPYYSPSPKVDYKSSPPQYVYSSPP 686

Query: 192 PPYYSPSPKVYYKSPPPPSYY 254
            PYYSPSPKV YKSPPPP  Y
Sbjct: 687 TPYYSPSPKVTYKSPPPPYVY 707

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 56/113 (49%), Positives = 61/113 (53%), Gaps = 18/113 (15%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP-YYSPSPK 218
           PY SP    +Y SP H H        P Y+P PK        P +Y+S PPP YYSPSPK
Sbjct: 51  PYTSPQTP-HYNSPSHEHKI------PKYTPHPK--------PSIYSSSPPPSYYSPSPK 95

Query: 219 VYYKSPPPPS-Y-------YSPSPKVEYK---------SPPPPSYSPSPKTEY 326
           V YKSPPP   Y       YSPSPKV+YK         SPPPP YSPSPK  Y
Sbjct: 96  VDYKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNY 148

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 44/66 (66%), Positives = 44/66 (66%), Gaps = 9/66 (13%)
 Frame = +3

Query: 9   SPKVYYK---------SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YK         SPPPPYYSPSPKV YKS P P      PP P YSPSPKV YKSP
Sbjct: 643 SPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSSP-PQYVYSSPPTPYYSPSPKVTYKSP 701

Query: 162 PPPYVY 179
           PPPYVY
Sbjct: 702 PPPYVY 707

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/75 (45%), Positives = 39/75 (52%), Gaps = 23/75 (30%)
 Frame = +3

Query: 171 YVYNSPPPPYYSPSPKVYYKSP-----PPPSYY---------SPSPKVEYK--------- 281
           Y Y SP  P+Y+ SP   +K P     P PS Y         SPSPKV+YK         
Sbjct: 50  YPYTSPQTPHYN-SPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYS 108

Query: 282 SPPPPSYSPSPKTEY 326
           SPPPP YSPSPK +Y
Sbjct: 109 SPPPPYYSPSPKVDY 123

[15][TOP]
>UniRef100_Q2A9D2 Extensin-like region containing protein n=1 Tax=Brassica oleracea
           RepID=Q2A9D2_BRAOL
          Length = 347

 Score =  173 bits (438), Expect = 6e-42
 Identities = 84/125 (67%), Positives = 88/125 (70%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P +Y   PPPPYYSPSPK  YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+S P
Sbjct: 130 PYLYNSPPPPPYYSPSPKAEYKSPPPPYVYSYPPPPPYYSPSPKVEYKSPPPPYVYSSPP 189

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYYSPSPKV YK         SPPPP YYSP PKVEYKS          PPPP YSPS
Sbjct: 190 PPPYYSPSPKVEYKSQPPPYVYNSPPPPPYYSPLPKVEYKSPPPPYVYSSPPPPPYYSPS 249

Query: 312 PKTEY 326
           PK +Y
Sbjct: 250 PKVDY 254

 Score =  173 bits (438), Expect = 6e-42
 Identities = 85/125 (68%), Positives = 88/125 (70%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKS PPPYVYNSPP
Sbjct: 156 PYVYSYPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSQPPPYVYNSPP 215

Query: 192 PP-YYSPSPKVYYKSPPPP---------SYYSPSPKVEYKS----------PPPPSYSPS 311
           PP YYSP PKV YKSPPPP          YYSPSPKV+YKS          PPPP YSPS
Sbjct: 216 PPPYYSPLPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPS 275

Query: 312 PKTEY 326
           PK +Y
Sbjct: 276 PKVDY 280

 Score =  172 bits (437), Expect = 8e-42
 Identities = 85/125 (68%), Positives = 88/125 (70%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSP PKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+S P
Sbjct: 208 PYVYNSPPPPPYYSPLPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPP 267

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYYSPSPKV YK         SPPPP YYSPSPKV+YKS          PPPP YSPS
Sbjct: 268 PPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPS 327

Query: 312 PKTEY 326
           PK  Y
Sbjct: 328 PKVYY 332

 Score =  171 bits (433), Expect = 2e-41
 Identities = 84/125 (67%), Positives = 88/125 (70%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKS P P+V   PPPPP YSP PKV YKSPPPPYVY+S P
Sbjct: 182 PYVYSSPPPPPYYSPSPKVEYKSQPPPYVYNSPPPPPYYSPLPKVEYKSPPPPYVYSSPP 241

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYYSPSPKV YK         SPPPP YYSPSPKV+YKS          PPPP YSPS
Sbjct: 242 PPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPS 301

Query: 312 PKTEY 326
           PK +Y
Sbjct: 302 PKVDY 306

 Score =  169 bits (428), Expect = 9e-41
 Identities = 85/122 (69%), Positives = 87/122 (71%), Gaps = 21/122 (17%)
 Frame = +3

Query: 24  YKSPP-PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-PPPP 197
           Y SPP PPYYSPSPKV YKSPP P+V   PPPPP YSPS KV YKSPPPPY+YNS PPPP
Sbjct: 81  YSSPPLPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSLKVEYKSPPPPYLYNSPPPPP 140

Query: 198 YYSPSPKVYYKS---------PPPPSYYSPSPKVEYKS----------PPPPSYSPSPKT 320
           YYSPSPK  YKS         PPPP YYSPSPKVEYKS          PPPP YSPSPK 
Sbjct: 141 YYSPSPKAEYKSPPPPYVYSYPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKV 200

Query: 321 EY 326
           EY
Sbjct: 201 EY 202

 Score =  169 bits (428), Expect = 9e-41
 Identities = 80/107 (74%), Positives = 82/107 (76%), Gaps = 10/107 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-P 188
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+S P
Sbjct: 234 PYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPP 293

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKSPPPPSY 302
           PPPYYSPSPKV YK         SPPPP YYSPSPKV YKSPPPP Y
Sbjct: 294 PPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPY 340

 Score =  168 bits (426), Expect = 1e-40
 Identities = 83/125 (66%), Positives = 86/125 (68%), Gaps = 20/125 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN-SP 188
           P VY   PPPPYYSPS KV YKSPP P++   PPPPP YSPSPK  YKSPPPPYVY+  P
Sbjct: 104 PYVYSSPPPPPYYSPSLKVEYKSPPPPYLYNSPPPPPYYSPSPKAEYKSPPPPYVYSYPP 163

Query: 189 PPPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKS----------PPPPSYSPS 311
           PPPYYSPSPKV YK         SPPPP YYSPSPKVEYKS          PPPP YSP 
Sbjct: 164 PPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSQPPPYVYNSPPPPPYYSPL 223

Query: 312 PKTEY 326
           PK EY
Sbjct: 224 PKVEY 228

 Score =  149 bits (375), Expect = 1e-34
 Identities = 67/86 (77%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKSPPPPYVY+SPP
Sbjct: 260 PYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPP 319

Query: 192 PP-YYSPSPKVYYKSPPPPSYYSPSP 266
           PP YYSPSPKVYYKSPPPP Y    P
Sbjct: 320 PPPYYSPSPKVYYKSPPPPPYVYKKP 345

 Score =  124 bits (311), Expect = 3e-27
 Identities = 64/98 (65%), Positives = 66/98 (67%), Gaps = 20/98 (20%)
 Frame = +3

Query: 93  HVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP-YYSPSPKVYYKSPPPP-------- 245
           +V   PP PP YSPSPKV YKSPPPPYVY+SPPPP YYSPS KV YKSPPPP        
Sbjct: 79  YVYSSPPLPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSLKVEYKSPPPPYLYNSPPP 138

Query: 246 -SYYSPSPKVEYKS----------PPPPSYSPSPKTEY 326
             YYSPSPK EYKS          PPPP YSPSPK EY
Sbjct: 139 PPYYSPSPKAEYKSPPPPYVYSYPPPPPYYSPSPKVEY 176

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 49/71 (69%), Positives = 50/71 (70%), Gaps = 11/71 (15%)
 Frame = +3

Query: 9   SPKVYYKS----------PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           SPKV YKS          PPPPYYSPSPKV YKSPP P+V   PPPPP YSPSPKV YKS
Sbjct: 275 SPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKS 334

Query: 159 -PPPPYVYNSP 188
            PPPPYVY  P
Sbjct: 335 PPPPPYVYKKP 345

[16][TOP]
>UniRef100_Q9LHS1 Genomic DNA, chromosome 5, TAC clone:K3D20 n=2 Tax=Arabidopsis
           thaliana RepID=Q9LHS1_ARATH
          Length = 334

 Score =  171 bits (432), Expect = 3e-41
 Identities = 87/129 (67%), Positives = 91/129 (70%), Gaps = 18/129 (13%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           PK Y + SPPPPYYSPSPK  YKSPP P+V    PPPP YSPSPKV YKSPPPPYVYNSP
Sbjct: 80  PKPYLFNSPPPPYYSPSPKEDYKSPPPPYV-YNSPPPPYYSPSPKVDYKSPPPPYVYNSP 138

Query: 189 PPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPK 317
           PPPYYSPSPKV YKSP        PPP YYS SPKV+YK         SPPPP YSPSPK
Sbjct: 139 PPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPPPYVYNSPPPPYYSPSPK 198

Query: 318 TEY*ISRLP 344
            +Y  S  P
Sbjct: 199 VDYKFSPPP 207

 Score =  170 bits (431), Expect = 4e-41
 Identities = 84/122 (68%), Positives = 87/122 (71%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YSPSPKV YKSPPPPYVYNSPP
Sbjct: 106 PPYVYNSPPPPYYSPSPKVDYKSPPPPYV-YNSPPPPYYSPSPKVEYKSPPPPYVYNSPP 164

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYS SPKV YKSP        PPP YYSPSPKV+YK         SP PP YSPSPK 
Sbjct: 165 PPYYSLSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKV 224

Query: 321 EY 326
           +Y
Sbjct: 225 DY 226

 Score =  167 bits (424), Expect = 3e-40
 Identities = 84/122 (68%), Positives = 88/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YKSPP P+V    PPPP YS SPKV YKSPPPPYVYNSPP
Sbjct: 131 PPYVYNSPPPPYYSPSPKVEYKSPPPPYV-YNSPPPPYYSLSPKVDYKSPPPPYVYNSPP 189

Query: 192 PPYYSPSPKVYYK-SPPP-------PSYYSPSPKVEYK---------SPPPPSYSPSPKT 320
           PPYYSPSPKV YK SPPP       P YYSPSPKV+YK         SPPPP +SPSPK 
Sbjct: 190 PPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKV 249

Query: 321 EY 326
           +Y
Sbjct: 250 DY 251

 Score =  164 bits (416), Expect = 2e-39
 Identities = 80/116 (68%), Positives = 85/116 (73%), Gaps = 11/116 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SP PPYYSPSPKV YKSPP P+V    PPPP +SPSPKV YKSPPPPYVY+SPP
Sbjct: 206 PPYVYNSPSPPYYSPSPKVDYKSPPPPYV-YNSPPPPYFSPSPKVDYKSPPPPYVYSSPP 264

Query: 192 PP-YYSPSPKVYYKSPPPPSYYSPSPKVEYKS----------PPPPSYSPSPKTEY 326
           PP YYSPSP+V YKSPPPP YYSPS +V YKS          PPPP YSPSPK  Y
Sbjct: 265 PPPYYSPSPEVSYKSPPPPPYYSPSLEVSYKSPPPLFVYNFPPPPPFYSPSPKVSY 320

 Score =  161 bits (408), Expect = 2e-38
 Identities = 79/115 (68%), Positives = 83/115 (72%), Gaps = 10/115 (8%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYSPSPKV YK  P P+V    P PP YSPSPKV YKSPPPPYVYNSPP
Sbjct: 181 PPYVYNSPPPPYYSPSPKVDYKFSPPPYV-YNSPSPPYYSPSPKVDYKSPPPPYVYNSPP 239

Query: 192 PPYYSPSPKVYYK---------SPPPPSYYSPSPKVEYKSPPPPS-YSPSPKTEY 326
           PPY+SPSPKV YK         SPPPP YYSPSP+V YKSPPPP  YSPS +  Y
Sbjct: 240 PPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPPPYYSPSLEVSY 294

 Score =  160 bits (405), Expect = 4e-38
 Identities = 80/123 (65%), Positives = 84/123 (68%), Gaps = 18/123 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPPYYS SPKV YKSPP P+V    PPPP YSPSPKV YK  PPPYVYNSP 
Sbjct: 156 PPYVYNSPPPPYYSLSPKVDYKSPPPPYV-YNSPPPPYYSPSPKVDYKFSPPPYVYNSPS 214

Query: 192 PPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKS----------PPPPSYSPSPK 317
           PPYYSPSPKV YKSP        PPP Y+SPSPKV+YKS          PPPP YSPSP+
Sbjct: 215 PPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPE 274

Query: 318 TEY 326
             Y
Sbjct: 275 VSY 277

 Score =  139 bits (349), Expect = 1e-31
 Identities = 72/120 (60%), Positives = 78/120 (65%), Gaps = 18/120 (15%)
 Frame = +3

Query: 9   SPKVYYK---------SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPKV YK         SPPPPY+SPSPKV YKSPP P+V   PPPPP YSPSP+V YKSP
Sbjct: 221 SPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSP 280

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKS---------PPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                   PPPPYYSPS +V YKS         PPPP +YSPSPKV YKSPP P  S +P
Sbjct: 281 --------PPPPYYSPSLEVSYKSPPPLFVYNFPPPPPFYSPSPKVSYKSPPAPYVSKTP 332

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 60/121 (49%), Positives = 63/121 (52%), Gaps = 28/121 (23%)
 Frame = +3

Query: 48  YSPSPKVYYKSPPHPHVCVCPPPP--PCYSPSPKVV---------YKSPPPPYVYNSPPP 194
           YS      Y SP H H     P    P YS SP            Y   P PY++NSPPP
Sbjct: 31  YSSHQTPQYNSPVHKHESSYSPKKYSPYYSASPLPPLQYRRQGPKYTPHPKPYLFNSPPP 90

Query: 195 PYYSPSPKVYYKSPPPPS-Y-------YSPSPKVEYK---------SPPPPSYSPSPKTE 323
           PYYSPSPK  YKSPPPP  Y       YSPSPKV+YK         SPPPP YSPSPK E
Sbjct: 91  PYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVE 150

Query: 324 Y 326
           Y
Sbjct: 151 Y 151

[17][TOP]
>UniRef100_Q43687 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43687_VIGUN
          Length = 242

 Score =  132 bits (333), Expect = 9e-30
 Identities = 64/105 (60%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 85  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPRPSPPPPYYYKSPP 141

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS   P P   YKSPPPPS SP P   Y
Sbjct: 142 PPSPSPPPPYYYKSPPPPSPSPPPPSYYYKSPPPPSPSPPPPYYY 186

 Score =  131 bits (329), Expect = 3e-29
 Identities = 71/128 (55%), Positives = 71/128 (55%), Gaps = 14/128 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P  YYKSPPPP  SP P  YYKSPP P     PP      PPP  SP P   YKSPPPP 
Sbjct: 101 PPYYYKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 160

Query: 171 -------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY* 329
                  Y Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y 
Sbjct: 161 PSPPPPSYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYYK 219

Query: 330 ISRLPLYE 353
               P YE
Sbjct: 220 SPPPPPYE 227

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/95 (60%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           P  YYKSPPPP  S P P  YYKSPP P      PPPP Y  SP     SPPPPY Y SP
Sbjct: 149 PPYYYKSPPPPSPSPPPPSYYYKSPPPPSP---SPPPPYYYKSPPPPSPSPPPPYYYKSP 205

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
           PPP  SP P  YYKSPPPP Y    P  +YKSPPP
Sbjct: 206 PPPSPSPPPPYYYKSPPPPPYEHKDPYYQYKSPPP 240

 Score =  117 bits (294), Expect = 3e-25
 Identities = 64/120 (53%), Positives = 66/120 (55%), Gaps = 13/120 (10%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP------PPPPCYSPSPKVVYK---- 155
           +SP     SPPPPY    P   YKSPP P     P      PPPP  SP P   YK    
Sbjct: 51  SSPPPPSLSPPPPYKYKDPHYEYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPP 110

Query: 156 ---SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
              SPPPPY Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P + Y
Sbjct: 111 PSPSPPPPYYYKSPPPPRPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPSYY 169

 Score =  115 bits (289), Expect = 1e-24
 Identities = 59/109 (54%), Positives = 61/109 (55%), Gaps = 4/109 (3%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP----PPPCYSPSPKVVYKSPPPPYVY 179
           P   Y SPPPP  SP P   YK P + +    PP    PPP Y  SP     SPPPPY Y
Sbjct: 46  PPYVYSSPPPPSLSPPPPYKYKDPHYEYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY 105

Query: 180 NSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            SPPPP  SP P  YYKSPPPP   SP P   YKSPPPPS SP P   Y
Sbjct: 106 KSPPPPSPSPPPPYYYKSPPPPR-PSPPPPYYYKSPPPPSPSPPPPYYY 153

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 53/102 (51%), Positives = 54/102 (52%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           Y  SPPPP     P   Y SPP P +    PPPP         YK   P Y Y SPPPP 
Sbjct: 38  YTHSPPPP-----PPYVYSSPPPPSLS---PPPP---------YKYKDPHYEYKSPPPPS 80

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 81  PSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 121

[18][TOP]
>UniRef100_Q41707 Extensin class 1 protein n=1 Tax=Vigna unguiculata
           RepID=Q41707_VIGUN
          Length = 489

 Score =  132 bits (332), Expect = 1e-29
 Identities = 66/105 (62%), Positives = 66/105 (62%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPYVY SPP
Sbjct: 106 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYVYKSPP 162

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 163 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 206

 Score =  132 bits (332), Expect = 1e-29
 Identities = 66/105 (62%), Positives = 66/105 (62%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPYVY SPP
Sbjct: 170 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYVYKSPP 226

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 227 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 270

 Score =  132 bits (332), Expect = 1e-29
 Identities = 66/105 (62%), Positives = 66/105 (62%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPYVY SPP
Sbjct: 298 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYVYKSPP 354

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 355 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 398

 Score =  131 bits (330), Expect = 2e-29
 Identities = 65/101 (64%), Positives = 65/101 (64%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPYVY SPP
Sbjct: 378 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYVYKSPP 434

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P
Sbjct: 435 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPP 474

 Score =  130 bits (327), Expect = 5e-29
 Identities = 65/105 (61%), Positives = 65/105 (61%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 234 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 290

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 291 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 334

 Score =  130 bits (327), Expect = 5e-29
 Identities = 65/105 (61%), Positives = 65/105 (61%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 266 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 322

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 323 PPSPSPPPPYYYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYYY 366

 Score =  129 bits (325), Expect = 8e-29
 Identities = 68/118 (57%), Positives = 68/118 (57%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P  YYKSPPPP  SP P  YYKSPP P     PP      PPP  SP P   YKSPPPP 
Sbjct: 122 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPS 181

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                 Y Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 182 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYYY 238

 Score =  129 bits (325), Expect = 8e-29
 Identities = 68/118 (57%), Positives = 68/118 (57%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P  YYKSPPPP  SP P  YYKSPP P     PP      PPP  SP P   YKSPPPP 
Sbjct: 186 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPS 245

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                 Y Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 246 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 302

 Score =  129 bits (325), Expect = 8e-29
 Identities = 68/118 (57%), Positives = 68/118 (57%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYK------ 155
           P  YYKSPPPP  SP P  YYKSPP P     PP      PPP  SP P   YK      
Sbjct: 314 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPS 373

Query: 156 -SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            SPPPPY Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 374 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYVY 430

 Score =  127 bits (319), Expect = 4e-28
 Identities = 64/105 (60%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P   YKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 74  PPYYYKSPPPPSPSPPPPYVYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 130

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 131 PPSPSPPPPYYYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYYY 174

 Score =  127 bits (319), Expect = 4e-28
 Identities = 64/105 (60%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 218 PPYVYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 274

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 275 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 318

 Score =  127 bits (319), Expect = 4e-28
 Identities = 64/105 (60%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 346 PPYVYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 402

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 403 PPSPSPPPPYYYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYYY 446

 Score =  127 bits (319), Expect = 4e-28
 Identities = 64/105 (60%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 362 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 418

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 419 PPSPSPPPPYVYKSPPPPSP-SPPPPYYYKSPPPPSPSPPPPYYY 462

 Score =  123 bits (309), Expect = 6e-27
 Identities = 66/118 (55%), Positives = 66/118 (55%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYK------ 155
           P  YYKSPPPP  SP P   YKSPP P     PP      PPP  SP P   YK      
Sbjct: 138 PPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 197

Query: 156 -SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            SPPPPY Y SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 198 PSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 254

 Score =  117 bits (294), Expect = 3e-25
 Identities = 61/108 (56%), Positives = 62/108 (57%), Gaps = 7/108 (6%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYK-------SPPPPYVYN 182
           Y    PPYY  +P  YYKSPP P     PPPPP     P   YK       SPPPPYVY 
Sbjct: 38  YPKQTPPYYYNAPPYYYKSPPPPSPS--PPPPPYVHKYPPYYYKSPPPPSPSPPPPYVYK 95

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 96  SPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 142

 Score =  117 bits (292), Expect = 5e-25
 Identities = 59/99 (59%), Positives = 60/99 (60%), Gaps = 2/99 (2%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P     PPPP  Y  SP     SPPPPY Y SPP
Sbjct: 394 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS--PPPPYVYK-SPPPPSPSPPPPYYYKSPP 450

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVE--YKSPPPPSY 302
           PP  SP P  YYKSPPPPS   P P     Y SPPPP+Y
Sbjct: 451 PPSPSPPPPYYYKSPPPPSPSPPPPYYPYLYNSPPPPAY 489

 Score =  113 bits (282), Expect = 7e-24
 Identities = 61/115 (53%), Positives = 63/115 (54%), Gaps = 13/115 (11%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCP------PPPPCYSPSPKVVYK-------SP 161
           YY + PP YY   P      PP P+V   P      PPPP  SP P  VYK       SP
Sbjct: 45  YYYNAPPYYYKSPPPPSPSPPPPPYVHKYPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSP 104

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPPY Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 105 PPPYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYVY 158

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 38/82 (46%), Positives = 39/82 (47%), Gaps = 15/82 (18%)
 Frame = +3

Query: 126 YSPSPKVVYKSPPPPYVYNS---------------PPPPYYSPSPKVYYKSPPPPSYYSP 260
           Y   P   Y    PPY YN+               PPPPY    P  YYKSPPPPS  SP
Sbjct: 30  YYGQPWNNYPKQTPPYYYNAPPYYYKSPPPPSPSPPPPPYVHKYPPYYYKSPPPPS-PSP 88

Query: 261 SPKVEYKSPPPPSYSPSPKTEY 326
            P   YKSPPPPS SP P   Y
Sbjct: 89  PPPYVYKSPPPPSPSPPPPYYY 110

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 40/81 (49%), Positives = 41/81 (50%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPPY       YYKS          PPPP  SP P   YKSPPPP    SP
Sbjct: 432 SPPPPSPSPPPPY-------YYKS----------PPPPSPSPPPPYYYKSPPPP--SPSP 472

Query: 189 PPPYYSPSPKVYYKSPPPPSY 251
           PPPYY       Y SPPPP+Y
Sbjct: 473 PPPYY----PYLYNSPPPPAY 489

[19][TOP]
>UniRef100_Q7DLZ6 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q7DLZ6_VIGUN
          Length = 164

 Score =  131 bits (330), Expect = 2e-29
 Identities = 65/101 (64%), Positives = 65/101 (64%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPYVY SPP
Sbjct: 53  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYVYKSPP 109

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P
Sbjct: 110 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPP 149

 Score =  127 bits (319), Expect = 4e-28
 Identities = 64/105 (60%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P   YKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 5   PPYYYKSPPPPSPSPPPPYVYKSPPPPSP---SPPPPYYYKSPPPPSPSPPPPYYYKSPP 61

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 62  PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYVY 105

 Score =  127 bits (319), Expect = 4e-28
 Identities = 64/105 (60%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 21  PPYVYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 77

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 78  PPSPSPPPPYYYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYYY 121

 Score =  127 bits (319), Expect = 4e-28
 Identities = 64/105 (60%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 37  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 93

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 94  PPSPSPPPPYVYKSPPPPSP-SPPPPYYYKSPPPPSPSPPPPYYY 137

 Score =  117 bits (292), Expect = 5e-25
 Identities = 59/99 (59%), Positives = 60/99 (60%), Gaps = 2/99 (2%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P     PPPP  Y  SP     SPPPPY Y SPP
Sbjct: 69  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS--PPPPYVYK-SPPPPSPSPPPPYYYKSPP 125

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVE--YKSPPPPSY 302
           PP  SP P  YYKSPPPPS   P P     Y SPPPP+Y
Sbjct: 126 PPSPSPPPPYYYKSPPPPSPSPPPPYYPYLYNSPPPPAY 164

 Score =  112 bits (280), Expect = 1e-23
 Identities = 59/99 (59%), Positives = 60/99 (60%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPPYY  SP     SPP P+V   PPPP     SP     SPPPPY Y SPPPP  SP
Sbjct: 2   SPPPPYYYKSPPPPSPSPPPPYVYKSPPPP-----SP-----SPPPPYYYKSPPPPSPSP 51

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 52  PPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 89

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 40/81 (49%), Positives = 41/81 (50%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPPY       YYKS          PPPP  SP P   YKSPPPP    SP
Sbjct: 107 SPPPPSPSPPPPY-------YYKS----------PPPPSPSPPPPYYYKSPPPP--SPSP 147

Query: 189 PPPYYSPSPKVYYKSPPPPSY 251
           PPPYY       Y SPPPP+Y
Sbjct: 148 PPPYY----PYLYNSPPPPAY 164

[20][TOP]
>UniRef100_Q01943 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01943_SOLLC
          Length = 181

 Score =  130 bits (327), Expect = 5e-29
 Identities = 65/105 (61%), Positives = 65/105 (61%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 5   PPYYYKSPPPPSPSPPPPYYYKSPPPPSP---SPPPPYYYKSPPPPSPSPPPPYYYKSPP 61

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 62  PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 105

 Score =  130 bits (327), Expect = 5e-29
 Identities = 68/118 (57%), Positives = 69/118 (58%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYK------ 155
           P  YYKSPPPP  SP P  YYKSPP P     PP      PPP  SP P   YK      
Sbjct: 37  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 96

Query: 156 -SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            SPPPPY Y+SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 97  PSPPPPYYYSSPPPPKKSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 153

 Score =  129 bits (325), Expect = 8e-29
 Identities = 65/105 (61%), Positives = 65/105 (61%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP    KSPPPPY Y SPP
Sbjct: 69  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYSSPPPPKKSPPPPYYYKSPP 125

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKS PPPS SP P   Y
Sbjct: 126 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSSPPPSPSPPPPYYY 169

 Score =  127 bits (319), Expect = 4e-28
 Identities = 63/105 (60%), Positives = 63/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 21  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 77

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   Y SPPPP  SP P   Y
Sbjct: 78  PPSPSPPPPYYYKSPPPPS-PSPPPPYYYSSPPPPKKSPPPPYYY 121

 Score =  115 bits (287), Expect = 2e-24
 Identities = 60/100 (60%), Positives = 60/100 (60%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           KSPPPPYY       YKSPP P      PPPP Y  SP     SPPPPY Y SPPPP  S
Sbjct: 1   KSPPPPYY-------YKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 50

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           P P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 51  PPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 89

 Score =  111 bits (277), Expect = 3e-23
 Identities = 61/108 (56%), Positives = 62/108 (57%), Gaps = 7/108 (6%)
 Frame = +3

Query: 12  PKVYYKSPPPP-------YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           P  YYKSPPPP       YY  SP    KSPP P+    PPPP   SP       SPPPP
Sbjct: 85  PPYYYKSPPPPSPSPPPPYYYSSPPPPKKSPPPPYYYKSPPPP---SP-------SPPPP 134

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           Y Y SPPPP  SP P  YYKS PPPS  SP P   YKSPPPPS SP P
Sbjct: 135 YYYKSPPPPSPSPPPPYYYKSSPPPS-PSPPPPYYYKSPPPPSPSPPP 181

[21][TOP]
>UniRef100_Q09085 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q09085_PHAVU
          Length = 368

 Score =  129 bits (324), Expect = 1e-28
 Identities = 64/101 (63%), Positives = 64/101 (63%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 156 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPDPSPPPPYYYKSPP 212

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P
Sbjct: 213 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPP 252

 Score =  129 bits (323), Expect = 1e-28
 Identities = 70/120 (58%), Positives = 70/120 (58%), Gaps = 14/120 (11%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPH-------VCVCPPPPPCYSPSPKVVYKSPPP 167
           SP  YYKSPPPP  SPSP  YYKSPP PH            PPPP  SP P   YKSPPP
Sbjct: 123 SPPYYYKSPPPPSPSPSP-YYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYYYKSPPP 181

Query: 168 P-------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           P       Y Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 182 PSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 240

 Score =  124 bits (312), Expect = 2e-27
 Identities = 67/124 (54%), Positives = 68/124 (54%), Gaps = 19/124 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP------------PPPPCYSPSPKVVYK 155
           P  YYKSPPPP  SP P  YYKSPP P     P            PPPP  SP P   YK
Sbjct: 220 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYK 279

Query: 156 SPPPP-------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           SPPPP       Y Y SPPPP  SP P  YYKSPPPPS   P+P   YKSPPPPS SP P
Sbjct: 280 SPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPDPPTP-YYYKSPPPPSPSPPP 338

Query: 315 KTEY 326
              Y
Sbjct: 339 PYYY 342

 Score =  124 bits (311), Expect = 3e-27
 Identities = 67/111 (60%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY------SPSPKVVYKSPPPPY 173
           P  YYKSPPPP  SP P  YYKSPP P     PPPP  Y      SPSP     SPPPPY
Sbjct: 204 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS--PPPPYYYKSPPPPSPSPP-PSPSPPPPY 260

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 261 YYKSPPPPDPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 310

 Score =  122 bits (305), Expect = 2e-26
 Identities = 60/111 (54%), Positives = 63/111 (56%), Gaps = 13/111 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P  YYKSPPPP  SP P  YYKSPP P     PP      PPP  SP P   YKSPPPP 
Sbjct: 258 PPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 317

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
                 Y Y SPPPP  SP P  YY SPPPP+   P P   Y SPPPP+Y+
Sbjct: 318 PDPPTPYYYKSPPPPSPSPPPPYYYVSPPPPTKSPPPPAYSYASPPPPTYN 368

 Score =  120 bits (302), Expect = 4e-26
 Identities = 67/126 (53%), Positives = 67/126 (53%), Gaps = 21/126 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPPY 173
           P  YYKSPPPP  SP P  YYKSPP P     PP      PPP  SP P   YKSPPPP 
Sbjct: 172 PPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 231

Query: 174 VYNSPPPPYY---------------SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
              SPPPPYY               SP P  YYKSPPPP   SP P   YKSPPPPS SP
Sbjct: 232 P--SPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPD-PSPPPPYYYKSPPPPSPSP 288

Query: 309 SPKTEY 326
            P   Y
Sbjct: 289 PPPYYY 294

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 55/108 (50%), Positives = 58/108 (53%), Gaps = 7/108 (6%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP------PYVYNS 185
           +K  P PY+ P    YY SPP          PP Y  SP   YKSPPP      PY Y S
Sbjct: 99  HKHSPTPYHKP---YYYNSPP----------PPYYYKSPPYYYKSPPPPSPSPSPYYYKS 145

Query: 186 PPPPYYSP-SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPPP+  P  P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 146 PPPPHKDPYYPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 192

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 50/119 (42%), Positives = 55/119 (46%), Gaps = 15/119 (12%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP 194
           +V  K+ P  Y   +PK  Y    H H             SP   +K    PY YNSPPP
Sbjct: 78  EVVLKAKPFAY---APKKPYDCEKHKH-------------SPTPYHK----PYYYNSPPP 117

Query: 195 PYYSPSPKVYYKSPPPPS-------YYSPSPKVE--------YKSPPPPSYSPSPKTEY 326
           PYY  SP  YYKSPPPPS       Y SP P  +        YKSPPPPS SP P   Y
Sbjct: 118 PYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYYY 176

[22][TOP]
>UniRef100_Q09082 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q09082_SOLLC
          Length = 388

 Score =  129 bits (324), Expect = 1e-28
 Identities = 70/117 (59%), Positives = 71/117 (60%), Gaps = 11/117 (9%)
 Frame = +3

Query: 9   SPKVYYKSPPPP-----YYSP---SPKVYYKSPPHP---HVCVCPPPPPCYSPSPKVVYK 155
           SPK  YKSPPPP     Y SP   SPK  YKSPP P   +V   PPPPP Y  SP     
Sbjct: 199 SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPPPPSP 258

Query: 156 SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           SPPPPY Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 259 SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 314

 Score =  125 bits (314), Expect = 1e-27
 Identities = 69/121 (57%), Positives = 69/121 (57%), Gaps = 15/121 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPP-----YYSP---SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP 164
           SPK  YKSPPPP     Y SP   SPK  YKSPP P      PPPP  SP P   YKSPP
Sbjct: 211 SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPPPPSPSPPPPYYYKSPP 270

Query: 165 PP-------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           PP       Y Y SPPPP  SP P  YYKSPPPPS  SP P   YK PPPPS SP P   
Sbjct: 271 PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYKCPPPPSPSPPPPYY 329

Query: 324 Y 326
           Y
Sbjct: 330 Y 330

 Score =  124 bits (311), Expect = 3e-27
 Identities = 62/105 (59%), Positives = 62/105 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y  PP
Sbjct: 262 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKCPP 318

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   Y SPPPP  SP P   Y
Sbjct: 319 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYHSPPPPVNSPPPPYYY 362

 Score =  124 bits (310), Expect = 4e-27
 Identities = 77/137 (56%), Positives = 78/137 (56%), Gaps = 31/137 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPP-----YYSP---SPKVYYKSPPHP---HVCVCPPPP-PCY------SP 134
           SPK  YKSPPPP     Y SP   SPK  YKSPP P   +V   PPPP P Y       P
Sbjct: 163 SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 222

Query: 135 SPKVVYKSPPPP---YVYNSPPPPYY----------SPSPKVYYKSPPPPSYYSPSPKVE 275
           SPK VYKSPPPP   YVY SPPPP Y          SP P  YYKSPPPPS  SP P   
Sbjct: 223 SPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYY 281

Query: 276 YKSPPPPSYSPSPKTEY 326
           YKSPPPPS SP P   Y
Sbjct: 282 YKSPPPPSPSPPPPYYY 298

 Score =  118 bits (295), Expect = 2e-25
 Identities = 82/150 (54%), Positives = 83/150 (55%), Gaps = 44/150 (29%)
 Frame = +3

Query: 9   SPKVYYKSPPPP-----YYS---PSPKVYYKSPPHP---HVCVCPPPP-PCY------SP 134
           SPK  YKSPPPP     Y S   PSPK  YKSPP P   +V   PPPP P Y       P
Sbjct: 19  SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 78

Query: 135 SPKVVYKSPPPP---YVYNSPPPP-----YYS---PSPKVYYKSPPPPS----YYS---P 260
           SPK VYKSPPPP   YVY SPPPP     Y S   PSPK  YKSPPPPS    Y S   P
Sbjct: 79  SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 138

Query: 261 SPKVEYKSPPPPSYS--------PSPKTEY 326
           SPK  YKSPPPPS          PSPK  Y
Sbjct: 139 SPKYVYKSPPPPSPKYVYKSPPPPSPKYVY 168

 Score =  118 bits (295), Expect = 2e-25
 Identities = 82/150 (54%), Positives = 83/150 (55%), Gaps = 44/150 (29%)
 Frame = +3

Query: 9   SPKVYYKSPPPP-----YYSP---SPKVYYKSPPHP---HVCVCPPPP-PCY------SP 134
           SPK  YKSPPPP     Y SP   SPK  YKSPP P   +V   PPPP P Y       P
Sbjct: 79  SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 138

Query: 135 SPKVVYKSPPPP---YVYNSPPPP-----YYS---PSPKVYYKSPPPPS----YYS---P 260
           SPK VYKSPPPP   YVY SPPPP     Y S   PSPK  YKSPPPPS    Y S   P
Sbjct: 139 SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 198

Query: 261 SPKVEYKSPPPPSYS--------PSPKTEY 326
           SPK  YKSPPPPS          PSPK  Y
Sbjct: 199 SPKYVYKSPPPPSPKYVYKSPPPPSPKYVY 228

 Score =  117 bits (294), Expect = 3e-25
 Identities = 59/108 (54%), Positives = 60/108 (55%), Gaps = 13/108 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P  YYKSPPPP  SP P  YYKSPP P     PP      PPP  SP P   YKSPPPP 
Sbjct: 278 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKCPPPPSPSPPPPYYYKSPPPPS 337

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
                 Y Y+SPPPP  SP P  YY SPPPP    P P   Y SPPPP
Sbjct: 338 PSPPPPYYYHSPPPPVNSPPPPYYYSSPPPPVKSPPPPVYIYGSPPPP 385

 Score =  116 bits (291), Expect = 7e-25
 Identities = 63/106 (59%), Positives = 63/106 (59%), Gaps = 1/106 (0%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV-YNSP 188
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY    SP
Sbjct: 246 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYY-KSP 301

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPP  SP P  YYK PPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 302 PPPSPSPPPPYYYKCPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 346

 Score =  115 bits (287), Expect = 2e-24
 Identities = 77/138 (55%), Positives = 78/138 (56%), Gaps = 36/138 (26%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHP---HVCVCPPPP-PCY------SPSPKVVYKSPPPP 170
           YYKSPPPP    SPK  YKSPP P   +V   PPPP P Y       PSPK VYKSPPPP
Sbjct: 11  YYKSPPPP----SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 66

Query: 171 ---YVYNSPPPP-----YYS---PSPKVYYKSPPPPS----YYS---PSPKVEYKSPPPP 296
              YVY SPPPP     Y S   PSPK  YKSPPPPS    Y S   PSPK  YKSPPPP
Sbjct: 67  SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 126

Query: 297 SYS--------PSPKTEY 326
           S          PSPK  Y
Sbjct: 127 SPKYVYKSPPPPSPKYVY 144

 Score =  102 bits (253), Expect = 2e-20
 Identities = 49/82 (59%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYK PPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 310 PPYYYKCPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYHSPPPPVNSPPPPYYYSSPP 366

Query: 192 PPYYSPSPKVY-YKSPPPPSYY 254
           PP  SP P VY Y SPPPP +Y
Sbjct: 367 PPVKSPPPPVYIYGSPPPPVHY 388

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 69/131 (52%), Positives = 72/131 (54%), Gaps = 36/131 (27%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHP---HVCVCPPPP-PCY------SPSPKVVYKSPPPP---YVYN 182
           P  +P+P  Y KSPP P   +V   PPPP P Y       PSPK VYKSPPPP   YVY 
Sbjct: 3   PKPTPTPYYY-KSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYK 61

Query: 183 SPPPP-----YYS---PSPKVYYKSPPPPS----YYS---PSPKVEYKSPPPPSYS---- 305
           SPPPP     Y S   PSPK  YKSPPPPS    Y S   PSPK  YKSPPPPS      
Sbjct: 62  SPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYK 121

Query: 306 ----PSPKTEY 326
               PSPK  Y
Sbjct: 122 SPPPPSPKYVY 132

[23][TOP]
>UniRef100_O65760 Extensin (Fragment) n=1 Tax=Cicer arietinum RepID=O65760_CICAR
          Length = 192

 Score =  129 bits (324), Expect = 1e-28
 Identities = 64/105 (60%), Positives = 65/105 (61%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 2   PPYYYHSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYHSPP 58

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 59  PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYHY 102

 Score =  129 bits (323), Expect = 1e-28
 Identities = 64/105 (60%), Positives = 67/105 (63%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 18  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYHSPPPPSPSPPPPYYYKSPP 74

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   Y+SPPPP  SP+P+T Y
Sbjct: 75  PPSPSPPPPYYYKSPPPPS-PSPPPPYHYQSPPPP--SPTPRTPY 116

 Score =  119 bits (298), Expect = 1e-25
 Identities = 59/105 (56%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 50  PPYYYHSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYHYQSPP 106

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  +P    YYKSPPPP+  SP P   Y SPPPP  SP P   Y
Sbjct: 107 PPSPTPRTPYYYKSPPPPT-SSPPPPYHYVSPPPPIKSPPPPYHY 150

 Score =  118 bits (295), Expect = 2e-25
 Identities = 62/114 (54%), Positives = 66/114 (57%), Gaps = 13/114 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP----PPPCYSPSPKVVY--------- 152
           P  YYKSPPPP  SP P  YYKSPP P     PP     PP  SP+P+  Y         
Sbjct: 66  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYQSPPPPSPTPRTPYYYKSPPPPT 125

Query: 153 KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SPPPPY Y SPPPP  SP P  +Y SPPPPS  SP+P   YKSPPPP  SP P
Sbjct: 126 SSPPPPYHYVSPPPPIKSPPPPYHYTSPPPPS-PSPAPTYIYKSPPPPVKSPPP 178

 Score =  112 bits (279), Expect = 2e-23
 Identities = 53/97 (54%), Positives = 58/97 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y+SPPPP  +P    YYKSPP P      PPPP +  SP    KSPPPPY Y SPP
Sbjct: 98  PPYHYQSPPPPSPTPRTPYYYKSPPPP---TSSPPPPYHYVSPPPPIKSPPPPYHYTSPP 154

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PP  SP+P   YKSPPPP    P P   Y SPPPP Y
Sbjct: 155 PPSPSPAPTYIYKSPPPPVKSPPPPVYIYASPPPPIY 191

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/71 (61%), Positives = 44/71 (61%)
 Frame = +3

Query: 114 PPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
           PPP Y  SP     SPPPPY Y SPPPP  SP P  YYKSPPPPS  SP P   Y SPPP
Sbjct: 1   PPPYYYHSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYHSPPP 59

Query: 294 PSYSPSPKTEY 326
           PS SP P   Y
Sbjct: 60  PSPSPPPPYYY 70

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 37/81 (45%), Positives = 40/81 (49%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP    KSPPPPY+  S                 PPPP  SP+P  +YKSPPPP    SP
Sbjct: 136 SPPPPIKSPPPPYHYTS-----------------PPPPSPSPAPTYIYKSPPPP--VKSP 176

Query: 189 PPPYYSPSPKVYYKSPPPPSY 251
           PPP Y       Y SPPPP Y
Sbjct: 177 PPPVY------IYASPPPPIY 191

[24][TOP]
>UniRef100_B9GU80 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9GU80_POPTR
          Length = 153

 Score =  129 bits (323), Expect = 1e-28
 Identities = 64/105 (60%), Positives = 65/105 (61%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +YKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 27  PPYHYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 83

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 84  PPSPSPPPPYYYKSPPPPS-SSPPPPYVYKSPPPPSPSPPPPYYY 127

 Score =  125 bits (313), Expect = 2e-27
 Identities = 65/114 (57%), Positives = 65/114 (57%), Gaps = 9/114 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 43  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 99

Query: 192 PPYYSPSPKVYYKSPPPPS------YYSPSPKVEYKSPPPPSY---SPSPKTEY 326
           PP  SP P   YKSPPPPS      YY  SP    KSPPPP Y   SP P T Y
Sbjct: 100 PPSSSPPPPYVYKSPPPPSPSPPPPYYYHSPPPPVKSPPPPVYIYASPPPPTHY 153

 Score =  120 bits (300), Expect = 6e-26
 Identities = 64/115 (55%), Positives = 65/115 (56%), Gaps = 9/115 (7%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY---------SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SP     SPPPPYY         SP P  +YKSPP P      PPPP Y  SP     SP
Sbjct: 1   SPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYKSPPPPSP---SPPPPYYYKSPPPPSPSP 57

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPPY Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 58  PPPYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSSSPPPPYVY 111

[25][TOP]
>UniRef100_Q41120 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q41120_PHAVU
          Length = 154

 Score =  128 bits (321), Expect = 2e-28
 Identities = 62/105 (59%), Positives = 65/105 (61%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 19  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYHSPP 75

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  +P P  YYKSPPPP+ Y P P   Y SPPPPS SP P   Y
Sbjct: 76  PPSPTPHPPYYYKSPPPPTSY-PPPPYHYVSPPPPSPSPPPPYYY 119

 Score =  124 bits (312), Expect = 2e-27
 Identities = 66/117 (56%), Positives = 70/117 (59%), Gaps = 16/117 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P  YYKSPPPP  SP P  YYKSPP P     PP      PPP  +P P   YKSPPPP 
Sbjct: 35  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPTPHPPYYYKSPPPPT 94

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY---SPSP 314
                 Y Y SPPPP  SP P  YYKSPPPPS  +P+PK  YKSPPPP+Y   SP P
Sbjct: 95  SYPPPPYHYVSPPPPSPSPPPPYYYKSPPPPS-PAPAPKYIYKSPPPPAYIYSSPPP 150

 Score =  111 bits (277), Expect = 3e-23
 Identities = 58/105 (55%), Positives = 59/105 (56%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP        PP P           SPPPPY Y SPP
Sbjct: 3   PPYYYKSPPPPSPSPPPPYYYKSPP--------PPSP-----------SPPPPYYYKSPP 43

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   Y SPPPPS +P P   Y
Sbjct: 44  PPSPSPPPPYYYKSPPPPS-PSPPPPYYYHSPPPPSPTPHPPYYY 87

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/97 (54%), Positives = 58/97 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  +P P  YYKSPP P      PPPP +  SP     SPPPPY Y SPP
Sbjct: 67  PPYYYHSPPPPSPTPHPPYYYKSPPPP---TSYPPPPYHYVSPPPPSPSPPPPYYYKSPP 123

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PP  +P+PK  YKSPPPP+Y        Y SPPPP Y
Sbjct: 124 PPSPAPAPKYIYKSPPPPAYI-------YSSPPPPIY 153

[26][TOP]
>UniRef100_B9IAD8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAD8_POPTR
          Length = 379

 Score =  127 bits (318), Expect = 5e-28
 Identities = 67/118 (56%), Positives = 68/118 (57%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  SP P   YKSPP P     PP      PPP  SP P  VYKSPPPP 
Sbjct: 93  PPYIYKSPPPPSPSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPS 152

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                 Y+Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 153 PSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYVYKSPPPPSSSPPPPYYY 209

 Score =  125 bits (315), Expect = 1e-27
 Identities = 62/105 (59%), Positives = 65/105 (61%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +YKSPPPP  SP P  YY+SPP P      PPPP +  SP     SPPPPY Y SPP
Sbjct: 253 PPYHYKSPPPPSPSPPPPYYYRSPPPPS---SSPPPPYHYSSPPPPSPSPPPPYYYKSPP 309

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 310 PPSPSPPPPYYYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYYY 353

 Score =  124 bits (310), Expect = 4e-27
 Identities = 61/105 (58%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P  YYKSP  P      PPPP Y  SP  +  SPPPPY Y SPP
Sbjct: 189 PPYVYKSPPPPSSSPPPPYYYKSPSPPS---SSPPPPYYYKSPPPLSPSPPPPYYYKSPP 245

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +YKSPPPPS  SP P   Y+SPPPPS SP P   Y
Sbjct: 246 PPDPSPPPPYHYKSPPPPS-PSPPPPYYYRSPPPPSSSPPPPYHY 289

 Score =  123 bits (309), Expect = 6e-27
 Identities = 64/105 (60%), Positives = 66/105 (62%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  +YKSPP P     PPPP  Y  SP     SPPPPY Y+SPP
Sbjct: 237 PPYYYKSPPPPDPSPPPPYHYKSPPPPSPS--PPPPYYYR-SPPPPSSSPPPPYHYSSPP 293

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 294 PPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYVY 337

 Score =  121 bits (303), Expect = 3e-26
 Identities = 62/106 (58%), Positives = 64/106 (60%), Gaps = 1/106 (0%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPSPKVVYKSPPPPYVYNSP 188
           P  YYKSP PP  SP P  YYKSPP     + P PPPP Y  SP     SPPPPY Y SP
Sbjct: 205 PPYYYKSPSPPSSSPPPPYYYKSPPP----LSPSPPPPYYYKSPPPPDPSPPPPYHYKSP 260

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPP  SP P  YY+SPPPPS  SP P   Y SPPPPS SP P   Y
Sbjct: 261 PPPSPSPPPPYYYRSPPPPS-SSPPPPYHYSSPPPPSPSPPPPYYY 305

 Score =  121 bits (303), Expect = 3e-26
 Identities = 61/105 (58%), Positives = 63/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPP   SP P  YYKSPP P      PPPP +  SP     SPPPPY Y SPP
Sbjct: 221 PPYYYKSPPPLSPSPPPPYYYKSPPPPDPS---PPPPYHYKSPPPPSPSPPPPYYYRSPP 277

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 278 PPSSSPPPPYHYSSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 321

 Score =  120 bits (302), Expect = 4e-26
 Identities = 64/120 (53%), Positives = 64/120 (53%), Gaps = 15/120 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P   YKSPP P      PPPP Y  SP     SPPPPYVY SPP
Sbjct: 141 PPYVYKSPPPPSPSPPPPYIYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYVYKSPP 197

Query: 192 PPYYSPSPKVYYKSP------PPPSYY---------SPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YYKSP      PPP YY         SP P   YKSPPPP  SP P   Y
Sbjct: 198 PPSSSPPPPYYYKSPSPPSSSPPPPYYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHY 257

 Score =  120 bits (301), Expect = 5e-26
 Identities = 65/118 (55%), Positives = 66/118 (55%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP------PPPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  SP P   YKSPP P     P      PPPP  SP P  +YKSPPPP 
Sbjct: 45  PPYVYKSPPPPSPSPPPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYIYKSPPPPS 104

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                 Y Y SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 105 PSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYIY 161

 Score =  118 bits (295), Expect = 2e-25
 Identities = 65/120 (54%), Positives = 65/120 (54%), Gaps = 15/120 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY--------SPSPKVVYK---- 155
           P   YKSPPPP  SP P  YYKSPP P     PPPP  Y        SP P   YK    
Sbjct: 157 PPYIYKSPPPPSPSPPPPYYYKSPPPPSPS--PPPPYVYKSPPPPSSSPPPPYYYKSPSP 214

Query: 156 ---SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
              SPPPPY Y SPPP   SP P  YYKSPPPP   SP P   YKSPPPPS SP P   Y
Sbjct: 215 PSSSPPPPYYYKSPPPLSPSPPPPYYYKSPPPPD-PSPPPPYHYKSPPPPSPSPPPPYYY 273

 Score =  115 bits (287), Expect = 2e-24
 Identities = 64/120 (53%), Positives = 66/120 (55%), Gaps = 15/120 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY------SPSPKVVYK------ 155
           P   YKSPPPP   P P   YKSPP P     PPPP  Y      SPSP   Y+      
Sbjct: 61  PPYEYKSPPPPSPHPPPTYVYKSPPPPSPS--PPPPYIYKSPPPPSPSPPPPYEYKSPPP 118

Query: 156 ---SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
              SPPPPY+Y SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 119 PSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPS-PSPPPPYIYKSPPPPSPSPPPPYYY 177

 Score =  114 bits (284), Expect = 4e-24
 Identities = 60/108 (55%), Positives = 63/108 (58%), Gaps = 7/108 (6%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYK-------SPPPPYVYN 182
           Y SPPPPY   SP     SPP P+    PPPP  + P P  VYK       SPPPPY+Y 
Sbjct: 40  YSSPPPPYVYKSPPPPSPSPPPPYEYKSPPPPSPH-PPPTYVYKSPPPPSPSPPPPYIYK 98

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 99  SPPPPSPSPPPPYEYKSPPPPS-SSPPPPYIYKSPPPPSPSPPPPYVY 145

 Score =  109 bits (272), Expect = 1e-22
 Identities = 53/95 (55%), Positives = 54/95 (56%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPYVY SPP
Sbjct: 285 PPYHYSSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYVYKSPP 341

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
           PP  SP P  YY SPPP     P     Y SPPPP
Sbjct: 342 PPSPSPPPPYYYHSPPPAMKSPPLSVYIYASPPPP 376

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/60 (66%), Positives = 41/60 (68%)
 Frame = +3

Query: 147 VYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           VY SPPPPYVY SPPPP  SP P   YKSPPPPS + P P   YKSPPPPS SP P   Y
Sbjct: 39  VYSSPPPPYVYKSPPPPSPSPPPPYEYKSPPPPSPH-PPPTYVYKSPPPPSPSPPPPYIY 97

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/89 (44%), Positives = 42/89 (47%), Gaps = 8/89 (8%)
 Frame = +3

Query: 12  PKVYYKSPPPP-------YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           P  YYKSPPPP       Y        YKSPP       PP P            SPPPP
Sbjct: 317 PPYYYKSPPPPSPSPPPPY-------VYKSPP-------PPSP------------SPPPP 350

Query: 171 YVYNSPPPPYYSPSPKVY-YKSPPPPSYY 254
           Y Y+SPPP   SP   VY Y SPPPP +Y
Sbjct: 351 YYYHSPPPAMKSPPLSVYIYASPPPPIHY 379

[27][TOP]
>UniRef100_Q9M564 CRANTZ hydroxyproline-rich glycoprotein n=1 Tax=Manihot esculenta
           RepID=Q9M564_MANES
          Length = 232

 Score =  125 bits (315), Expect = 1e-27
 Identities = 62/105 (59%), Positives = 63/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 16  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYHSPPPPVKSPPPPYYYHSPP 72

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 73  PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 116

 Score =  125 bits (313), Expect = 2e-27
 Identities = 62/105 (59%), Positives = 63/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 32  PPYYYKSPPPPSPSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 88

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 89  PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 132

 Score =  123 bits (309), Expect = 6e-27
 Identities = 61/105 (58%), Positives = 62/105 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 48  PPYYYHSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 104

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 105 PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 148

 Score =  123 bits (309), Expect = 6e-27
 Identities = 61/105 (58%), Positives = 62/105 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 64  PPYYYHSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 120

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 121 PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 164

 Score =  123 bits (309), Expect = 6e-27
 Identities = 61/105 (58%), Positives = 62/105 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 80  PPYYYHSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 136

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 137 PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 180

 Score =  123 bits (309), Expect = 6e-27
 Identities = 61/105 (58%), Positives = 62/105 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 96  PPYYYHSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 152

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 153 PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 196

 Score =  123 bits (309), Expect = 6e-27
 Identities = 61/105 (58%), Positives = 62/105 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 112 PPYYYHSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 168

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 169 PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 212

 Score =  122 bits (307), Expect = 9e-27
 Identities = 60/101 (59%), Positives = 61/101 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 128 PPYYYHSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 184

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P
Sbjct: 185 PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPP 224

 Score =  111 bits (278), Expect = 2e-23
 Identities = 55/97 (56%), Positives = 56/97 (57%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 144 PPYYYHSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 200

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PP  SP P  YY SPPPP           KSPPPP Y
Sbjct: 201 PPVKSPPPPYYYHSPPPP----------VKSPPPPVY 227

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/106 (50%), Positives = 55/106 (51%), Gaps = 7/106 (6%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYK-------SPPPPYVYNSP 188
           SPPPPYY       YKSPP          PP  SP P   YK       SPPPPY Y+SP
Sbjct: 13  SPPPPYY-------YKSPP----------PPSPSPPPPYYYKSPPPPSPSPPPPYYYHSP 55

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 56  PPPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 100

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 46/76 (60%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 160 PPYYYHSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 216

Query: 192 PPYYSPSPKVY-YKSP 236
           PP  SP P VY Y SP
Sbjct: 217 PPVKSPPPPVYIYASP 232

[28][TOP]
>UniRef100_Q43682 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43682_VIGUN
          Length = 280

 Score =  125 bits (315), Expect = 1e-27
 Identities = 67/113 (59%), Positives = 67/113 (59%), Gaps = 8/113 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  SP P   YKSPP P     PP      PPP  SP P  VYKSPPPP 
Sbjct: 72  PPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPP 131

Query: 171 -YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            YVY SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 132 PYVYKSPPPPSPSPPPPYVYKSPPPPSP-SPPPPYVYKSPPPPSPSPPPPYIY 183

 Score =  125 bits (313), Expect = 2e-27
 Identities = 67/113 (59%), Positives = 67/113 (59%), Gaps = 8/113 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPSPKVVYKSPPPP------ 170
           P   YKSPPPP  SP P   YKSPP P   V   PPPP  SP P  VYKSPPPP      
Sbjct: 104 PPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPP 163

Query: 171 -YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            YVY SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 164 PYVYKSPPPPSPSPPPPYIYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYVY 215

 Score =  124 bits (311), Expect = 3e-27
 Identities = 67/118 (56%), Positives = 67/118 (56%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  SP P   YKSPP P     PP      PPP  SP P  VYKSPPPP 
Sbjct: 147 PPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPS 206

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                 YVY SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 207 PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYVY 263

 Score =  124 bits (311), Expect = 3e-27
 Identities = 67/118 (56%), Positives = 67/118 (56%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  SP P   YKSPP P     PP      PPP  SP P  VYKSPPPP 
Sbjct: 163 PPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 222

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                 YVY SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 223 PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYVY 279

 Score =  124 bits (310), Expect = 4e-27
 Identities = 66/118 (55%), Positives = 67/118 (56%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  SP P   YKSPP P     PP      PPP  SP P  +YKSPPPP 
Sbjct: 131 PPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPS 190

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                 YVY SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 191 PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYVY 247

 Score =  120 bits (302), Expect = 4e-26
 Identities = 65/113 (57%), Positives = 66/113 (58%), Gaps = 8/113 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHP-------HVCVCPPPPPCYS-PSPKVVYKSPPP 167
           P   YKSPPPP  SP P   YKSPP P       +V   PPPPP Y   SP     SPPP
Sbjct: 88  PPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPP 147

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PYVY SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 148 PYVYKSPPPPSPSPPPPYVYKSPPPPS-PSPPPPYIYKSPPPPSPSPPPPYVY 199

 Score =  120 bits (301), Expect = 5e-26
 Identities = 67/120 (55%), Positives = 67/120 (55%), Gaps = 15/120 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY--------SPSPKVVYK---- 155
           P   YKSPPPP  SP P   YKSPP P     PPPP  Y        SP P  VYK    
Sbjct: 8   PPYVYKSPPPPSPSPPPPYVYKSPPPPSPS--PPPPYVYKSPPPPSPSPPPPYVYKSPPP 65

Query: 156 ---SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
              SPPPPYVY SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 66  PSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYVY 124

 Score =  119 bits (299), Expect = 8e-26
 Identities = 68/128 (53%), Positives = 68/128 (53%), Gaps = 23/128 (17%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  SP P   YKSPP P     PP      PPP  SP P  VYKSPPPP 
Sbjct: 24  PPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 83

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPS--------YYS--PSPKVEYKSPPPPSY 302
                 YVY SPPPP  SP P   YKSPPPPS        Y S  P P   YKSPPPPS 
Sbjct: 84  PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSP 143

Query: 303 SPSPKTEY 326
           SP P   Y
Sbjct: 144 SPPPPYVY 151

 Score =  118 bits (295), Expect = 2e-25
 Identities = 67/128 (52%), Positives = 67/128 (52%), Gaps = 23/128 (17%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  SP P   YKSPP P     PP      PPP  SP P  VYKSPPPP 
Sbjct: 40  PPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 99

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSP-PPPSYY---------SPSPKVEYKSPPPPSY 302
                 YVY SPPPP  SP P   YKSP PPP Y          SP P   YKSPPPPS 
Sbjct: 100 PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSP 159

Query: 303 SPSPKTEY 326
           SP P   Y
Sbjct: 160 SPPPPYVY 167

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/123 (52%), Positives = 66/123 (53%), Gaps = 17/123 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCP------PPPPCYSPSPKVVYK- 155
           SP     SPPPPY      P P   YKSPP P     P      PPPP  SP P  VYK 
Sbjct: 110 SPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKS 169

Query: 156 ------SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
                 SPPPPY+Y SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P 
Sbjct: 170 PPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPP 228

Query: 318 TEY 326
             Y
Sbjct: 229 YVY 231

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/99 (58%), Positives = 59/99 (59%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPPY   SP     SPP P+V   PPPP     SP     SPPPPYVY SPPPP  SP
Sbjct: 5   SPPPPYVYKSPPPPSPSPPPPYVYKSPPPP-----SP-----SPPPPYVYKSPPPPSPSP 54

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 55  PPPYVYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYVY 92

 Score =  107 bits (267), Expect = 4e-22
 Identities = 61/111 (54%), Positives = 61/111 (54%), Gaps = 15/111 (13%)
 Frame = +3

Query: 39  PPYYSPSPKVYYKSPPHPHVCVCPPPPPCY--------SPSPKVVYK-------SPPPPY 173
           PP  SP P   YKSPP P     PPPP  Y        SP P  VYK       SPPPPY
Sbjct: 1   PPSPSPPPPYVYKSPPPPSPS--PPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPY 58

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           VY SPPPP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 59  VYKSPPPPSPSPPPPYVYKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYVY 108

[29][TOP]
>UniRef100_Q7DMV8 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q7DMV8_PHAVU
          Length = 230

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 57  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 113

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 114 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 157

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 73  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 129

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 130 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 173

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 89  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 145

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 146 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 189

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 105 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 161

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 162 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 205

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 121 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 177

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 178 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 221

 Score =  124 bits (311), Expect = 3e-27
 Identities = 58/102 (56%), Positives = 64/102 (62%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           YY+SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPPPP 
Sbjct: 44  YYQSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPPPPK 100

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 101 HSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 141

 Score =  119 bits (299), Expect = 8e-26
 Identities = 56/98 (57%), Positives = 61/98 (62%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 137 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 193

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +S
Sbjct: 194 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHS 230

 Score =  111 bits (277), Expect = 3e-23
 Identities = 56/101 (55%), Positives = 61/101 (60%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y SPPPP   P P  YY+SPP P      PPPP Y  SP     SPPPPY Y+SPPPP +
Sbjct: 33  YSSPPPP---PKP-YYYQSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH 85

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 86  SPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 125

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 42/81 (51%), Positives = 46/81 (56%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPPYY      Y+  PP  H     PPPP Y  SP     SPPPPY Y+SP
Sbjct: 159 SPPPPKHSPPPPYY------YHSPPPPKH----SPPPPYYYHSPPPPKHSPPPPYYYHSP 208

Query: 189 PPPYYSPSPKVYYKSPPPPSY 251
           PPP +SP P  YY SPPPP +
Sbjct: 209 PPPKHSPPPPYYYHSPPPPKH 229

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 32/64 (50%), Positives = 36/64 (56%), Gaps = 12/64 (18%)
 Frame = +3

Query: 171 YVYNSPPP---PYY---------SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           Y+Y+SPPP   PYY         SP P  YY SPPPP  +SP P   Y SPPPP +SP P
Sbjct: 31  YIYSSPPPPPKPYYYQSPPPPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPP 89

Query: 315 KTEY 326
              Y
Sbjct: 90  PYYY 93

[30][TOP]
>UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN
          Length = 432

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 44  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 100

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 101 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 144

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 60  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 116

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 117 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 160

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 76  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 132

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 133 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 176

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 92  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 148

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 149 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 192

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 108 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 164

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 165 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 208

 Score =  121 bits (303), Expect = 3e-26
 Identities = 57/101 (56%), Positives = 62/101 (61%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPPPP +
Sbjct: 32  YSSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH 88

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 89  SPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 128

 Score =  121 bits (303), Expect = 3e-26
 Identities = 57/99 (57%), Positives = 61/99 (61%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 124 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 180

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           PP +SP P  YY SPPPP  +SP P   YKSPPPP   P
Sbjct: 181 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYKSPPPPPKKP 218

 Score =  121 bits (303), Expect = 3e-26
 Identities = 61/117 (52%), Positives = 65/117 (55%), Gaps = 16/117 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 140 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 196

Query: 192 PPYYSPSPKVYYKSPPPP---------------SYYSPSPKVEYKSPPPPSYS-PSP 314
           PP +SP P  YYKSPPPP                Y SP P  +Y SPPPP Y  PSP
Sbjct: 197 PPKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSP 253

 Score =  120 bits (300), Expect = 6e-26
 Identities = 70/128 (54%), Positives = 72/128 (56%), Gaps = 27/128 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPP------YYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK--------- 143
           P  YYKSPPPP      Y SP P VY YKSPP P+    PPPPP   PSP          
Sbjct: 204 PPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP 263

Query: 144 ----VVYKSPPPPYVYNSPPPP---YYSPSPKVY-YKSPPPP--SYYSPSPKVEYKSPPP 293
                 YKSPPPPY Y SPPPP   Y SP P VY YKSPPPP   Y SP P  +Y SPPP
Sbjct: 264 PPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPP 323

Query: 294 PSYS-PSP 314
           P Y  PSP
Sbjct: 324 PPYKYPSP 331

 Score =  114 bits (286), Expect = 3e-24
 Identities = 68/125 (54%), Positives = 70/125 (56%), Gaps = 24/125 (19%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYY---SPSPKVYYKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPPP 167
           P VY YKSPPPP Y   SP P   Y SPP P      PPPP Y     P P   YKSPPP
Sbjct: 294 PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 353

Query: 168 PYVYNSPPPP---YYSPSPKVY-YKSPPPP-----------SYYSPSPKV-EYKSPPPPS 299
           PY Y SPPPP   Y SP P VY YKSPPPP            Y SP P V +YKSPPPP 
Sbjct: 354 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 413

Query: 300 YSPSP 314
           +SP P
Sbjct: 414 HSPPP 418

 Score =  114 bits (285), Expect = 3e-24
 Identities = 65/130 (50%), Positives = 69/130 (53%), Gaps = 28/130 (21%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY---------SPSPKVYYKSPPHPHVCVCP------PPPPCYSPSPK 143
           SP     SPPPPYY         SP P  YY SPP P     P      PPPP +SP P 
Sbjct: 114 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 173

Query: 144 VVY-------KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP-----SYYSPSPKV-EYKS 284
             Y        SPPPPY Y+SPPPP +SP P  YYKSPPPP      Y SP P V +YKS
Sbjct: 174 YYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKS 233

Query: 285 PPPPSYSPSP 314
           PPPP   PSP
Sbjct: 234 PPPPYKYPSP 243

 Score =  114 bits (285), Expect = 3e-24
 Identities = 66/127 (51%), Positives = 69/127 (54%), Gaps = 22/127 (17%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 156 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYKSPP 212

Query: 192 PP------YYSPSPKVY-YKSPPPP-----------SYYSPSPKV-EYKSPPPPSY---S 305
           PP      Y SP P VY YKSPPPP            Y SP P V +YKSPPPP Y   S
Sbjct: 213 PPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKS 272

Query: 306 PSPKTEY 326
           P P  +Y
Sbjct: 273 PPPPYKY 279

 Score =  114 bits (285), Expect = 3e-24
 Identities = 62/106 (58%), Positives = 64/106 (60%), Gaps = 11/106 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK---VVYKSPPPP 170
           P   Y SPPPP Y   SP P VY YKSPP P+    PPPPP   PSP      YKSPPPP
Sbjct: 324 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 383

Query: 171 YVYNSPPPPYY---SPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPP 296
           Y Y SPPPP Y   SP P VY YKSPPPP +  P P   Y SPPPP
Sbjct: 384 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPPPPHYIYASPPPP 429

 Score =  113 bits (283), Expect = 6e-24
 Identities = 64/112 (57%), Positives = 66/112 (58%), Gaps = 11/112 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPPPPYVY 179
           P  YY SPPPP +SP P  YYKSPP       PPP   Y     P P   YKSPPPPY Y
Sbjct: 188 PPYYYHSPPPPKHSPPPPYYYKSPP-------PPPKKPYKYPSPPPPVYKYKSPPPPYKY 240

Query: 180 NSPPPP-YY--SPSPKVY-YKSPPPP--SYYSPSPKVEYKSPPPPSYS-PSP 314
            SPPPP Y   SP P VY YKSPPPP   Y SP P  +Y SPPPP Y  PSP
Sbjct: 241 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSP 292

 Score =  105 bits (262), Expect = 2e-21
 Identities = 63/115 (54%), Positives = 65/115 (56%), Gaps = 14/115 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---SPSPKVY-YKSPPHP-HVCVCPPPPPCY--SPSPKVVYKSPPPP 170
           P   Y SPPPP Y   SP P VY YKSPP P +    PPPP  Y   P P   Y SPPPP
Sbjct: 275 PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPP 334

Query: 171 -YVYNSPPPPYY---SPSPKVYYKSPPPPSYYSPSPK---VEYKSPPPPSYSPSP 314
            Y Y SPPPP Y   SP P   Y SPPPP Y  PSP     +YKSPPPP   PSP
Sbjct: 335 VYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSP 389

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 48/86 (55%), Positives = 51/86 (59%), Gaps = 5/86 (5%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           P   Y SPPPP Y   SP P VY YKSPP P+    PPPPP   PSP      PPP Y Y
Sbjct: 353 PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSP------PPPVYKY 406

Query: 180 NSPPPPYYSPSPKVY-YKSPPPPSYY 254
            SPPPP +SP P  Y Y SPPPP +Y
Sbjct: 407 KSPPPPVHSPPPPHYIYASPPPPYHY 432

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 37/76 (48%), Positives = 44/76 (57%), Gaps = 7/76 (9%)
 Frame = +3

Query: 120 PCYSPSPKVVYK-------SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEY 278
           P  + +   +Y        SPPPPY Y+SPPPP +SP P  YY SPPPP  +SP P   Y
Sbjct: 22  PSQTLADNYIYSSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPK-HSPPPPYYY 80

Query: 279 KSPPPPSYSPSPKTEY 326
            SPPPP +SP P   Y
Sbjct: 81  HSPPPPKHSPPPPYYY 96

[31][TOP]
>UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris
           RepID=Q09083_PHAVU
          Length = 580

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 56  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 112

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 113 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 156

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 72  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 128

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 129 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 172

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 88  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 144

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 145 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 188

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 104 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 160

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 161 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 204

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 120 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 176

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 177 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 220

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 136 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 192

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 193 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 236

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 152 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 208

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 209 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 252

 Score =  125 bits (314), Expect = 1e-27
 Identities = 59/105 (56%), Positives = 64/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 168 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 224

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 225 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 268

 Score =  124 bits (311), Expect = 3e-27
 Identities = 58/102 (56%), Positives = 64/102 (62%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           YY+SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPPPP 
Sbjct: 43  YYQSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPPPPK 99

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           +SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 100 HSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 140

 Score =  119 bits (297), Expect = 1e-25
 Identities = 59/109 (54%), Positives = 63/109 (57%), Gaps = 4/109 (3%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP +SP P  YY SPP P      PPPP Y  SP     SPPPPY Y+SPP
Sbjct: 184 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPP 240

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP----SYSPSPKTEY 326
           PP +SP P  YY SPPPP  +SP P   Y SPPPP     YS  P   Y
Sbjct: 241 PPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKNPYKYSSPPPPVY 288

 Score =  118 bits (296), Expect = 2e-25
 Identities = 70/118 (59%), Positives = 72/118 (61%), Gaps = 17/118 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPP-----YYSPSPKVY-YKSPPHPHVCVCPPPPPC-YS--PSPKVVYKSPP 164
           P  YY SPPPP     Y SP P VY YKSPP P+    PPPPP  YS  P P   YKSPP
Sbjct: 264 PPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPP 323

Query: 165 PP-YVYNSPPPPYY---SPSPKVY-YKSPPPP--SYYSPSPKVEYKSPPPPSYS-PSP 314
           PP Y Y SPPPP Y   SP P VY YKSPPPP   Y SP P  +Y SPPPP Y  PSP
Sbjct: 324 PPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP 381

 Score =  116 bits (290), Expect = 9e-25
 Identities = 69/132 (52%), Positives = 73/132 (55%), Gaps = 18/132 (13%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYYSPSPK---VYYKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPPP 167
           P VY YKSPPPPY  PSP      Y SPP P      PPPP Y     P P   YKSPPP
Sbjct: 393 PPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPP 452

Query: 168 PYVYNSPPPP---YYSPSPKVY-YKSPPPP--SYYSPSPKVEYKSPPPPSYS----PSPK 317
           PY Y SPPPP   Y SP P VY YKSPPPP   Y SP P  +Y SPPPP Y     P P 
Sbjct: 453 PYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPV 512

Query: 318 TEY*ISRLPLYE 353
            +Y     P+Y+
Sbjct: 513 YKYKSPPPPVYK 524

 Score =  114 bits (286), Expect = 3e-24
 Identities = 67/116 (57%), Positives = 68/116 (58%), Gaps = 15/116 (12%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYY---SPSPKVYYKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPPP 167
           P VY YKSPPPP Y   SP P   Y SPP P      PPPP Y     P P   YKSPPP
Sbjct: 344 PPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 403

Query: 168 PYVYNSPPPP---YYSPSPKVY-YKSPPPP--SYYSPSPKV-EYKSPPPPSYSPSP 314
           PY Y SPPPP   Y SP P VY Y SPPPP   Y SP P V +YKSPPPP   PSP
Sbjct: 404 PYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSP 459

 Score =  113 bits (282), Expect = 7e-24
 Identities = 68/119 (57%), Positives = 69/119 (57%), Gaps = 14/119 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPC-YS--PSPKVVYKSPPPP 170
           P   Y SPPPP Y   SP P VY YKSPP P+    PPPPP  YS  P P   YKSPPPP
Sbjct: 462 PPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPP 521

Query: 171 -YVYNSPPPPYY--SPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPPSY---SPSPKTEY 326
            Y Y SPPPPY   SP P VY YKSPPPP Y   SP     SPPPP Y   SP P   Y
Sbjct: 522 VYKYKSPPPPYKYPSPPPPVYKYKSPPPPVYKYNSPPPPVHSPPPPHYIYASPPPPYHY 580

 Score =  112 bits (281), Expect = 1e-23
 Identities = 64/129 (49%), Positives = 68/129 (52%), Gaps = 27/129 (20%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY---------SPSPKVYYKSPPHPHVCVCP------PPPPCYSPSPK 143
           SP     SPPPPYY         SP P  YY SPP P     P      PPPP +SP P 
Sbjct: 174 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 233

Query: 144 VVY-------KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP----SYYSPSPKV-EYKSP 287
             Y        SPPPPY Y+SPPPP +SP P  YY SPPPP     Y SP P V +YKSP
Sbjct: 234 YYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSP 293

Query: 288 PPPSYSPSP 314
           PPP   PSP
Sbjct: 294 PPPYKYPSP 302

 Score =  111 bits (277), Expect = 3e-23
 Identities = 56/101 (55%), Positives = 61/101 (60%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y SPPPP   P P  YY+SPP P      PPPP Y  SP     SPPPPY Y+SPPPP +
Sbjct: 32  YSSPPPP---PKP-YYYQSPPPPKHS---PPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH 84

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           SP P  YY SPPPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 85  SPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPPPYYY 124

 Score =  109 bits (272), Expect = 1e-22
 Identities = 66/135 (48%), Positives = 68/135 (50%), Gaps = 34/135 (25%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYY---SPSPKVYYKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPPP 167
           P VY YKSPPPP Y   SP P   Y SPP P      PPPP Y     P P   YKSPPP
Sbjct: 432 PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPP 491

Query: 168 PYVYNSPPPP---YYSPSPKVY-YKSPPPPSY--------------------YS--PSPK 269
           PY Y SPPPP   Y SP P VY YKSPPPP Y                    Y   P P 
Sbjct: 492 PYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPVYKYKSPPPPV 551

Query: 270 VEYKSPPPPSYSPSP 314
            +Y SPPPP +SP P
Sbjct: 552 YKYNSPPPPVHSPPP 566

 Score =  108 bits (271), Expect = 1e-22
 Identities = 66/138 (47%), Positives = 71/138 (51%), Gaps = 21/138 (15%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY---------SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP 161
           SP     SPPPPYY         SP P  YY SPP P      PPPP Y  SP     SP
Sbjct: 206 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPK---HSPPPPYYYHSPPPPKHSP 262

Query: 162 PPPYVYNSPPPP-----YYSPSPKVY-YKSPPPPSYY--SPSPKVEYKSPPPPSYS---- 305
           PPPY Y+SPPPP     Y SP P VY YKSPPPP  Y   P P  +Y SPPPP Y     
Sbjct: 263 PPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSP 322

Query: 306 PSPKTEY*ISRLPLYE*N 359
           P P  +Y     P+Y+ N
Sbjct: 323 PPPVYKYKSPPPPVYKYN 340

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 32/64 (50%), Positives = 36/64 (56%), Gaps = 12/64 (18%)
 Frame = +3

Query: 171 YVYNSPPP---PYY---------SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           Y+Y+SPPP   PYY         SP P  YY SPPPP  +SP P   Y SPPPP +SP P
Sbjct: 30  YIYSSPPPPPKPYYYQSPPPPKHSPPPPYYYHSPPPPK-HSPPPPYYYHSPPPPKHSPPP 88

Query: 315 KTEY 326
              Y
Sbjct: 89  PYYY 92

[32][TOP]
>UniRef100_Q01942 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q01942_SOLLC
          Length = 132

 Score =  124 bits (312), Expect = 2e-27
 Identities = 63/112 (56%), Positives = 65/112 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 8   PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 64

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPL 347
           PP  SP P  YYKSPPPP   SPSP     SPPPP+YS  P        +PL
Sbjct: 65  PPDPSPPPPYYYKSPPPP---SPSPPPPSPSPPPPTYSSPPPPPPFYENIPL 113

 Score =  108 bits (270), Expect = 2e-22
 Identities = 58/109 (53%), Positives = 59/109 (54%), Gaps = 14/109 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 24  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPDPSPPPPYYYKSPP 80

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPK--------------VEYKSPPPP 296
           PP  SPSP     SPPPP+Y SP P               V Y SPPPP
Sbjct: 81  PP--SPSPPPPSPSPPPPTYSSPPPPPPFYENIPLPPVIGVSYASPPPP 127

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/96 (54%), Positives = 52/96 (54%)
 Frame = +3

Query: 39  PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPK 218
           PP  SP P  YYKSPP        PP P           SPPPPY Y SPPPP  SP P 
Sbjct: 1   PPSPSPPPPYYYKSPP--------PPSP-----------SPPPPYYYKSPPPPSPSPPPP 41

Query: 219 VYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            YYKSPPPPS  SP P   YKSPPPP  SP P   Y
Sbjct: 42  YYYKSPPPPS-PSPPPPYYYKSPPPPDPSPPPPYYY 76

[33][TOP]
>UniRef100_Q39866 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39866_SOYBN
          Length = 118

 Score =  123 bits (309), Expect = 6e-27
 Identities = 66/114 (57%), Positives = 66/114 (57%), Gaps = 13/114 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  SP P   YKSPP P     PP      PPP  SP P  VYKSPPPP 
Sbjct: 5   PPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 64

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                 YVY SPPPP  SP    YYKSPPPPS  SP P   YKSPPPPS SP P
Sbjct: 65  PSPPPPYVYKSPPPPSPSPPSPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPP 117

 Score =  105 bits (263), Expect = 1e-21
 Identities = 57/99 (57%), Positives = 60/99 (60%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPPY   SP     SPP P++   PPPP     SP     SPPPPYVY SPPPP  SP
Sbjct: 2   SPPPPYVYKSPPPPSPSPPPPYIYKSPPPP-----SP-----SPPPPYVYKSPPPPSPSP 51

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            P   YKSPPPPS  SP P   YKSPPPP  SPSP + Y
Sbjct: 52  PPPYVYKSPPPPS-PSPPPPYVYKSPPPP--SPSPPSPY 87

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 52/95 (54%), Positives = 52/95 (54%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P   YKSPP P     PPPP  Y  SP     SPP PY Y SPP
Sbjct: 37  PPYVYKSPPPPSPSPPPPYVYKSPPPPSPS--PPPPYVYK-SPPPPSPSPPSPYYYKSPP 93

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
           PP  SP P  YYKSPPPPS           SPPPP
Sbjct: 94  PPSPSPPPPYYYKSPPPPS----------PSPPPP 118

[34][TOP]
>UniRef100_Q9ZW80 Putative extensin n=1 Tax=Arabidopsis thaliana RepID=Q9ZW80_ARATH
          Length = 212

 Score =  123 bits (308), Expect = 7e-27
 Identities = 62/105 (59%), Positives = 63/105 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P   YKSPP P   V  PPPP Y  SP    KSPPPPYVY+SPP
Sbjct: 38  PPYEYKSPPPPVKSPPPPYEYKSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYVYSSPP 94

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 95  PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 138

 Score =  122 bits (307), Expect = 9e-27
 Identities = 60/101 (59%), Positives = 61/101 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 102 PPYYYHSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 158

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P
Sbjct: 159 PPVKSPPPPYYYHSPPPP-VKSPPPPYLYSSPPPPVKSPPP 198

 Score =  120 bits (302), Expect = 4e-26
 Identities = 60/105 (57%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P   Y SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 70  PPYYYHSPPPPVKSPPPPYVYSSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 126

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 127 PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 170

 Score =  120 bits (301), Expect = 5e-26
 Identities = 60/105 (57%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 86  PPYVYSSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 142

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 143 PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYLY 186

 Score =  119 bits (298), Expect = 1e-25
 Identities = 61/105 (58%), Positives = 62/105 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P  YY SPP P     PPPP  YS  P  V KSPPPPY Y+SPP
Sbjct: 54  PPYEYKSPPPPVKSPPPPYYYHSPPPP--VKSPPPPYVYSSPPPPV-KSPPPPYYYHSPP 110

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 111 PPVKSPPPPYYYHSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 154

 Score =  117 bits (292), Expect = 5e-25
 Identities = 55/97 (56%), Positives = 58/97 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y+SPP
Sbjct: 118 PPYYYHSPPPPVKSPPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 174

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PP  SP P   Y SPPPP    P P   Y SPPPP++
Sbjct: 175 PPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPPPPTH 211

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/108 (50%), Positives = 57/108 (52%), Gaps = 1/108 (0%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV-YN 182
           A+   YY SPPPPY   SP    KSPP P+    PPPP           KSPPPPY  + 
Sbjct: 27  ATEPYYYSSPPPPYEYKSPPPPVKSPPPPYEYKSPPPP----------VKSPPPPYYYH- 75

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           SPPPP  SP P   Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 76  SPPPPVKSPPPPYVYSSPPPP-VKSPPPPYYYHSPPPPVKSPPPPYYY 122

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 42/86 (48%), Positives = 48/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   RASPKVYYK-SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           ++ P  YY  SPPPP  SP P  YY SPP P                    KSPPPPY+Y
Sbjct: 146 KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPP-------------------VKSPPPPYLY 186

Query: 180 NSPPPPYYSPSPKVY-YKSPPPPSYY 254
           +SPPPP  SP P VY Y SPPPP++Y
Sbjct: 187 SSPPPPVKSPPPPVYIYASPPPPTHY 212

[35][TOP]
>UniRef100_B9GF15 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GF15_POPTR
          Length = 152

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/113 (57%), Positives = 65/113 (57%), Gaps = 8/113 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP------- 170
           P   Y SPPPP  SP P   YKSPP P      PPPP  SP P  VYKSPPPP       
Sbjct: 46  PPYVYMSPPPPSPSPPPPYIYKSPPPP------PPPPSPSPPPPYVYKSPPPPSPSPPPP 99

Query: 171 YVYNSPPPPYYSPSPKVYYKS-PPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           YVYNSPPPP  SP P   Y S PPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 100 YVYNSPPPPSPSPPPPYVYNSPPPPPSSPSPPPPYIYKSPPPPSPSPPPPPYY 152

 Score =  116 bits (290), Expect = 9e-25
 Identities = 63/122 (51%), Positives = 64/122 (52%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  S  P   YKSPP P     PP      PPP  SP P  +YKSPPPP 
Sbjct: 14  PPYIYKSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPPSPSPPPPYIYKSPPPPP 73

Query: 171 ----------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
                     YVY SPPPP  SP P   Y SPPPPS  SP P   Y SPPPP  SPSP  
Sbjct: 74  PPPSPSPPPPYVYKSPPPPSPSPPPPYVYNSPPPPSP-SPPPPYVYNSPPPPPSSPSPPP 132

Query: 321 EY 326
            Y
Sbjct: 133 PY 134

 Score =  110 bits (275), Expect = 5e-23
 Identities = 62/106 (58%), Positives = 62/106 (58%), Gaps = 5/106 (4%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPP--PPPCYSPSPKVVYKSPPPPYVYNSPPPP 197
           YKSPPPP  SP P   YKSPP P     PP  PPP    SP     SPPPPYVY SPPPP
Sbjct: 2   YKSPPPPSTSPPPPYIYKSPPPP-----PPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPP 56

Query: 198 YYSPSPKVYYKSPPPPSY-YSPS--PKVEYKSPPPPSYSPSPKTEY 326
             SP P   YKSPPPP    SPS  P   YKSPPPPS SP P   Y
Sbjct: 57  SPSPPPPYIYKSPPPPPPPPSPSPPPPYVYKSPPPPSPSPPPPYVY 102

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 38/67 (56%), Positives = 40/67 (59%), Gaps = 7/67 (10%)
 Frame = +3

Query: 147 VYKSPP-------PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           +YKSPP       PPY+Y SPPPP  S  P   YKSPPPPS  SP P   Y SPPPPS S
Sbjct: 1   MYKSPPPPSTSPPPPYIYKSPPPPPPSSPPPYIYKSPPPPS-PSPPPPYVYMSPPPPSPS 59

Query: 306 PSPKTEY 326
           P P   Y
Sbjct: 60  PPPPYIY 66

[36][TOP]
>UniRef100_Q9ZWT0 Extensin n=1 Tax=Adiantum capillus-veneris RepID=Q9ZWT0_ADICA
          Length = 207

 Score =  120 bits (302), Expect = 4e-26
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 13/116 (11%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPP 167
           +SP   YKSPPPP  SP P   YKSPP P     PP      PPP  SP P  +YKSPPP
Sbjct: 80  SSPPYKYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYLYKSPPP 139

Query: 168 P-------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P       Y+Y SPPPP  +PSP  Y+ S PPP   SP P  +YKSPPPPS+ PSP
Sbjct: 140 PSPSPPPPYIYKSPPPPPCTPSPPPYFYSSPPPPSPSPPPPYQYKSPPPPSH-PSP 194

 Score =  119 bits (299), Expect = 8e-26
 Identities = 62/111 (55%), Positives = 65/111 (58%), Gaps = 14/111 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P   YKSPPPP  SP P   YKSPP P     PP      PPP  SP P  +YKSPPPP 
Sbjct: 98  PPYIYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYIYKSPPPPP 157

Query: 171 -------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
                  Y Y+SPPPP  SP P   YKSPPPPS+ SP P V YKSPPPP Y
Sbjct: 158 CTPSPPPYFYSSPPPPSPSPPPPYQYKSPPPPSHPSPPPYV-YKSPPPPPY 207

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 55/105 (52%), Positives = 57/105 (54%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   +KSPPP   SP  K  YKSPP        PP P           SPPPPY+Y SPP
Sbjct: 68  PHYPHKSPPPSPSSPPYK--YKSPP--------PPSP-----------SPPPPYIYKSPP 106

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P   YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 107 PPSPSPPPPYIYKSPPPPSP-SPPPPYLYKSPPPPSPSPPPPYIY 150

[37][TOP]
>UniRef100_B9GWA6 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9GWA6_POPTR
          Length = 202

 Score =  120 bits (300), Expect = 6e-26
 Identities = 64/121 (52%), Positives = 69/121 (57%), Gaps = 15/121 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVY------ 152
           +P+  YKSPPPP  SP P  +Y SPP P +   PPP      PP  SPSP   Y      
Sbjct: 36  TPRYVYKSPPPPSPSPPPPYHYSSPPPPPLKKSPPPSYVYKSPPPPSPSPPPPYHYSSPP 95

Query: 153 ---KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
              KSPPPPYVY SPPPP  S SP  +Y SPPPP   SP P   YKSPPPPS SP P   
Sbjct: 96  PPKKSPPPPYVYKSPPPPSPSLSPPYHYSSPPPPK-KSPPPPYIYKSPPPPSPSPPPPYH 154

Query: 324 Y 326
           Y
Sbjct: 155 Y 155

 Score =  119 bits (299), Expect = 8e-26
 Identities = 61/114 (53%), Positives = 67/114 (58%), Gaps = 13/114 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P  +Y SPPPP  SP P   YKSPP P   + PP      PPP  SP P  +YKSPPPP 
Sbjct: 87  PPYHYSSPPPPKKSPPPPYVYKSPPPPSPSLSPPYHYSSPPPPKKSPPPPYIYKSPPPPS 146

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                 Y Y+SP PP  SP P   YKSPPPPS  SP P   YKSPPPP++SP P
Sbjct: 147 PSPPPPYHYSSPSPPKKSPPPLYIYKSPPPPS-PSPPPPYYYKSPPPPTHSPPP 199

 Score =  109 bits (273), Expect = 8e-23
 Identities = 61/120 (50%), Positives = 64/120 (53%), Gaps = 15/120 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY-SP--------------SPKV 146
           P   YKSPPPP  SP P  +Y SPP P     PPPP  Y SP              SP  
Sbjct: 71  PSYVYKSPPPPSPSPPPPYHYSSPPPPKKS--PPPPYVYKSPPPPSPSLSPPYHYSSPPP 128

Query: 147 VYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
             KSPPPPY+Y SPPPP  SP P  +Y SP PP   SP P   YKSPPPPS SP P   Y
Sbjct: 129 PKKSPPPPYIYKSPPPPSPSPPPPYHYSSPSPPK-KSPPPLYIYKSPPPPSPSPPPPYYY 187

 Score =  105 bits (263), Expect = 1e-21
 Identities = 52/98 (53%), Positives = 57/98 (58%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP  +Y SPPPP  SP P   YKSPP P      PPPP +  SP    KSPPP Y+Y SP
Sbjct: 118 SPPYHYSSPPPPKKSPPPPYIYKSPPPPSPS---PPPPYHYSSPSPPKKSPPPLYIYKSP 174

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PPP  SP P  YYKSPPPP++          SPPPP Y
Sbjct: 175 PPPSPSPPPPYYYKSPPPPTH----------SPPPPYY 202

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/108 (50%), Positives = 58/108 (53%), Gaps = 11/108 (10%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY---SPSPKVVYKSPPPPYVYNSPPPPYYS 206
           P    SP+P+  YKSPP P     P PPP Y   SP P  + KSPPP YVY SPPPP   
Sbjct: 29  PAKEVSPTPRYVYKSPPPPS----PSPPPPYHYSSPPPPPLKKSPPPSYVYKSPPPP--- 81

Query: 207 PSPKVYYKSPPPPSYY--------SPSPKVEYKSPPPPSYSPSPKTEY 326
            SP     SPPPP +Y        SP P   YKSPPPPS S SP   Y
Sbjct: 82  -SP-----SPPPPYHYSSPPPPKKSPPPPYVYKSPPPPSPSLSPPYHY 123

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 32/66 (48%), Positives = 34/66 (51%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           +SP    KSPPP Y        YKS          PPPP  SP P   YKSPPPP   +S
Sbjct: 156 SSPSPPKKSPPPLY-------IYKS----------PPPPSPSPPPPYYYKSPPPP--THS 196

Query: 186 PPPPYY 203
           PPPPYY
Sbjct: 197 PPPPYY 202

[38][TOP]
>UniRef100_Q39865 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39865_SOYBN
          Length = 169

 Score =  119 bits (298), Expect = 1e-25
 Identities = 63/118 (53%), Positives = 64/118 (54%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P  YY SPPPP  SP P  YYKSPP P     PP      PPP  SP P   Y SPPPP 
Sbjct: 2   PPYYYHSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYHSPPPPS 61

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                 Y Y SPPPP  SP P  YYKSPPPPS  S  P   YKSPPPP+  P P   Y
Sbjct: 62  PSPPSPYYYKSPPPPSPSPPPPYYYKSPPPPSPTS-HPPYYYKSPPPPTSYPPPPYHY 118

 Score =  119 bits (298), Expect = 1e-25
 Identities = 62/118 (52%), Positives = 64/118 (54%), Gaps = 13/118 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPP- 170
           P  YYKSPPPP  SP P  YY SPP P     PP      PPP  SP     YKSPPPP 
Sbjct: 18  PPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYHSPPPPSPSPPSPYYYKSPPPPS 77

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                 Y Y SPPPP  +  P  YYKSPPPP+ Y P P   Y SPPPPS SP P   Y
Sbjct: 78  PSPPPPYYYKSPPPPSPTSHPPYYYKSPPPPTSY-PPPPYHYVSPPPPSPSPPPPYHY 134

 Score =  115 bits (289), Expect = 1e-24
 Identities = 64/115 (55%), Positives = 65/115 (56%), Gaps = 10/115 (8%)
 Frame = +3

Query: 12  PKVYYK-SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           P  YY  SPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y+SP
Sbjct: 1   PPPYYYHSPPPPSPSPPPPYYYKSPPPPSP---SPPPPYYYHSPPPPSPSPPPPYYYHSP 57

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS---------YSPSPKTEY 326
           PPP  SP    YYKSPPPPS  SP P   YKSPPPPS          SP P T Y
Sbjct: 58  PPPSPSPPSPYYYKSPPPPS-PSPPPPYYYKSPPPPSPTSHPPYYYKSPPPPTSY 111

 Score =  110 bits (276), Expect = 4e-23
 Identities = 61/121 (50%), Positives = 66/121 (54%), Gaps = 7/121 (5%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-------P 167
           SP     SPPPPYY  SP     SPP P+     PPPP  SP P   YKSPP       P
Sbjct: 40  SPPPPSPSPPPPYYYHSPPPPSPSPPSPYY-YKSPPPPSPSPPPPYYYKSPPPPSPTSHP 98

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPL 347
           PY Y SPPPP   P P  +Y SPPPPS  SP P   Y SPPPPS +P+PK  Y     P+
Sbjct: 99  PYYYKSPPPPTSYPPPPYHYVSPPPPS-PSPPPPYHYTSPPPPSPAPAPKYIYKSPPPPV 157

Query: 348 Y 350
           Y
Sbjct: 158 Y 158

 Score =  110 bits (276), Expect = 4e-23
 Identities = 58/101 (57%), Positives = 61/101 (60%), Gaps = 3/101 (2%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           YYKSPPPP  SP P  YYKSPP P        PP Y  SP      PPPPY Y SPPPP 
Sbjct: 69  YYKSPPPPSPSPPPPYYYKSPPPPSPT---SHPPYYYKSPPPPTSYPPPPYHYVSPPPPS 125

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY---SPSP 314
            SP P  +Y SPPPPS  +P+PK  YKSPPPP Y   SP P
Sbjct: 126 PSPPPPYHYTSPPPPS-PAPAPKYIYKSPPPPVYIYASPPP 165

 Score =  104 bits (259), Expect = 3e-21
 Identities = 54/97 (55%), Positives = 57/97 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  +  P  YYKSPP P     PPPP  Y  SP     SPPPPY Y SPP
Sbjct: 82  PPYYYKSPPPPSPTSHPPYYYKSPPPP--TSYPPPPYHY-VSPPPPSPSPPPPYHYTSPP 138

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PP  +P+PK  YKSPPPP Y        Y SPPPP Y
Sbjct: 139 PPSPAPAPKYIYKSPPPPVYI-------YASPPPPIY 168

[39][TOP]
>UniRef100_B9NAX9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NAX9_POPTR
          Length = 312

 Score =  119 bits (298), Expect = 1e-25
 Identities = 57/102 (55%), Positives = 61/102 (59%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           YYKSPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y+SPPPP 
Sbjct: 33  YYKSPPPPSQSPPPPYHYSSPPPPKKS---PPPPYHYTSPPPPKKSPPPPYHYSSPPPPK 89

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 90  KSPPPPYHYSSPPPPK-KSPPPPYHYSSPPPPKKSPPPPYHY 130

 Score =  117 bits (292), Expect = 5e-25
 Identities = 56/105 (53%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y+SPP
Sbjct: 78  PPYHYSSPPPPKKSPPPPYHYSSPPPPKKS---PPPPYHYSSPPPPKKSPPPPYHYSSPP 134

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 135 PPKKSPPPPYHYSSPPPPK-KSPPPPYHYSSPPPPKKSPPPPYHY 178

 Score =  117 bits (292), Expect = 5e-25
 Identities = 56/105 (53%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y+SPP
Sbjct: 94  PPYHYSSPPPPKKSPPPPYHYSSPPPPKKS---PPPPYHYSSPPPPKKSPPPPYHYSSPP 150

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 151 PPKKSPPPPYHYSSPPPPK-KSPPPPYHYSSPPPPKKSPPPPYHY 194

 Score =  116 bits (291), Expect = 7e-25
 Identities = 56/105 (53%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y+SPP
Sbjct: 62  PPYHYTSPPPPKKSPPPPYHYSSPPPPKKS---PPPPYHYSSPPPPKKSPPPPYHYSSPP 118

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 119 PPKKSPPPPYHYSSPPPPK-KSPPPPYHYSSPPPPKKSPPPPYHY 162

 Score =  116 bits (291), Expect = 7e-25
 Identities = 56/105 (53%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y+SPP
Sbjct: 110 PPYHYSSPPPPKKSPPPPYHYSSPPPPKKS---PPPPYHYSSPPPPKKSPPPPYHYSSPP 166

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 167 PPKKSPPPPYHYSSPPPPK-KSPPPPYHYTSPPPPKKSPPPPYHY 210

 Score =  116 bits (291), Expect = 7e-25
 Identities = 56/105 (53%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y+SPP
Sbjct: 126 PPYHYSSPPPPKKSPPPPYHYSSPPPPKKS---PPPPYHYSSPPPPKKSPPPPYHYSSPP 182

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 183 PPKKSPPPPYHYTSPPPPK-KSPPPPYHYSSPPPPKKSPPPPYHY 226

 Score =  116 bits (291), Expect = 7e-25
 Identities = 56/105 (53%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y+SPP
Sbjct: 158 PPYHYSSPPPPKKSPPPPYHYSSPPPPKKS---PPPPYHYTSPPPPKKSPPPPYHYSSPP 214

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 215 PPKKSPPPPYHYTSPPPPK-KSPPPPYHYSSPPPPKKSPPPPYHY 258

 Score =  116 bits (291), Expect = 7e-25
 Identities = 56/105 (53%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y+SPP
Sbjct: 190 PPYHYTSPPPPKKSPPPPYHYSSPPPPKKS---PPPPYHYTSPPPPKKSPPPPYHYSSPP 246

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 247 PPKKSPPPPYHYSSPPPPK-KSPPPPYHYSSPPPPKKSPPPPYHY 290

 Score =  116 bits (291), Expect = 7e-25
 Identities = 56/105 (53%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y+SPP
Sbjct: 206 PPYHYSSPPPPKKSPPPPYHYTSPPPPKKS---PPPPYHYSSPPPPKKSPPPPYHYSSPP 262

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 263 PPKKSPPPPYHYSSPPPPK-KSPPPPYHYSSPPPPKKSPPPPYHY 306

 Score =  116 bits (290), Expect = 9e-25
 Identities = 56/105 (53%), Positives = 60/105 (57%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y SPP
Sbjct: 142 PPYHYSSPPPPKKSPPPPYHYSSPPPPKKS---PPPPYHYSSPPPPKKSPPPPYHYTSPP 198

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 199 PPKKSPPPPYHYSSPPPPK-KSPPPPYHYTSPPPPKKSPPPPYHY 242

 Score =  115 bits (288), Expect = 2e-24
 Identities = 58/105 (55%), Positives = 62/105 (59%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P     PPPP  YS SP    KSPPPPY Y+SPP
Sbjct: 46  PPYHYSSPPPPKKSPPPPYHYTSPPPPKKS--PPPPYHYS-SPPPPKKSPPPPYHYSSPP 102

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 103 PPKKSPPPPYHYSSPPPPK-KSPPPPYHYSSPPPPKKSPPPPYHY 146

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/105 (55%), Positives = 61/105 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P     PPPP  YS SP    KSPPPPY Y SPP
Sbjct: 174 PPYHYSSPPPPKKSPPPPYHYTSPPPPKKS--PPPPYHYS-SPPPPKKSPPPPYHYTSPP 230

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  SP P  +Y SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 231 PPKKSPPPPYHYSSPPPPK-KSPPPPYHYSSPPPPKKSPPPPYHY 274

 Score =  108 bits (271), Expect = 1e-22
 Identities = 52/95 (54%), Positives = 57/95 (60%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +Y SPPPP  SP P  +Y SPP P      PPPP +  SP    KSPPPPY Y+SPP
Sbjct: 222 PPYHYTSPPPPKKSPPPPYHYSSPPPPKKS---PPPPYHYSSPPPPKKSPPPPYHYSSPP 278

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
           PP  SP P  +Y SPPPP   SP P   Y SPPPP
Sbjct: 279 PPKKSPPPPYHYSSPPPPK-KSPPPPYHYTSPPPP 312

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 38/69 (55%), Positives = 41/69 (59%)
 Frame = +3

Query: 120 PCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
           P Y  SP    +SPPPPY Y+SPPPP  SP P  +Y SPPPP   SP P   Y SPPPP 
Sbjct: 31  PYYYKSPPPPSQSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPK-KSPPPPYHYSSPPPPK 89

Query: 300 YSPSPKTEY 326
            SP P   Y
Sbjct: 90  KSPPPPYHY 98

[40][TOP]
>UniRef100_Q8H9E1 Extensin (Fragment) n=1 Tax=Solanum tuberosum RepID=Q8H9E1_SOLTU
          Length = 152

 Score =  118 bits (296), Expect = 2e-25
 Identities = 63/108 (58%), Positives = 66/108 (61%), Gaps = 11/108 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPPPP--- 170
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y     P P   YKSPPPP   
Sbjct: 45  PPYYYKSPPPPSPSPPPPYYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPV 104

Query: 171 YVYNSPPPPYY---SPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPPSY 302
           Y Y SPPPP Y   SP P VY YKSPPPP + SP+P   Y SPPPPS+
Sbjct: 105 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAP-YYYTSPPPPSH 151

 Score =  118 bits (295), Expect = 2e-25
 Identities = 68/115 (59%), Positives = 71/115 (61%), Gaps = 14/115 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY---SPSPKVVYKSPPPP-YVY 179
           P  YYKSPPPP  SP P  YYKSPP P      PPPP Y    P P  VYKSPPPP Y Y
Sbjct: 29  PPYYYKSPPPPSPSPPPPYYYKSPPPPSP---SPPPPYYYKSPPPPPPVYKSPPPPVYKY 85

Query: 180 NSPPPPYYS-----PSPKVY-YKSPPPP--SYYSPSPKV-EYKSPPPPSY-SPSP 314
            SPPPP Y      P P VY YKSPPPP   Y SP P V +YKSPPPP + SP+P
Sbjct: 86  KSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAP 140

 Score =  112 bits (281), Expect = 1e-23
 Identities = 64/113 (56%), Positives = 65/113 (57%), Gaps = 12/113 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P  YYKSPP P      PPPP Y  SP     SPPPPY Y SPP
Sbjct: 13  PPYVYKSPPPPSPSPPPPYYYKSPPPPSPS---PPPPYYYKSPPPPSPSPPPPYYYKSPP 69

Query: 192 PP--YY-SPSPKVY-YKSPPPPSYY-----SPSPKVEYKSPPPPSY---SPSP 314
           PP   Y SP P VY YKSPPPP Y       P P  +YKSPPPP Y   SP P
Sbjct: 70  PPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPP 122

 Score =  110 bits (275), Expect = 5e-23
 Identities = 65/120 (54%), Positives = 69/120 (57%), Gaps = 10/120 (8%)
 Frame = +3

Query: 24  YKSPPPPYYS-PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           YKSPPPP  S P P VY KSPP P      PPPP Y  SP     SPPPPY Y SPPPP 
Sbjct: 1   YKSPPPPSPSLPPPYVY-KSPPPPSP---SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 56

Query: 201 YSPSPKVYYKSPPPPS--YYSPSPKV-EYKSPPPPSYS------PSPKTEY*ISRLPLYE 353
            SP P  YYKSPPPP   Y SP P V +YKSPPPP Y       P P  +Y     P+Y+
Sbjct: 57  PSPPPPYYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYK 116

[41][TOP]
>UniRef100_Q41986 Extensin (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q41986_ARATH
          Length = 97

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/100 (57%), Positives = 61/100 (61%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P V    PPPP YS SPK  YKSPP P+V   PPPPP  S SPK  Y   PPPYVY+SPP
Sbjct: 6   PHVCXFXPPPPCYSNSPKXEYKSPPTPYVXHSPPPPPXXSXSPKPAYNFXPPPYVYSSPP 65

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
           PPY SP+PK  YK PPPP  Y+        SPPP    PS
Sbjct: 66  PPYXSPAPKPVYKFPPPPYVYN--------SPPPXYXXPS 97

 Score =  111 bits (277), Expect = 3e-23
 Identities = 53/93 (56%), Positives = 56/93 (60%), Gaps = 9/93 (9%)
 Frame = +3

Query: 75  KSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP---------PYYSPSPKVYY 227
           KSPPHPHVC   PPPPCYS SPK  YKSPP PYV +SPPP         P Y+  P  Y 
Sbjct: 1   KSPPHPHVCXFXPPPPCYSNSPKXEYKSPPTPYVXHSPPPPPXXSXSPKPAYNFXPPPYV 60

Query: 228 KSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            S PPP Y SP+PK  YK PPPP    SP   Y
Sbjct: 61  YSSPPPPYXSPAPKPVYKFPPPPYVYNSPPPXY 93

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 40/68 (58%), Positives = 44/68 (64%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           +P V +  PPPP  S SPK  Y   P P+V    PPPP  SP+PK VYK PPPPYVYNSP
Sbjct: 31  TPYVXHSPPPPPXXSXSPKPAYNFXPPPYV-YSSPPPPYXSPAPKPVYKFPPPPYVYNSP 89

Query: 189 PPPYYSPS 212
           PP Y  PS
Sbjct: 90  PPXYXXPS 97

[42][TOP]
>UniRef100_Q39864 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39864_SOYBN
          Length = 199

 Score =  116 bits (290), Expect = 9e-25
 Identities = 67/116 (57%), Positives = 68/116 (58%), Gaps = 15/116 (12%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYY---SPSPKVYYKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPPP 167
           P VY YKSPPPP Y   SP P   Y SPP P      PPPP Y     P P   YKSPPP
Sbjct: 42  PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 101

Query: 168 PYVYNSPPPP---YYSPSPKVY-YKSPPPP--SYYSPSPKVEYKSPPPPSYS-PSP 314
           PY Y SPPPP   Y SP P VY YKSPPPP   Y SP P  +Y SPPPP Y  PSP
Sbjct: 102 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSP 157

 Score =  112 bits (279), Expect = 2e-23
 Identities = 65/112 (58%), Positives = 66/112 (58%), Gaps = 11/112 (9%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYYSPS---PKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           P VY YKSPPPPY  PS   P   Y SPP P      PPPP Y       YKSPPPPY Y
Sbjct: 13  PPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK------YKSPPPPYKY 66

Query: 180 NSPPPP---YYSPSPKVY-YKSPPPP--SYYSPSPKVEYKSPPPPSYS-PSP 314
            SPPPP   Y SP P VY YKSPPPP   Y SP P  +Y SPPPP Y  PSP
Sbjct: 67  PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSP 118

 Score =  112 bits (279), Expect = 2e-23
 Identities = 66/115 (57%), Positives = 68/115 (59%), Gaps = 14/115 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK---VVYKSPPPP 170
           P   Y SPPPP Y   SP P VY YKSPP P+    PPPPP   PSP      YKSPPPP
Sbjct: 72  PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 131

Query: 171 -YVYNSPPPP--YYSPSPKVY-YKSPPPP--SYYSPSPKVEYKSPPPPSYS-PSP 314
            Y Y SPPPP  Y SP P  Y Y SPPPP   Y SP P  +Y SPPPP Y  PSP
Sbjct: 132 VYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSP 186

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/118 (55%), Positives = 67/118 (56%), Gaps = 17/118 (14%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYY---SPSPKVYYKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPPP 167
           P VY YKSPPPP Y   SP P   Y SPP P      PPPP Y     P P   YKSPPP
Sbjct: 81  PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 140

Query: 168 PYVYNSPPPPYY---SPSPKVY-YKSPPPPSYYS--PSPKVEYKSPPPPSY---SPSP 314
           P+ Y SPPPP Y   SP P VY YKSPPPP  Y   P P  +Y SPPPP Y   SP P
Sbjct: 141 PHKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 198

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/102 (55%), Positives = 58/102 (56%), Gaps = 7/102 (6%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK---VVYKSPPPP 170
           P   Y SPPPP Y   SP P VY YKSPP PH    PPPPP   PSP      YKSPPPP
Sbjct: 111 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKSPPPP 170

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
           Y Y SPPPP Y       Y SPPPP Y       +YKSPPPP
Sbjct: 171 YKYPSPPPPPYK------YPSPPPPVY-------KYKSPPPP 199

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 51/92 (55%), Positives = 52/92 (56%), Gaps = 7/92 (7%)
 Frame = +3

Query: 60  PKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP---YYSPSPKVY-Y 227
           PK  YK P         PPPP Y       YKSPPPPY Y SPPPP   Y SP P VY Y
Sbjct: 2   PKKPYKYPS--------PPPPVYK------YKSPPPPYKYPSPPPPPYKYPSPPPPVYKY 47

Query: 228 KSPPPP--SYYSPSPKVEYKSPPPPSYS-PSP 314
           KSPPPP   Y SP P  +Y SPPPP Y  PSP
Sbjct: 48  KSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSP 79

[43][TOP]
>UniRef100_C3VPW8 Extensin n=1 Tax=Lithospermum erythrorhizon RepID=C3VPW8_LITER
          Length = 247

 Score =  115 bits (288), Expect = 2e-24
 Identities = 62/116 (53%), Positives = 70/116 (60%), Gaps = 8/116 (6%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           ++ P   YKSPPPP +   P   YKSPP P +   PPPP  YSP P V YKSPPPP   +
Sbjct: 56  KSPPPPVYKSPPPPMHKSPPPPVYKSPPPP-MHKSPPPPKKYSPPPPV-YKSPPPPMHKS 113

Query: 183 SPPPPYYSPSPKVY-------YKSPPPPSYYSPSPKVEYKSPPPPSY-SPSPKTEY 326
            PPP  YSP P VY       +KSPPPP  YSP P V YKSPPPP + SP P  +Y
Sbjct: 114 PPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPV-YKSPPPPMHKSPPPPKKY 168

 Score =  111 bits (278), Expect = 2e-23
 Identities = 59/115 (51%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPY-YSPSPKVYYKSPPHPHVCVCPP-----PPPCYSPSPKVVYKSPP 164
           ++ P   +KSPPPP  YSP P VY   PP  H    PP     PPP Y   P  ++KSPP
Sbjct: 80  KSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPP 139

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY-SPSPKTEY 326
           PP  Y+ PPP Y SP P + +KSPPPP  YSP P V YKSPPPP + SP P  +Y
Sbjct: 140 PPKKYSPPPPVYKSPPPPM-HKSPPPPKKYSPPPPV-YKSPPPPMHKSPPPPKKY 192

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/110 (54%), Positives = 65/110 (59%), Gaps = 9/110 (8%)
 Frame = +3

Query: 24  YKSPPPPY-YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           Y SPPPP  YSP P  Y+   P P V   PPPP   SP P V YKSPPPP   + PPP  
Sbjct: 37  YSSPPPPKKYSPPPHHYHHKSPPPPVYKSPPPPMHKSPPPPV-YKSPPPPMHKSPPPPKK 95

Query: 201 YSPSPKVY-------YKSPPPPSYYSPSPKVEYKSPPPPSY-SPSPKTEY 326
           YSP P VY       +KSPPPP  YSP P V YKSPPPP + SP P  +Y
Sbjct: 96  YSPPPPVYKSPPPPMHKSPPPPKKYSPPPPV-YKSPPPPMHKSPPPPKKY 144

 Score =  103 bits (258), Expect = 5e-21
 Identities = 57/130 (43%), Positives = 68/130 (52%), Gaps = 15/130 (11%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPY-YSPSPKVYYKSPPHPHVCVCPP-----PPPCYSPSPKVVYKSPP 164
           ++ P   +KSPPPP  YSP P VY   PP  H    PP     PPP Y   P  ++KSPP
Sbjct: 104 KSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPP 163

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKV---------EYKSPPPPSYSPSPK 317
           PP  Y+ PPP Y SP P + +KSPPPP  YSP P V         +Y  PPP   SP   
Sbjct: 164 PPKKYSPPPPVYKSPPPPM-HKSPPPPKKYSPPPPVHKPPPHWSHKYSPPPPVHKSPPHH 222

Query: 318 TEY*ISRLPL 347
             Y +  LP+
Sbjct: 223 YRYNLLHLPI 232

[44][TOP]
>UniRef100_B9SSV0 Cleavage and polyadenylation specificity factor, putative n=1
           Tax=Ricinus communis RepID=B9SSV0_RICCO
          Length = 210

 Score =  114 bits (285), Expect = 3e-24
 Identities = 64/132 (48%), Positives = 67/132 (50%), Gaps = 18/132 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP----------PPPPCYSPSPKVVYKSP 161
           P  YYKSPPPP  SP P  YY SPP       P          PPPP  S  P   Y SP
Sbjct: 49  PPYYYKSPPPPSPSPPPPYYYTSPPPRKKYPSPSPLLPYHYHSPPPPKKSTHPTYYYNSP 108

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPPS------YYSPSPKVEYKSPPPPSY--SPSPK 317
           PPPY YNSPPPP  SP P  YY SPPPP       Y+  SP     SPPPP Y  SPSP 
Sbjct: 109 PPPYYYNSPPPPSSSPPPLYYYDSPPPPKKSLSPPYHYQSPSPLSPSPPPPYYYASPSPT 168

Query: 318 TEY*ISRLPLYE 353
            +   S L  Y+
Sbjct: 169 PKKSPSPLSYYK 180

 Score =  102 bits (255), Expect = 1e-20
 Identities = 56/103 (54%), Positives = 61/103 (59%), Gaps = 2/103 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY SPPPP  SP P  YY SPP P   + PP    +  SP  +  SPPPPY Y SP 
Sbjct: 110 PPYYYNSPPPPSSSPPPLYYYDSPPPPKKSLSPP---YHYQSPSPLSPSPPPPYYYASPS 166

Query: 192 P-PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY-SPSP 314
           P P  SPSP  YYKSPPPPS  SP     Y+S PPP+Y SP P
Sbjct: 167 PTPKKSPSPLSYYKSPPPPS-LSPPLSYYYQSLPPPNYFSPPP 208

 Score =  102 bits (253), Expect = 2e-20
 Identities = 58/117 (49%), Positives = 60/117 (51%), Gaps = 12/117 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY--SPSPKVVYKSPPP--PYVY 179
           P   YK PPP      P  YYKSPP P      PPPP Y  SP P+  Y SP P  PY Y
Sbjct: 33  PSYEYKLPPPHKKVYYPPYYYKSPPPPSPS---PPPPYYYTSPPPRKKYPSPSPLLPYHY 89

Query: 180 NSPPPPYYSPSPKVYYKSPPPPSYY--------SPSPKVEYKSPPPPSYSPSPKTEY 326
           +SPPPP  S  P  YY SPPPP YY        SP P   Y SPPPP  S SP   Y
Sbjct: 90  HSPPPPKKSTHPTYYYNSPPPPYYYNSPPPPSSSPPPLYYYDSPPPPKKSLSPPYHY 146

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 39/86 (45%), Positives = 45/86 (52%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP  +Y+SP P   SP P  YY SP               SP+PK   KSP P   Y SP
Sbjct: 141 SPPYHYQSPSPLSPSPPPPYYYASP---------------SPTPK---KSPSPLSYYKSP 182

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSP 266
           PPP  SP    YY+S PPP+Y+SP P
Sbjct: 183 PPPSLSPPLSYYYQSLPPPNYFSPPP 208

[45][TOP]
>UniRef100_Q38913 Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=EXTN1_ARATH
          Length = 373

 Score =  113 bits (283), Expect = 6e-24
 Identities = 64/117 (54%), Positives = 69/117 (58%), Gaps = 15/117 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHP-------HVCVCPPPPPCYSPSPKVVYKSPPP 167
           SP   YKSPPPP    SP   YKSPP P        V   PPPP  YSP P VVY SPPP
Sbjct: 202 SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVHYSPPP-VVYHSPPP 260

Query: 168 PY-------VYNSPPPP-YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P        VY+SPPPP +YSP P VY+ SPPPP +YSP P V +  PPP  YSP P
Sbjct: 261 PVHYSPPPVVYHSPPPPVHYSPPPVVYH-SPPPPVHYSPPPVVYHSPPPPVHYSPPP 316

 Score =  111 bits (278), Expect = 2e-23
 Identities = 65/117 (55%), Positives = 65/117 (55%), Gaps = 15/117 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPP 170
           SP   YKSPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPPPP
Sbjct: 138 SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 197

Query: 171 YVYNSPPPPYYSPSPKV-------YYKSPPPP-SYYSPSPKVEYKSPPPP-SYSPSP 314
             Y SPPP Y SP P V        YKSPPPP  YYSP P   YKSPPPP  YSP P
Sbjct: 198 VKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPP--VYKSPPPPVHYSPPP 252

 Score =  111 bits (278), Expect = 2e-23
 Identities = 66/119 (55%), Positives = 71/119 (59%), Gaps = 17/119 (14%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPHP-------HVCVCPPPPPCYSPSPKVVYKSP 161
           SP   YKSPPPP  YYSP P   YKSPP P        V   PPPP  Y  SP  VYKSP
Sbjct: 186 SPPPVYKSPPPPVKYYSPPP--VYKSPPPPVKHYSPPPVYKSPPPPVKYY-SPPPVYKSP 242

Query: 162 -------PPPYVYNSPPPP-YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                  PPP VY+SPPPP +YSP P VY+ SPPPP +YSP P V +  PPP  YSP P
Sbjct: 243 PPPVHYSPPPVVYHSPPPPVHYSPPPVVYH-SPPPPVHYSPPPVVYHSPPPPVHYSPPP 300

 Score =  111 bits (277), Expect = 3e-23
 Identities = 72/134 (53%), Positives = 77/134 (57%), Gaps = 28/134 (20%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPHPH-------VCVCPPPPPCYSPSPKVVYKSP 161
           SP   YKSPPPP  YYSP P   YKSPP P        V   PPPP  YSP P VVY SP
Sbjct: 218 SPPPVYKSPPPPVKYYSPPP--VYKSPPPPVHYSPPPVVYHSPPPPVHYSPPP-VVYHSP 274

Query: 162 PPPY-------VYNSPPPP-YYSPSPKVYYKSPPPPSYYSPSPKV-----------EYKS 284
           PPP        VY+SPPPP +YSP P VY+ SPPPP +YSP P V           EYKS
Sbjct: 275 PPPVHYSPPPVVYHSPPPPVHYSPPPVVYH-SPPPPVHYSPPPVVYHSPPPPKKHYEYKS 333

Query: 285 PPPPSYSPSPKTEY 326
           PPPP +  SP T Y
Sbjct: 334 PPPPVHY-SPPTVY 346

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/118 (55%), Positives = 65/118 (55%), Gaps = 16/118 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPP 170
           SP   YKSPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPPPP
Sbjct: 106 SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 165

Query: 171 YVYNSPPPPYYSPSPKV-------YYKSPPPP-SYYSPSPKVEYKSPPPP--SYSPSP 314
             Y SPPP Y SP P V        YKSPPPP  YYSP P   YKSPPPP   YSP P
Sbjct: 166 VKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPP--VYKSPPPPVKHYSPPP 221

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 60/106 (56%), Gaps = 8/106 (7%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPPYVYN 182
           +Y SPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPPPP  Y 
Sbjct: 22  FYSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYY 81

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP--SYSPSP 314
           SPPP Y SP P VY   PPP  +YSP P   YKSPPPP   YSP P
Sbjct: 82  SPPPVYKSPPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPP 125

 Score =  109 bits (272), Expect = 1e-22
 Identities = 62/121 (51%), Positives = 68/121 (56%), Gaps = 6/121 (4%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPP 170
           SP   YKSPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPPPP
Sbjct: 122 SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 181

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPLY 350
             + SPPP Y SP P V Y S PPP Y SP P V++ SPPP   SP P  +Y  S  P+Y
Sbjct: 182 VKHYSPPPVYKSPPPPVKYYS-PPPVYKSPPPPVKHYSPPPVYKSPPPPVKY-YSPPPVY 239

Query: 351 E 353
           +
Sbjct: 240 K 240

 Score =  108 bits (271), Expect = 1e-22
 Identities = 68/116 (58%), Positives = 70/116 (60%), Gaps = 14/116 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY--- 173
           SP   YKSPPPP  YYSP P   YKSPP P     PPP   YSP P  VYKSPPPP    
Sbjct: 66  SPPPVYKSPPPPVKYYSPPP--VYKSPPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHY 121

Query: 174 ----VYNSPPPP--YYSPSPKVYYKSPPPP-SYYSPSPKVEYKSPPPP--SYSPSP 314
               VY SPPPP  +YSP P   YKSPPPP  +YSP P   YKSPPPP   YSP P
Sbjct: 122 SPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPP--VYKSPPPPVKYYSPPP 173

 Score =  108 bits (271), Expect = 1e-22
 Identities = 61/123 (49%), Positives = 69/123 (56%), Gaps = 6/123 (4%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPP 164
           ++ P   YKSPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPP
Sbjct: 88  KSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 147

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           PP  + SPPP Y SP P V Y S PPP Y SP P V++ SPPP   SP P  +Y  S  P
Sbjct: 148 PPVKHYSPPPVYKSPPPPVKYYS-PPPVYKSPPPPVKHYSPPPVYKSPPPPVKY-YSPPP 205

Query: 345 LYE 353
           +Y+
Sbjct: 206 VYK 208

 Score =  108 bits (270), Expect = 2e-22
 Identities = 63/111 (56%), Positives = 64/111 (57%), Gaps = 9/111 (8%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPP 170
           SP   YKSPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPPPP
Sbjct: 34  SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 93

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPP-SYYSPSPKVEYKSPPPP--SYSPSP 314
            VY SPPPP    SP   YKSPPPP  +YSP P   YKSPPPP   YSP P
Sbjct: 94  -VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPP 141

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/114 (53%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPP 164
           SP   YKSPPPP  YYSP P   YKSPP P     PPP      PP    SP  VYKSPP
Sbjct: 154 SPPPVYKSPPPPVKYYSPPP--VYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPP 211

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP  + SPPP Y SP P V Y SPPP  Y SP P V Y  PP   +SP P   Y
Sbjct: 212 PPVKHYSPPPVYKSPPPPVKYYSPPPV-YKSPPPPVHYSPPPVVYHSPPPPVHY 264

 Score =  107 bits (268), Expect = 3e-22
 Identities = 61/110 (55%), Positives = 68/110 (61%), Gaps = 9/110 (8%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPH------VCVCPPPPPCYSPSPKVVYKSPPPPY 173
           P VY+  PPP +YSP P VY+  PP  H      V   PPPP  YSP P VVY SPPPP 
Sbjct: 252 PVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSP-PPVVYHSPPPPV 310

Query: 174 VYNSPPPPYYSPSP--KVY-YKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            Y+ PP  Y+SP P  K Y YKSPPPP +YSP P V Y SPPPP +  SP
Sbjct: 311 HYSPPPVVYHSPPPPKKHYEYKSPPPPVHYSP-PTV-YHSPPPPVHHYSP 358

 Score =  100 bits (248), Expect = 7e-20
 Identities = 52/101 (51%), Positives = 59/101 (58%), Gaps = 4/101 (3%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYN 182
           P VY+  PPP +YSP P VY+           PPPP  YSP P VVY SPPPP   Y Y 
Sbjct: 284 PVVYHSPPPPVHYSPPPVVYHS----------PPPPVHYSP-PPVVYHSPPPPKKHYEYK 332

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPK-VEYKSPPPPSY 302
           SPPPP +   P VY+  PPP  +YSP  +   YKSPPPP Y
Sbjct: 333 SPPPPVHYSPPTVYHSPPPPVHHYSPPHQPYLYKSPPPPHY 373

[46][TOP]
>UniRef100_Q9C668 Putative uncharacterized protein F28B23.10 n=1 Tax=Arabidopsis
           thaliana RepID=Q9C668_ARATH
          Length = 478

 Score =  113 bits (282), Expect = 7e-24
 Identities = 70/129 (54%), Positives = 71/129 (55%), Gaps = 28/129 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKSPPPP 170
           P VY   PPPPY      P P VY   PP P+V   PPPPP  YS  P P  VYKSPPPP
Sbjct: 274 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 333

Query: 171 -YVYNSPPPP-------------YYSPSPKVY-YKSPPPPSY-YS--PSPKVEYKSPPPP 296
            YVYNSPPPP             Y SP P  Y YKSPPPP Y YS  P P   YKSPPPP
Sbjct: 334 PYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 393

Query: 297 SY---SPSP 314
            Y   SP P
Sbjct: 394 PYVYSSPPP 402

 Score =  112 bits (280), Expect = 1e-23
 Identities = 69/129 (53%), Positives = 71/129 (55%), Gaps = 28/129 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKSPPPP 170
           P VY   PPPPY      P P VY   PP P++   PPPPP  YS  P P  VYKSPPPP
Sbjct: 74  PYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPP 133

Query: 171 -YVYNSPPPP---YYSPSPKVY-----------YKSPPPPSY-YS--PSPKVEYKSPPPP 296
            YVYNSPPPP   Y SP P  Y           YKSPPPP Y YS  P P   YKSPPPP
Sbjct: 134 PYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 193

Query: 297 SY---SPSP 314
            Y   SP P
Sbjct: 194 PYVYSSPPP 202

 Score =  112 bits (280), Expect = 1e-23
 Identities = 66/119 (55%), Positives = 68/119 (57%), Gaps = 18/119 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKSPPPP 170
           P VY   PPPPY      P P VY   PP P+V   PPPPP  YS  P P  VYKSPPPP
Sbjct: 334 PYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 393

Query: 171 -YVYNSPPPP---YYSPSPKVY-YKSPPPPSYY---SPSPKVEYKSPPPPSY---SPSP 314
            YVY+SPPPP   Y SP P  Y Y SPPPP Y     P P   Y SPPPP Y   SPSP
Sbjct: 394 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSP 452

 Score =  110 bits (276), Expect = 4e-23
 Identities = 69/129 (53%), Positives = 71/129 (55%), Gaps = 28/129 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKSPPPP 170
           P VY   PPPPY      P P VY   PP P+V   PPPPP  YS  P P  VYKSPPPP
Sbjct: 134 PYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 193

Query: 171 -YVYNSPPPP---YYSPSPKVY-----------YKSPPPPSY-YS--PSPKVEYKSPPPP 296
            YVY+SPPPP   Y SP P  Y           YKSPPPP Y YS  P P   YKSPPPP
Sbjct: 194 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 253

Query: 297 SY---SPSP 314
            Y   SP P
Sbjct: 254 PYVYSSPPP 262

 Score =  110 bits (276), Expect = 4e-23
 Identities = 69/129 (53%), Positives = 71/129 (55%), Gaps = 28/129 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKSPPPP 170
           P VY   PPPPY      P P VY   PP P+V   PPPPP  YS  P P  VYKSPPPP
Sbjct: 194 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 253

Query: 171 -YVYNSPPPP---YYSPSPKVY-----------YKSPPPPSY-YS--PSPKVEYKSPPPP 296
            YVY+SPPPP   Y SP P  Y           YKSPPPP Y YS  P P   YKSPPPP
Sbjct: 254 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 313

Query: 297 SY---SPSP 314
            Y   SP P
Sbjct: 314 PYVYSSPPP 322

 Score =  110 bits (274), Expect = 6e-23
 Identities = 67/127 (52%), Positives = 69/127 (54%), Gaps = 27/127 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY-----SPSPKVYYKSPPHPHVCVCPPPPP-----------CYS--PS 137
           P   YKSPPPP Y      PSP VY   PP P+V   PPPPP            YS  P 
Sbjct: 343 PPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 402

Query: 138 PKVVYKSPPPP-YVYNSPPPP---YYSPSPKVY-YKSPPPPSYY----SPSPKVEYKSPP 290
           P  VYKSPPPP YVY+SPPPP   Y SP P  Y Y SPPPP Y     SP P V    PP
Sbjct: 403 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPP 462

Query: 291 PPSYSPS 311
           PPSYS S
Sbjct: 463 PPSYSYS 469

 Score =  108 bits (271), Expect = 1e-22
 Identities = 67/120 (55%), Positives = 69/120 (57%), Gaps = 22/120 (18%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY-YS---PSPKVYYKSPPHPHVCVCPPPPP-----------CYS--PS 137
           SP VY   PPPPY YS   P P VY   PP P+V   PPPPP            YS  P 
Sbjct: 363 SPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 422

Query: 138 PKVVYKS-PPPPYVYNSPPPP---YYSPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPPSY 302
           P  VYKS PPPPYVY+SPPPP   Y SPSP  Y YKSPPPP  YS S    Y SPPPP Y
Sbjct: 423 PPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYS----YSSPPPPIY 478

 Score =  103 bits (257), Expect = 6e-21
 Identities = 59/109 (54%), Positives = 62/109 (56%), Gaps = 14/109 (12%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY---SPSPKVVYKS-PPPPYVYNSPPPP 197
           SPP   Y P   +Y   PP P+V   PPPPP      P P  VY S PPPPY+Y SPPPP
Sbjct: 34  SPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPP 93

Query: 198 ---YYSPSPKVY-YKSPPPPSY-YS--PSPKVEYKSPPPPSY---SPSP 314
              Y SP P  Y YKSPPPP Y YS  P P   YKSPPPP Y   SP P
Sbjct: 94  PYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 142

 Score =  102 bits (255), Expect = 1e-20
 Identities = 61/117 (52%), Positives = 65/117 (55%), Gaps = 16/117 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPK--VYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKS-PPPPY 173
           P   YK P   Y SP P   VY   PP P++   PPPPP  YS  P P  +YKS PPPPY
Sbjct: 36  PSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPY 95

Query: 174 VYNSPPPP---YYSPSPKVY-YKSPPPPSYY---SPSPKVEYKSPPPPSY---SPSP 314
           VY+SPPPP   Y SP P  Y Y SPPPP Y     P P   Y SPPPP Y   SP P
Sbjct: 96  VYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 152

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 54/95 (56%), Positives = 55/95 (57%), Gaps = 13/95 (13%)
 Frame = +3

Query: 69  YYKSPPHPHVCVCPPPPPCYS--PSPKVVYKS-PPPPYVYNSPPPP---YYSPSPKVY-Y 227
           Y  SPP P   V  PP   YS  P P  VY S PPPPY+Y SPPPP   Y SP P  Y Y
Sbjct: 28  YTYSPPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIY 87

Query: 228 KSPPPPSY-YS--PSPKVEYKSPPPPSY---SPSP 314
           KSPPPP Y YS  P P   YKSPPPP Y   SP P
Sbjct: 88  KSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 122

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 39/78 (50%), Positives = 41/78 (52%), Gaps = 18/78 (23%)
 Frame = +3

Query: 135 SPKVVYKSPPPPYV--------YNSPPPP---YYSPSPKVY-YKSPPPPSY-YS--PSPK 269
           S +  Y  P PP          Y+SPPPP   Y SP P  Y YKSPPPP Y YS  P P 
Sbjct: 25  SAQYTYSPPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 84

Query: 270 VEYKSPPPPSY---SPSP 314
             YKSPPPP Y   SP P
Sbjct: 85  YIYKSPPPPPYVYSSPPP 102

[47][TOP]
>UniRef100_Q6GUG3 Serine/proline-rich repeat protein n=2 Tax=Lupinus angustifolius
           RepID=Q6GUG3_LUPAN
          Length = 198

 Score =  113 bits (282), Expect = 7e-24
 Identities = 60/103 (58%), Positives = 62/103 (60%), Gaps = 2/103 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPK--VYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           P  YY+SPPPP  SPSP     YKSPP P      PPPP    SP     SPPPPY+Y S
Sbjct: 41  PSYYYQSPPPPSPSPSPPPPYVYKSPPPPSPS---PPPPYAYKSPPPPSPSPPPPYLYKS 97

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP  SP P    KSPPPPS  SP P   YKSPPPPS SP P
Sbjct: 98  PPPPSPSPPPPYVNKSPPPPS-SSPPPPYIYKSPPPPSPSPPP 139

 Score =  110 bits (274), Expect = 6e-23
 Identities = 59/101 (58%), Positives = 59/101 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P   YKSPP P     PPPP  Y  SP     SPPPPYV  SPP
Sbjct: 59  PPYVYKSPPPPSPSPPPPYAYKSPPPPSPS--PPPPYLYK-SPPPPSPSPPPPYVNKSPP 115

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  SP P   YKSPPPP   SPSP     SPPPPS SP P
Sbjct: 116 PPSSSPPPPYIYKSPPPP---SPSPPPPSPSPPPPSPSPPP 153

 Score =  107 bits (267), Expect = 4e-22
 Identities = 55/101 (54%), Positives = 57/101 (56%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y +  P YY   P  YY+SPP P     PPPP  Y  SP     SPPPPY Y SPPPP  
Sbjct: 29  YNAGQPYYYYQPPSYYYQSPPPPSPSPSPPPPYVYK-SPPPPSPSPPPPYAYKSPPPPSP 87

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           SP P   YKSPPPPS   P P V  KSPPPPS SP P   Y
Sbjct: 88  SPPPPYLYKSPPPPSPSPPPPYVN-KSPPPPSSSPPPPYIY 127

 Score =  102 bits (255), Expect = 1e-20
 Identities = 59/107 (55%), Positives = 60/107 (56%), Gaps = 6/107 (5%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P   YKSPP P     PPP    SP P     SPPPPY+Y SPP
Sbjct: 75  PPYAYKSPPPPSPSPPPPYLYKSPPPPSPSP-PPPYVNKSPPPP--SSSPPPPYIYKSPP 131

Query: 192 PPYYSPSPKVYYKSPPPPS------YYSPSPKVEYKSPPPPSYSPSP 314
           PP  SPSP     SPPPPS        SP P   YKSPPPPS SP P
Sbjct: 132 PP--SPSPPPPSPSPPPPSPSPPPPSPSPPPPYVYKSPPPPSPSPPP 176

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 55/99 (55%), Positives = 55/99 (55%), Gaps = 2/99 (2%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP--PPPPCYSPSPKVVYKSPPPPYVYNS 185
           P    KSPPPP  SP P   YKSPP P     P  P PP  SPSP     SPPPPYVY S
Sbjct: 107 PPYVNKSPPPPSSSPPPPYIYKSPPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPPYVYKS 166

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PPPP  SPSP     SPPPP  Y P     Y SPPPP Y
Sbjct: 167 PPPP--SPSPPPPSPSPPPP--YHP---YLYSSPPPPVY 198

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/110 (50%), Positives = 58/110 (52%), Gaps = 4/110 (3%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPPY + SP     SPP P++   PPPP   SPSP     SPPPP    SP
Sbjct: 97  SPPPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPPPP---SPSPPPPSPSPPPP--SPSP 151

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP----SYSPSPKTEY 326
           PPP  SP P   YKSPPPP   SPSP     SPPPP     YS  P   Y
Sbjct: 152 PPPSPSPPPPYVYKSPPPP---SPSPPPPSPSPPPPYHPYLYSSPPPPVY 198

[48][TOP]
>UniRef100_Q39949 Hydroxyproline-rich protein n=1 Tax=Helianthus annuus
           RepID=Q39949_HELAN
          Length = 263

 Score =  112 bits (281), Expect = 1e-23
 Identities = 64/118 (54%), Positives = 69/118 (58%), Gaps = 8/118 (6%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSP 188
           YKSPPPP  Y SP P VY   PP  H     PPPP +   P  VYKSPPPP   YVY SP
Sbjct: 54  YKSPPPPPVYKSPPPPVYKSPPPPVHKS---PPPPVHKSPPPPVYKSPPPPKKPYVYKSP 110

Query: 189 PPP---YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPLYE 353
           PPP   + SP P VY KSPPPP Y SP P V YKSPPPP Y   P   +     P+Y+
Sbjct: 111 PPPPPVHKSPPPPVY-KSPPPPVYESPPPPV-YKSPPPPVYKSPPPPVHKSPPPPVYK 166

 Score =  111 bits (277), Expect = 3e-23
 Identities = 63/119 (52%), Positives = 65/119 (54%), Gaps = 14/119 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPK---VVYKSPPPPY--- 173
           P   YKSPPPP Y   P   +KSPP P V   PPPP   SP P     VYKSPPPP    
Sbjct: 59  PPPVYKSPPPPVYKSPPPPVHKSPPPP-VHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVH 117

Query: 174 ------VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS--PSPKTEY 326
                 VY SPPPP Y   P   YKSPPPP Y SP P V +KSPPPP Y   P PK  Y
Sbjct: 118 KSPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPPPPV-HKSPPPPVYKSPPPPKKPY 175

 Score =  110 bits (276), Expect = 4e-23
 Identities = 55/102 (53%), Positives = 61/102 (59%), Gaps = 4/102 (3%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVC----PPPPPCYSPSPKVVYKSPPPP 170
           ++ P   +KSPPPP +   P   YKSPP P         PPPPP +   P  VYKSPPPP
Sbjct: 72  KSPPPPVHKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPPPP 131

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            VY SPPPP Y   P   YKSPPPP + SP P V YKSPPPP
Sbjct: 132 -VYESPPPPVYKSPPPPVYKSPPPPVHKSPPPPV-YKSPPPP 171

 Score =  107 bits (268), Expect = 3e-22
 Identities = 56/105 (53%), Positives = 62/105 (59%), Gaps = 7/105 (6%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYS--PSPK--VYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           ++ P   +KSPPPP Y   P PK    YKSPP P      PPPP Y   P  VY+SPPPP
Sbjct: 80  KSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPP 139

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVE---YKSPPPP 296
            VY SPPPP Y   P   +KSPPPP Y SP P  +   YKSPPPP
Sbjct: 140 -VYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPP 183

 Score =  104 bits (260), Expect = 3e-21
 Identities = 59/116 (50%), Positives = 64/116 (55%), Gaps = 18/116 (15%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---Y 173
           ++ P   YKSPPPP Y   P   YKSPP P      PPPP +   P  VYKSPPPP   Y
Sbjct: 118 KSPPPPVYKSPPPPVYESPPPPVYKSPPPP--VYKSPPPPVHKSPPPPVYKSPPPPKKPY 175

Query: 174 VYNSPPPP---YYSPSPKVY-------YKSPPPPSYYSP-----SPKVEYKSPPPP 296
           VY SPPPP   + SP P VY       +KSPP P Y SP     SP   YKSPPPP
Sbjct: 176 VYKSPPPPPPVHKSPPPPVYKSPTPPVHKSPPHPVYKSPLPVHKSPPPVYKSPPPP 231

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 58/120 (48%), Positives = 65/120 (54%), Gaps = 9/120 (7%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHP----HVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           +Y SPPPP     PK   KSPP P    +V   PPPPP Y   P  VYKSPPPP V+ SP
Sbjct: 31  HYSSPPPP----PPK---KSPPPPPKQQYVYKSPPPPPVYKSPPPPVYKSPPPP-VHKSP 82

Query: 189 PPPYYSPSPKVYYKSPPPPS----YYSPSPKVE-YKSPPPPSYSPSPKTEY*ISRLPLYE 353
           PPP +   P   YKSPPPP     Y SP P    +KSPPPP Y   P   Y     P+Y+
Sbjct: 83  PPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPPVYK 142

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 53/114 (46%), Positives = 61/114 (53%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   +KSPPPP Y   P   Y+SPP P      PPPP Y   P  V+KSPPPP VY SPP
Sbjct: 113 PPPVHKSPPPPVYKSPPPPVYESPPPP--VYKSPPPPVYKSPPPPVHKSPPPP-VYKSPP 169

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPLYE 353
           PP     P VY   PPPP  +   P   YKSP PP +   P   Y  S LP+++
Sbjct: 170 PP---KKPYVYKSPPPPPPVHKSPPPPVYKSPTPPVHKSPPHPVY-KSPLPVHK 219

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 54/119 (45%), Positives = 59/119 (49%), Gaps = 21/119 (17%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVC----PPPPPCYSPSPKVVYKSPPPP 170
           ++ P   YKSPPPP +   P   YKSPP P         PPPPP +   P  VYKSP PP
Sbjct: 142 KSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPTPP 201

Query: 171 Y--------------VYNSPPPPYYSPSP--KVY-YKSPPPPSYYSPSPKVEYKSPPPP 296
                          V+ SPPP Y SP P  K Y YKSPPPP    P P   Y SPPPP
Sbjct: 202 VHKSPPHPVYKSPLPVHKSPPPVYKSPPPPKKPYVYKSPPPPVKKHPPPHYIYSSPPPP 260

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/108 (49%), Positives = 57/108 (52%), Gaps = 13/108 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY----SPSPKVVYKSPPPPYVY 179
           P   YKSPPPP Y   P   +KSPP P     PPP   Y     P P  V+KSPPPP VY
Sbjct: 137 PPPVYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPP-VY 195

Query: 180 NSPPPPYYSPSPKVYYKSP------PPPSYYSPSPKVE---YKSPPPP 296
            SP PP +   P   YKSP      PPP Y SP P  +   YKSPPPP
Sbjct: 196 KSPTPPVHKSPPHPVYKSPLPVHKSPPPVYKSPPPPKKPYVYKSPPPP 243

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 47/84 (55%), Positives = 51/84 (60%), Gaps = 3/84 (3%)
 Frame = +3

Query: 54  PSPKV---YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVY 224
           PSP     +Y SPP P     PPPPP      + VYKSPPPP VY SPPPP Y   P   
Sbjct: 23  PSPTTATYHYSSPPPPPPKKSPPPPP----KQQYVYKSPPPPPVYKSPPPPVYKSPPPPV 78

Query: 225 YKSPPPPSYYSPSPKVEYKSPPPP 296
           +KSPPPP + SP P V YKSPPPP
Sbjct: 79  HKSPPPPVHKSPPPPV-YKSPPPP 101

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/86 (54%), Positives = 53/86 (61%), Gaps = 5/86 (5%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY-SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVY 179
           P   +KSPPPP Y SP+P V+ KSPPHP   V   P P +  SP  VYKSPPPP   YVY
Sbjct: 183 PPPVHKSPPPPVYKSPTPPVH-KSPPHP---VYKSPLPVHK-SPPPVYKSPPPPKKPYVY 237

Query: 180 NSPPPPYYS-PSPKVYYKSPPPPSYY 254
            SPPPP    P P   Y SPPPP ++
Sbjct: 238 KSPPPPVKKHPPPHYIYSSPPPPYHH 263

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 51/99 (51%), Positives = 55/99 (55%), Gaps = 7/99 (7%)
 Frame = +3

Query: 51  SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSPPPP--YYSPSP 215
           SP+   Y+ S P       PPPPP  SP        PPPP   YVY SPPPP  Y SP P
Sbjct: 24  SPTTATYHYSSP-------PPPPPKKSP--------PPPPKQQYVYKSPPPPPVYKSPPP 68

Query: 216 KVYYKSPPPPSYYSPSPKVEYKSPPPPSYS--PSPKTEY 326
            V YKSPPPP + SP P V +KSPPPP Y   P PK  Y
Sbjct: 69  PV-YKSPPPPVHKSPPPPV-HKSPPPPVYKSPPPPKKPY 105

[49][TOP]
>UniRef100_Q9M6R7 Extensin n=1 Tax=Pisum sativum RepID=Q9M6R7_PEA
          Length = 327

 Score =  112 bits (280), Expect = 1e-23
 Identities = 63/113 (55%), Positives = 69/113 (61%), Gaps = 15/113 (13%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS---PSPKVVYK--SPPPP-YVYN 182
           YY+SPPPP +SP P  +Y SPP P     PPPP  YS   P PK  YK  SPPPP Y Y 
Sbjct: 41  YYQSPPPPVHSPPPPYHYSSPPPP--VHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYK 98

Query: 183 SPPPPYYSPSPKVYYKSPPPP-----SYYSPSPKV-EYKSPPPPSY---SPSP 314
           SPPPP +SP P  +Y SPPPP      Y SP P V +YKSPPPP Y   SP P
Sbjct: 99  SPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPP 151

 Score =  111 bits (278), Expect = 2e-23
 Identities = 66/131 (50%), Positives = 69/131 (52%), Gaps = 30/131 (22%)
 Frame = +3

Query: 12  PKVY-YKSPPPP-----YYSPSPKVYYKSPPHPHVCVCPPPPPC-YSPSPKVVYK--SPP 164
           P VY Y+SPPPP     Y SP P VY KSPP P+    PPPPP  YS  P  VYK  SPP
Sbjct: 184 PPVYKYQSPPPPKKSYKYPSPPPPVY-KSPPPPYKYQSPPPPPYKYSSPPPPVYKYNSPP 242

Query: 165 PPYVYNSPP---------------------PPYYSPSPKVYYKSPPPPSYYSPSPKVEYK 281
           PPY + SPP                     PP YSP P   YKSPPPP Y  P P   Y 
Sbjct: 243 PPYKHISPPTPGKPFKFPPPPTPIYKYKSPPPVYSPPPVYKYKSPPPPVYSPPPPHYVYS 302

Query: 282 SPPPPSYSPSP 314
           SPPPP YSP P
Sbjct: 303 SPPPPVYSPPP 313

 Score =  109 bits (272), Expect = 1e-22
 Identities = 72/156 (46%), Positives = 73/156 (46%), Gaps = 55/156 (35%)
 Frame = +3

Query: 12  PKVY-YKSPPPP------YYSPSPKVY-YKSPPHPHVCVCPPPPPCYS----PSPK---- 143
           P VY YKSPPPP      Y SP P VY YKSPP P      PPPP Y     P PK    
Sbjct: 141 PPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYQSPPPPKKSYK 200

Query: 144 ------VVYKSPPPPYVYNSPPPP---YYSPSPKVY-YKSPP------------------ 239
                  VYKSPPPPY Y SPPPP   Y SP P VY Y SPP                  
Sbjct: 201 YPSPPPPVYKSPPPPYKYQSPPPPPYKYSSPPPPVYKYNSPPPPYKHISPPTPGKPFKFP 260

Query: 240 -----------PPSYYSPSPKVEYKSPPPPSYSPSP 314
                      PP  YSP P  +YKSPPPP YSP P
Sbjct: 261 PPPTPIYKYKSPPPVYSPPPVYKYKSPPPPVYSPPP 296

 Score =  107 bits (266), Expect = 5e-22
 Identities = 66/128 (51%), Positives = 69/128 (53%), Gaps = 23/128 (17%)
 Frame = +3

Query: 12  PKVYYKSPPPP------YYSPSPKVY-YKSPPHPHVCVCPPPPPC-----YS--PSPKVV 149
           P  +Y SPPPP      Y SP P VY YKSPP P      PPPP      YS  P P   
Sbjct: 109 PPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYK 168

Query: 150 YKSPPPP-YVYNSPPPPYYS----PSPKVYYK--SPPPPSYYSPSPKVEYKSPPPP--SY 302
           YKSPPPP Y Y SPPPP Y     P PK  YK  SPPPP Y SP P  +Y+SPPPP   Y
Sbjct: 169 YKSPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPPYKYQSPPPPPYKY 228

Query: 303 SPSPKTEY 326
           S  P   Y
Sbjct: 229 SSPPPPVY 236

 Score =  106 bits (264), Expect = 9e-22
 Identities = 66/126 (52%), Positives = 71/126 (56%), Gaps = 23/126 (18%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSP-----KVY-YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP 167
           +SP     SPPPPY+  SP     K Y Y SPP P      PPPP +SP P   Y SPPP
Sbjct: 59  SSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPP 118

Query: 168 P----YVYNSPPPPYY---SPSPKVY-YKSPPPP-----SYYSPSPKV-EYKSPPPPSY- 302
           P    Y Y+SPPPP Y   SP P VY YKSPPPP      Y SP P V +YKSPPPP Y 
Sbjct: 119 PPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPPPPVYK 178

Query: 303 --SPSP 314
             SP P
Sbjct: 179 YKSPPP 184

 Score =  105 bits (261), Expect = 2e-21
 Identities = 64/119 (53%), Positives = 69/119 (57%), Gaps = 18/119 (15%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYYSPSPKVYYKSPPHP---HVCVCPPPPPCYSPSPKVVYKSPPPP-YV 176
           P +Y YKSPPPP +SP P  +Y SPP P         PPPP Y       YKSPPPP Y 
Sbjct: 92  PPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYK------YKSPPPPVYK 145

Query: 177 YNSPPPP------YYSPSPKVY-YKSPPPP--SYYSPSPKV-EYKSPPPPSYS---PSP 314
           Y SPPPP      Y SP P VY YKSPPPP   Y SP P V +Y+SPPPP  S   PSP
Sbjct: 146 YKSPPPPVKKPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSP 204

 Score =  103 bits (258), Expect = 5e-21
 Identities = 68/152 (44%), Positives = 76/152 (50%), Gaps = 38/152 (25%)
 Frame = +3

Query: 12  PKVYY--------KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP----CYSPSPKVVYK 155
           PK YY         SPPPPY+  SP     SPP P+    PPPPP     YS  P  +YK
Sbjct: 37  PKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYK 96

Query: 156 ---------SPPPPYVYNSPPPP------YYSPSPKVY-YKSPPPP--SYYSPSPKV--- 272
                    SPPPPY Y+SPPPP      Y SP P VY YKSPPPP   Y SP P V   
Sbjct: 97  YKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKP 156

Query: 273 -EYKSPPPPSYS----PSPKTEY*ISRLPLYE 353
            +Y SPPPP Y     P P  +Y     P+Y+
Sbjct: 157 YKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYK 188

 Score =  102 bits (255), Expect = 1e-20
 Identities = 56/111 (50%), Positives = 61/111 (54%), Gaps = 16/111 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPKVY-YKSPPHPHVCVCPPPPPC---YSPSPKVVYK----- 155
           P   Y+SPPPP   Y SP P VY Y SPP P+  + PP P     + P P  +YK     
Sbjct: 214 PPYKYQSPPPPPYKYSSPPPPVYKYNSPPPPYKHISPPTPGKPFKFPPPPTPIYKYKSPP 273

Query: 156 ---SPPPPYVYNSPPPPYYSPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPP 296
              SPPP Y Y SPPPP YSP P  Y Y SPPPP Y  P P   Y SPPPP
Sbjct: 274 PVYSPPPVYKYKSPPPPVYSPPPPHYVYSSPPPPVYSPPPPHYIYASPPPP 324

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 47/91 (51%), Positives = 53/91 (58%), Gaps = 6/91 (6%)
 Frame = +3

Query: 72  YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP-- 245
           Y SPP       PPP P Y  SP     SPPPPY Y+SPPPP +SP P  +Y SPPPP  
Sbjct: 30  YSSPP-------PPPKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPK 82

Query: 246 ---SYYSPSPKV-EYKSPPPPSYSPSPKTEY 326
               Y SP P + +YKSPPPP +SP P   Y
Sbjct: 83  KSYKYSSPPPPIYKYKSPPPPVHSPPPPYHY 113

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 45/82 (54%), Positives = 48/82 (58%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           +P   YKSPPP  YSP P   YKSPP P   V  PPPP Y      VY SPPPP VY SP
Sbjct: 264 TPIYKYKSPPP-VYSPPPVYKYKSPPPP---VYSPPPPHY------VYSSPPPP-VY-SP 311

Query: 189 PPPYYSPSPKVYYKSPPPPSYY 254
           PPP+Y       Y SPPPP +Y
Sbjct: 312 PPPHY------IYASPPPPYHY 327

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 27/52 (51%), Positives = 31/52 (59%)
 Frame = +3

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           Y+Y+SPPPP     PK YY   PPP  +SP P   Y SPPPP +SP P   Y
Sbjct: 28  YLYSSPPPP-----PKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHY 74

[50][TOP]
>UniRef100_Q9C669 Putative uncharacterized protein F28B23.9 n=1 Tax=Arabidopsis
           thaliana RepID=Q9C669_ARATH
          Length = 443

 Score =  112 bits (280), Expect = 1e-23
 Identities = 69/122 (56%), Positives = 71/122 (58%), Gaps = 16/122 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYS---PSPKVYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKSPPPP 170
           SP  Y   PPP  YS   P P VY   PP P+V   PPPPP  YS  P P  VYKSPPPP
Sbjct: 54  SPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPP 113

Query: 171 -YVYNSPPPP---YYSPSPKVY-YKSPPPPSY-YS--PSPKVEYKSPPPPSY--SPSPKT 320
            YVY+SPPPP   Y SP P  Y Y SPPPP Y YS  P P   YKSPPPP Y  SP P  
Sbjct: 114 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPP 173

Query: 321 EY 326
            Y
Sbjct: 174 PY 175

 Score =  110 bits (276), Expect = 4e-23
 Identities = 67/119 (56%), Positives = 69/119 (57%), Gaps = 18/119 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKSPPPP 170
           P VY   PPPPY      P P VY   PP P+V   PPPPP  YS  P P  VYKSPPPP
Sbjct: 204 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 263

Query: 171 -YVYNSPPPP---YYSPSPKVY-YKSPPPPSY-YS--PSPKVEYKSPPPPSY---SPSP 314
            YVY+SPPPP   Y SP P  Y Y SPPPP Y YS  P P   Y SPPPP Y   SP P
Sbjct: 264 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 322

 Score =  110 bits (275), Expect = 5e-23
 Identities = 69/129 (53%), Positives = 71/129 (55%), Gaps = 28/129 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKSPPPP 170
           P VY   PPPPY      P P VY   PP P+V   PPPPP  YS  P P  VYKSPPPP
Sbjct: 144 PYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPP 203

Query: 171 -YVYNSPPPP---YYSPSPKVY-----------YKSPPPPSY-YS--PSPKVEYKSPPPP 296
            YVY+SPPPP   Y SP P  Y           YKSPPPP Y YS  P P   YKSPPPP
Sbjct: 204 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 263

Query: 297 SY---SPSP 314
            Y   SP P
Sbjct: 264 PYVYSSPPP 272

 Score =  110 bits (274), Expect = 6e-23
 Identities = 64/119 (53%), Positives = 65/119 (54%), Gaps = 18/119 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKSPPPP 170
           P VY   PPPPY      P P VY   PP P+V   PPPPP  YS  P P  VY SPPPP
Sbjct: 94  PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPP 153

Query: 171 -YVYNSPPPPYY-----SPSPKVYYKSPPPPSYYS--PSPKVEYKSPPPPSY---SPSP 314
            YVY SPPPP Y      P P VY   PPPP  YS  P P   YKSPPPP Y   SP P
Sbjct: 154 PYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 212

 Score =  106 bits (264), Expect = 9e-22
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 10/111 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PP  Y SPSP  Y   PP P++   PPPPP    SP      PPPPYVYNSPP
Sbjct: 39  PYVYNSPPPYVYNSPSPPPYVYKPP-PYIYSSPPPPPYVYSSP------PPPPYVYNSPP 91

Query: 192 PP---YYSPSPKVY-YKSPPPPSY-YS--PSPKVEYKSPPPPSY---SPSP 314
           PP   Y SP P  Y YKSPPPP Y YS  P P   YKSPPPP Y   SP P
Sbjct: 92  PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 142

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 59/121 (48%), Positives = 60/121 (49%), Gaps = 20/121 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-YS---PSPKVYYKSPPHPHVCVCPPPPPCY---SPSPKVVYKSPPPP 170
           P VY   PPPPY YS   P P VY   PP P+V   PPPPP      P P  VYKSPPPP
Sbjct: 284 PYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPP 343

Query: 171 ------------YVYNSPPPPYYSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSYSPS 311
                       YVY  PPP  Y P P VY  SPPP  Y Y P P V   SPPP  Y   
Sbjct: 344 PYVDSYSPPPAPYVY-KPPPYVYKPPPYVYNYSPPPAPYVYKPPPYVYSYSPPPAPYVYK 402

Query: 312 P 314
           P
Sbjct: 403 P 403

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 67/142 (47%), Positives = 68/142 (47%), Gaps = 29/142 (20%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCPPPPP---CYSPSPK-VVYKSPPP 167
           P VY   PPPPY      P P VY   PP P+V   PPPPP    YSP P   VYK  PP
Sbjct: 304 PYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYK--PP 361

Query: 168 PYVYN--------SPPP-PY-YSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSY---- 302
           PYVY         SPPP PY Y P P VY  SPPP  Y Y P P V   SPPP  Y    
Sbjct: 362 PYVYKPPPYVYNYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYKP 421

Query: 303 ------SPSPKTEY*ISRLPLY 350
                 SPSP   Y     PLY
Sbjct: 422 PPYVYSSPSPPPYYSSPSPPLY 443

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 44/75 (58%), Positives = 45/75 (60%), Gaps = 7/75 (9%)
 Frame = +3

Query: 111 PPPPCYSPSPKVVYKSPPPPYVYNSP-PPPY-YSPSPKVYYKSPPPPSYYS--PSPKVEY 278
           P P  YSP P  VY SPPP YVYNSP PPPY Y P P +Y   PPPP  YS  P P   Y
Sbjct: 29  PTPTPYSPLPPYVYNSPPP-YVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVY 87

Query: 279 KSPPPPSY---SPSP 314
            SPPPP Y   SP P
Sbjct: 88  NSPPPPPYVYSSPPP 102

[51][TOP]
>UniRef100_Q40768 Extensin n=1 Tax=Prunus dulcis RepID=Q40768_PRUDU
          Length = 278

 Score =  112 bits (280), Expect = 1e-23
 Identities = 65/117 (55%), Positives = 69/117 (58%), Gaps = 11/117 (9%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPK--VVYKSPPP----- 167
           SP  +YKSPPPP  SP+P V+Y  P HP+    PPPP  YSP PK    YKSPPP     
Sbjct: 43  SPPYHYKSPPPP--SPTPPVHYSPPKHPYHYKSPPPPVHYSP-PKHPYHYKSPPPPVYSP 99

Query: 168 ---PYVYNSPPPPYYSPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
              PY Y SPPPP  SP    Y YKSPPPPS   P     YKSPPPPS SP PK  Y
Sbjct: 100 PKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSP-PKHPY 155

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 59/116 (50%), Positives = 62/116 (53%), Gaps = 18/116 (15%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVY-YKSPP--------HPHVCVCPPPPPCYSPSPKVVYKSPPP-- 167
           +YKSPPPP YSP    Y YKSPP        HP+    PPPP    P     YKSPPP  
Sbjct: 88  HYKSPPPPVYSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPS 147

Query: 168 ------PYVYNSPPPPYYSPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                 PY Y SPPPP  SP    Y YKSPPPPS   P     YKSPPPP  SP+P
Sbjct: 148 PSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPS--PPKKPYHYKSPPPPP-SPTP 200

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 58/117 (49%), Positives = 61/117 (52%), Gaps = 19/117 (16%)
 Frame = +3

Query: 21  YYKSPPPP-YYSPSPKVY-YKSPP--------HPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           +YKSPPPP +YSP    Y YKSPP        HP+    PPPP    P     YKSPPPP
Sbjct: 70  HYKSPPPPVHYSPPKHPYHYKSPPPPVYSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPP 129

Query: 171 --------YVYNSPPPPYYSPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                   Y Y SPPPP  SP    Y YKSPPPPS   P     YKSPPPPS    P
Sbjct: 130 SPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPPKKP 186

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 61/128 (47%), Positives = 65/128 (50%), Gaps = 30/128 (23%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVY-YKSPP--------HPHVCVCPPPPPCYSPSPKVVYKSPPP-- 167
           +YKSPPPP  SP    Y YKSPP        HP+    PPPP    P     YKSPPP  
Sbjct: 122 HYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPS 181

Query: 168 ----PYVYNSPPPPYYSPSPKVY--------YKSPPPPSYYSPSPKVEYKSPPPPS---- 299
               PY Y SPPPP  SP+P VY        YKSPPPPS   P     YKSPPPP+    
Sbjct: 182 PPKKPYHYKSPPPP-PSPTPPVYSPPKHPYHYKSPPPPS--PPKKPYHYKSPPPPTPVYK 238

Query: 300 ---YSPSP 314
              YSP P
Sbjct: 239 PPVYSPPP 246

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 57/114 (50%), Positives = 63/114 (55%), Gaps = 16/114 (14%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVY-YKSPP------HPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           +YKSPPPP  SP    Y YKSPP       P+    PPPPP  SP+P V Y  P  PY Y
Sbjct: 156 HYKSPPPPSPSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPP--SPTPPV-YSPPKHPYHY 212

Query: 180 NSPPPPYYSPSPKVY-YKSPPPPS------YYS--PSPKVEYKSPPPPSYSPSP 314
            SPPPP  SP  K Y YKSPPPP+       YS  P PK  YK P PP ++  P
Sbjct: 213 KSPPPP--SPPKKPYHYKSPPPPTPVYKPPVYSPPPPPKKPYKPPTPPVHTAPP 264

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 56/112 (50%), Positives = 60/112 (53%), Gaps = 18/112 (16%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK--VVYKSPPP------PY 173
           +YKSPPPP  SP  K Y YKSPP P      P PP YSP PK    YKSPPP      PY
Sbjct: 173 HYKSPPPP--SPPKKPYHYKSPPPPP----SPTPPVYSP-PKHPYHYKSPPPPSPPKKPY 225

Query: 174 VYNSPP-------PPYYS--PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
            Y SPP       PP YS  P PK  YK P PP + +P     Y SPPPP +
Sbjct: 226 HYKSPPPPTPVYKPPVYSPPPPPKKPYKPPTPPVHTAPPHPYIYSSPPPPHH 277

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/110 (46%), Positives = 54/110 (49%), Gaps = 9/110 (8%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y SPPPP    SP  +YKSPP P            SP+P V Y  P  PY Y SPPPP  
Sbjct: 35  YSSPPPPV---SPPYHYKSPPPP------------SPTPPVHYSPPKHPYHYKSPPPP-- 77

Query: 204 SPSPKV---------YYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                V         +YKSPPPP Y  P     YKSPPPPS SP PK  Y
Sbjct: 78  -----VHYSPPKHPYHYKSPPPPVYSPPKHPYHYKSPPPPSPSP-PKHPY 121

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 36/74 (48%), Positives = 39/74 (52%), Gaps = 22/74 (29%)
 Frame = +3

Query: 171 YVYNSPPPP------YYSPSP--------------KVYYKSPPPPSYYSPSPK--VEYKS 284
           Y Y+SPPPP      Y SP P                +YKSPPPP +YSP PK    YKS
Sbjct: 33  YPYSSPPPPVSPPYHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPVHYSP-PKHPYHYKS 91

Query: 285 PPPPSYSPSPKTEY 326
           PPPP YSP PK  Y
Sbjct: 92  PPPPVYSP-PKHPY 104

[52][TOP]
>UniRef100_Q01945 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01945_SOLLC
          Length = 90

 Score =  112 bits (280), Expect = 1e-23
 Identities = 58/95 (61%), Positives = 60/95 (63%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPPY   SP     SPP P+V   PPPP     SP     SPPPPYVY SPPPP +SP
Sbjct: 5   SPPPPYVYKSPPPPSPSPPPPYVYKSPPPP-----SP-----SPPPPYVYKSPPPPSHSP 54

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P  YYKSPPPPS  SP P   YKSPPPPS SP P
Sbjct: 55  PPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPP 88

 Score =  101 bits (251), Expect = 3e-20
 Identities = 52/95 (54%), Positives = 52/95 (54%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP  SP P   YKSPP P      PPPP    SP     SPPPPY Y SPP
Sbjct: 8   PPYVYKSPPPPSPSPPPPYVYKSPPPPSPS---PPPPYVYKSPPPPSHSPPPPYYYKSPP 64

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
           PP  SP P  YYKSPPPPS           SPPPP
Sbjct: 65  PPSPSPPPPYYYKSPPPPS----------PSPPPP 89

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 53/91 (58%), Positives = 55/91 (60%)
 Frame = +3

Query: 54  PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKS 233
           PSP     SPP P+V   PPPP     SP     SPPPPYVY SPPPP  SP P   YKS
Sbjct: 2   PSP-----SPPPPYVYKSPPPP-----SP-----SPPPPYVYKSPPPPSPSPPPPYVYKS 46

Query: 234 PPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPPPS+ SP P   YKSPPPPS SP P   Y
Sbjct: 47  PPPPSH-SPPPPYYYKSPPPPSPSPPPPYYY 76

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/63 (57%), Positives = 37/63 (58%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   YKSPPPP +SP P  YYKSPP P      PPPP Y       YKSPPPP    SPP
Sbjct: 40  PPYVYKSPPPPSHSPPPPYYYKSPPPPSPS---PPPPYY-------YKSPPPP--SPSPP 87

Query: 192 PPY 200
           PPY
Sbjct: 88  PPY 90

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 32/56 (57%), Positives = 32/56 (57%)
 Frame = +3

Query: 159 PPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP P    SPPPPY        YKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 1   PPSP----SPPPPYV-------YKSPPPPS-PSPPPPYVYKSPPPPSPSPPPPYVY 44

[53][TOP]
>UniRef100_Q8H9E0 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Solanum
           tuberosum RepID=Q8H9E0_SOLTU
          Length = 217

 Score =  112 bits (279), Expect = 2e-23
 Identities = 74/139 (53%), Positives = 78/139 (56%), Gaps = 25/139 (17%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYYS-----PSPKVY-YKSPPHP--HVCVCPPPPPCYS----PSPKVVY 152
           P VY YKSPPPP Y      P P VY YKSPP P       PPPPP Y     P P   Y
Sbjct: 21  PPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKY 80

Query: 153 KSPPPP-YVYNSPPPPYY---SPSPKVY-YKSPPPP--SYYSPSPKV-EYKSPPPPSYS- 305
           KSPPPP Y Y SPPPP Y   SP P VY YKSPPPP   Y SP P V +YKSPPPP Y  
Sbjct: 81  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKY 140

Query: 306 ---PSPKTEY*ISRLPLYE 353
              P P  +Y     P+Y+
Sbjct: 141 KSPPPPVYKYKSPPPPVYK 159

 Score =  111 bits (277), Expect = 3e-23
 Identities = 66/113 (58%), Positives = 69/113 (61%), Gaps = 16/113 (14%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPP 164
           P VY YKSPPPP Y   SP P VY YKSPP P      PPPP Y     P P   YKSPP
Sbjct: 105 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 164

Query: 165 PP---YVYNSPPPPYY---SPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PP   Y Y SPPPP Y   SP P VY YKSPPPP + SP+P   Y SPPPPS+
Sbjct: 165 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAP-YYYTSPPPPSH 216

 Score =  109 bits (273), Expect = 8e-23
 Identities = 74/141 (52%), Positives = 78/141 (55%), Gaps = 27/141 (19%)
 Frame = +3

Query: 12  PKVY-YKSPPPP-----YYSPSPKVY-YKSPPHPHVC--VCPPPPPCYS------PSPKV 146
           P VY YKSPPPP     Y SP P VY YKSPP P        PPPP Y       P P  
Sbjct: 9   PPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVY 68

Query: 147 VYKSPPPP-YVYNSPPPPYY---SPSPKVY-YKSPPPP--SYYSPSPKV-EYKSPPPPSY 302
            YKSPPPP Y Y SPPPP Y   SP P VY YKSPPPP   Y SP P V +YKSPPPP Y
Sbjct: 69  KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 128

Query: 303 S----PSPKTEY*ISRLPLYE 353
                P P  +Y     P+Y+
Sbjct: 129 KYKSPPPPVYKYKSPPPPVYK 149

 Score =  109 bits (272), Expect = 1e-22
 Identities = 72/123 (58%), Positives = 73/123 (59%), Gaps = 22/123 (17%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPP 164
           P VY YKSPPPP Y   SP P VY YKSPP P      PPPP Y     P P   YKSPP
Sbjct: 75  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 134

Query: 165 PP-YVYNSPPPP-Y--YSPSPKVY-YKSPPPP----SYYSPSPKV-EYKSPPPPSY---S 305
           PP Y Y SPPPP Y   SP P VY YKSPPPP     Y SP P V +YKSPPPP Y   S
Sbjct: 135 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 194

Query: 306 PSP 314
           P P
Sbjct: 195 PPP 197

 Score =  108 bits (269), Expect = 2e-22
 Identities = 67/118 (56%), Positives = 70/118 (59%), Gaps = 17/118 (14%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPP 164
           P VY YKSPPPP Y   SP P VY YKSPP P      PPPP Y     P P   YKSPP
Sbjct: 95  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 154

Query: 165 PP-YVYNSPPPP-----YYSPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPPSY-SPSP 314
           PP Y Y SPPPP     Y SP P VY YKSPPPP Y       +YKSPPPP + SP+P
Sbjct: 155 PPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVY-------KYKSPPPPVHKSPAP 205

 Score =  100 bits (250), Expect = 4e-20
 Identities = 69/132 (52%), Positives = 74/132 (56%), Gaps = 22/132 (16%)
 Frame = +3

Query: 24  YKSPPPPYYS-----PSPKVY-YKSPPHP-HVCVCPPPPPCYSPSPKVVYKSPPPPYVY- 179
           YKSPPPP Y      P P VY YKSPP P +    PPPPP     P   YKSPPPP VY 
Sbjct: 4   YKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPP-----PVYKYKSPPPP-VYK 57

Query: 180 -NSPPPP-----YYSPSPKVY-YKSPPPP--SYYSPSPKV-EYKSPPPPSYS----PSPK 317
             SPPPP     Y SP P VY YKSPPPP   Y SP P V +YKSPPPP Y     P P 
Sbjct: 58  YKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV 117

Query: 318 TEY*ISRLPLYE 353
            +Y     P+Y+
Sbjct: 118 YKYKSPPPPVYK 129

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/93 (56%), Positives = 55/93 (59%), Gaps = 12/93 (12%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYY---SPSPKVY-YKSPPHP--HVCVCPPPPPCYS----PSPKVVYKS 158
           P VY YKSPPPP Y   SP P VY YKSPP P       PPPPP Y     P P   YKS
Sbjct: 125 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKS 184

Query: 159 PPPP-YVYNSPPPPYYSPSPKVYYKSPPPPSYY 254
           PPPP Y Y SPPPP +      YY SPPPPS+Y
Sbjct: 185 PPPPVYKYKSPPPPVHKSPAPYYYTSPPPPSHY 217

[54][TOP]
>UniRef100_Q9FSG1 Putative extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG1_NICSY
          Length = 311

 Score =  111 bits (277), Expect = 3e-23
 Identities = 71/121 (58%), Positives = 71/121 (58%), Gaps = 20/121 (16%)
 Frame = +3

Query: 12  PKVY-YKSPPPP---YYSPSPKVY-YKSPPHP--HVCVCPPPPPCYS--PSPKVVYKSPP 164
           P VY YKSPPPP   Y SP P VY YKSPP P       PPPPP Y   P P   YKSPP
Sbjct: 47  PPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPP 106

Query: 165 PP-YVYNSPPPP---YYSPSPKVY-YKSPPPPSY---YSPSPKVEYKSPPPPSY---SPS 311
           PP Y Y SPPPP   Y SP P VY YKSPPPP Y     P P   YKSPPPP Y   SP 
Sbjct: 107 PPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPP 166

Query: 312 P 314
           P
Sbjct: 167 P 167

 Score =  108 bits (271), Expect = 1e-22
 Identities = 70/134 (52%), Positives = 75/134 (55%), Gaps = 20/134 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYS----PSPKVVYKS-PP 164
           P   Y+SPPPP Y   SP P VY YKSPP P      PPPP Y     P P   YKS PP
Sbjct: 58  PLPIYRSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPP 117

Query: 165 PPYVYNSPPPPYY---SPSPKVY-YKSPPPPS--YYSPSPKV-EYKSPPPP----SYSPS 311
           PP VY SPPPP Y   SP P VY YKSPPPP   Y SP P V +YKSPPPP       P 
Sbjct: 118 PPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPP 177

Query: 312 PKTEY*ISRLPLYE 353
           P  +Y     P+Y+
Sbjct: 178 PIYKYKSPPPPVYK 191

 Score =  108 bits (271), Expect = 1e-22
 Identities = 69/146 (47%), Positives = 74/146 (50%), Gaps = 32/146 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYS--------------PS 137
           P   YKSPPPP Y   SP P VY YKSPP P      PPPP Y               P 
Sbjct: 88  PPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPP 147

Query: 138 PKVVYKSPPPP-YVYNSPPPP---YYSPSPKVY-YKSPPPPSY---YSPSPKVEYKSPPP 293
           P  VYKSPPPP Y Y SPPPP   + SP P +Y YKSPPPP Y     P P   YKSPPP
Sbjct: 148 PPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPP 207

Query: 294 PSYS------PSPKTEY*ISRLPLYE 353
           P Y       P P  +Y     P+Y+
Sbjct: 208 PVYKHKSPPPPPPVYKYKSPPPPVYK 233

 Score =  108 bits (270), Expect = 2e-22
 Identities = 70/145 (48%), Positives = 75/145 (51%), Gaps = 31/145 (21%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYYS----PSPKVYYKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPP 164
           P VY YKSPPPP Y     P P   YKSPP P      PPPP Y     P P  VYKSPP
Sbjct: 67  PPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPP 126

Query: 165 PP-YVYNSPPPPYY-------------SPSPKVY-YKSPPPPS--YYSPSPKV-EYKSPP 290
           PP Y Y SPPPP Y             SP P VY YKSPPPP   + SP P + +YKSPP
Sbjct: 127 PPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPP 186

Query: 291 PPSYS----PSPKTEY*ISRLPLYE 353
           PP Y     P P   Y     P+Y+
Sbjct: 187 PPVYKYKSPPPPPPMYKSPPPPVYK 211

 Score =  108 bits (269), Expect = 2e-22
 Identities = 69/134 (51%), Positives = 71/134 (52%), Gaps = 29/134 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYS------PSPKVVYKSP 161
           P   +KSPPPP Y   SP P VY YKSPP P      PPPP Y       P P   YKSP
Sbjct: 168 PPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSP 227

Query: 162 PPP-YVYNSPPPP---YYSPSPKVY-YKSPPPPS--YYSPSPKVE-----------YKSP 287
           PPP Y Y SPPPP   Y SP P +Y YKSPPPP   Y SP P V            YKSP
Sbjct: 228 PPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSP 287

Query: 288 PPPSY-SPSPKTEY 326
           PPP Y SP P   Y
Sbjct: 288 PPPVYKSPPPPYHY 301

 Score =  105 bits (263), Expect = 1e-21
 Identities = 66/132 (50%), Positives = 67/132 (50%), Gaps = 30/132 (22%)
 Frame = +3

Query: 21  YYKSPPPP-----YYSPSPKVY-YKSPPHPHVCVCPPPPPCYS--------------PSP 140
           YY SPPPP     Y SP P VY YKSPP P      PPPP Y               P P
Sbjct: 29  YYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPPP 88

Query: 141 KVVYKSPPPP-YVYNSPPPPYYS----PSPKVYYKSPPPP--SYYSPSPKV-EYKSPPPP 296
             VYKSPPPP Y Y SPPPP Y     P P   YKSPPPP   Y SP P V +YKSPPPP
Sbjct: 89  PPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPP 148

Query: 297 S--YSPSPKTEY 326
              Y   P   Y
Sbjct: 149 PPVYKSPPPPVY 160

 Score =  103 bits (257), Expect = 6e-21
 Identities = 63/112 (56%), Positives = 65/112 (58%), Gaps = 15/112 (13%)
 Frame = +3

Query: 12  PKVY-YKSPPPP-----YYSPSPKVY-YKSPPHPHVCVCPPPPPCYS----PSPKVVYKS 158
           P VY +KSPPPP     Y SP P VY YKSPP P      PPPP Y     P P  VYKS
Sbjct: 207 PPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKS 266

Query: 159 PPPP-YVYNSPPPP---YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PPPP Y Y SPPPP   Y SP P VY KSPPPP +Y       Y SPPPP Y
Sbjct: 267 PPPPVYKYKSPPPPPPVYKSPPPPVY-KSPPPPYHY------YYTSPPPPHY 311

 Score =  101 bits (252), Expect = 2e-20
 Identities = 70/137 (51%), Positives = 73/137 (53%), Gaps = 32/137 (23%)
 Frame = +3

Query: 12  PKVY-YKSPPPP---YYSPSPKVY-YKSPPHPHVCVCPPPPPCYS--------------P 134
           P VY YKSPPPP   Y SP P VY YKSPP P      PPPP Y               P
Sbjct: 137 PPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPP 196

Query: 135 SPKVVYKSPPPPYVY--NSPPPP-----YYSPSPKVY-YKSPPPPS--YYSPSPKV-EYK 281
            P  +YKSPPPP VY   SPPPP     Y SP P VY YKSPPPP   Y SP P + +YK
Sbjct: 197 PPPPMYKSPPPP-VYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYK 255

Query: 282 SPPPPS--YSPSPKTEY 326
           SPPPP   Y   P   Y
Sbjct: 256 SPPPPPPVYKSPPPPVY 272

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 70/124 (56%), Positives = 72/124 (58%), Gaps = 23/124 (18%)
 Frame = +3

Query: 12  PKVY-YKSPPPP---YYSPSPKVY-YKSPPHPHVCVC--PPPPPCYS----PSPKVVYKS 158
           P VY YKSPPPP   Y SP P VY +KSPP P        PPPP Y     P P  VYKS
Sbjct: 187 PPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKS 246

Query: 159 PPPP-YVYNSPPPP---YYSPSPKVY-YKSPPPPS---YYSPSPKVEYKSPPPPSY---- 302
           PPPP Y Y SPPPP   Y SP P VY YKSPPPP      SP P V YKSPPPP +    
Sbjct: 247 PPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYK-SPPPPV-YKSPPPPYHYYYT 304

Query: 303 SPSP 314
           SP P
Sbjct: 305 SPPP 308

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/74 (51%), Positives = 42/74 (56%), Gaps = 13/74 (17%)
 Frame = +3

Query: 171 YVYNSPPPP-----YYSPSPKVY-YKSPPP--PSYYSPSPKV-EYKSPPPPSYS----PS 311
           Y Y+SPPPP     Y SP P VY YKSPPP  P Y SP P V +YKSPPPP Y     P 
Sbjct: 28  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPP 87

Query: 312 PKTEY*ISRLPLYE 353
           P   Y     P+Y+
Sbjct: 88  PPPVYKSPPPPVYK 101

[55][TOP]
>UniRef100_Q38913-2 Isoform 2 of Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=Q38913-2
          Length = 246

 Score =  111 bits (277), Expect = 3e-23
 Identities = 66/127 (51%), Positives = 70/127 (55%), Gaps = 25/127 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSP--------------SP 140
           SP   YKSPPPP  YYSP P   YKSPP P     PPP   YSP              SP
Sbjct: 66  SPPPVYKSPPPPVKYYSPPP--VYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 123

Query: 141 KVVYKSPPPPY-------VYNSPPPP--YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
             VYKSPPPP        VY SPPPP  +YSP P VY+ SPPPP +YSP P V +  PPP
Sbjct: 124 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVVYH-SPPPPVHYSPPPVVYHSPPPP 182

Query: 294 PSYSPSP 314
             YSP P
Sbjct: 183 VHYSPPP 189

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 60/106 (56%), Gaps = 8/106 (7%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPPYVYN 182
           +Y SPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPPPP  Y 
Sbjct: 22  FYSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYY 81

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP--SYSPSP 314
           SPPP Y SP P VY   PPP  +YSP P   YKSPPPP   YSP P
Sbjct: 82  SPPPVYKSPPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPP 125

 Score =  108 bits (269), Expect = 2e-22
 Identities = 66/134 (49%), Positives = 73/134 (54%), Gaps = 26/134 (19%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSP- 161
           ++ P   YKSPPPP    SP   YKSPP P     PPP      PP    SP  VYKSP 
Sbjct: 88  KSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 147

Query: 162 -------PPPYVYNSPPPP-YYSPSPKVYYKSPPPPSYYSPSPKV-----------EYKS 284
                  PPP VY+SPPPP +YSP P VY+ SPPPP +YSP P V           EYKS
Sbjct: 148 PPVKHYSPPPVVYHSPPPPVHYSPPPVVYH-SPPPPVHYSPPPVVYHSPPPPKKHYEYKS 206

Query: 285 PPPPSYSPSPKTEY 326
           PPPP +  SP T Y
Sbjct: 207 PPPPVHY-SPPTVY 219

 Score =  106 bits (265), Expect = 7e-22
 Identities = 63/126 (50%), Positives = 65/126 (51%), Gaps = 24/126 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP--------------PPCYSPSPKV 146
           SP   YKSPPPP    SP   YKSPP P     PPP              PP Y   P  
Sbjct: 34  SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 93

Query: 147 VYKSPPPPYVYNSPPPPYYSPSPKV-------YYKSPPPP-SYYSPSPKVEYKSPPPP-- 296
           VYKSPPPP  + SPPP Y SP P V        YKSPPPP  +YSP P   YKSPPPP  
Sbjct: 94  VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP--VYKSPPPPVK 151

Query: 297 SYSPSP 314
            YSP P
Sbjct: 152 HYSPPP 157

 Score =  105 bits (262), Expect = 2e-21
 Identities = 61/114 (53%), Positives = 66/114 (57%), Gaps = 12/114 (10%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP   YKSPPPP    SP   YKSPP P     PPP   +SP P V Y   PPP VY+SP
Sbjct: 122 SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVVYHSPPPPVHYS--PPPVVYHSP 179

Query: 189 PPP-YYSPSPKVY-----------YKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP +YSP P VY           YKSPPPP +YSP P V Y SPPPP +  SP
Sbjct: 180 PPPVHYSPPPVVYHSPPPPKKHYEYKSPPPPVHYSP-PTV-YHSPPPPVHHYSP 231

 Score =  100 bits (248), Expect = 7e-20
 Identities = 52/101 (51%), Positives = 59/101 (58%), Gaps = 4/101 (3%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYN 182
           P VY+  PPP +YSP P VY+           PPPP  YSP P VVY SPPPP   Y Y 
Sbjct: 157 PVVYHSPPPPVHYSPPPVVYHS----------PPPPVHYSP-PPVVYHSPPPPKKHYEYK 205

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPK-VEYKSPPPPSY 302
           SPPPP +   P VY+  PPP  +YSP  +   YKSPPPP Y
Sbjct: 206 SPPPPVHYSPPTVYHSPPPPVHHYSPPHQPYLYKSPPPPHY 246

[56][TOP]
>UniRef100_Q3ECC3 Putative uncharacterized protein At1g76930.1 n=1 Tax=Arabidopsis
           thaliana RepID=Q3ECC3_ARATH
          Length = 293

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 60/106 (56%), Gaps = 8/106 (7%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPPYVYN 182
           +Y SPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPPPP  Y 
Sbjct: 26  FYSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYY 85

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP--SYSPSP 314
           SPPP Y SP P VY   PPP  +YSP P   YKSPPPP   YSP P
Sbjct: 86  SPPPVYKSPPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPP 129

 Score =  108 bits (270), Expect = 2e-22
 Identities = 63/111 (56%), Positives = 64/111 (57%), Gaps = 9/111 (8%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPP 170
           SP   YKSPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPPPP
Sbjct: 38  SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 97

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPP-SYYSPSPKVEYKSPPPP--SYSPSP 314
            VY SPPPP    SP   YKSPPPP  +YSP P   YKSPPPP   YSP P
Sbjct: 98  -VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPP 145

 Score =  103 bits (257), Expect = 6e-21
 Identities = 57/97 (58%), Positives = 61/97 (62%), Gaps = 2/97 (2%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           SP   YKSPPPP  YYSP P   YKSPP P     PPP   YSP P  VYKSPPPP  + 
Sbjct: 70  SPPPVYKSPPPPVKYYSPPP--VYKSPPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHY 125

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
           SPPP Y SP P V + S PPP Y SP P V++ SPPP
Sbjct: 126 SPPPVYKSPPPPVKHYS-PPPVYKSPPPPVKHYSPPP 161

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 42/80 (52%), Positives = 46/80 (57%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           ++ P   YKSPPPP    SP   YKSP        PPP   YSP P  VYKSPPPP  + 
Sbjct: 92  KSPPPPVYKSPPPPVKHYSPPPVYKSP--------PPPVKHYSPPP--VYKSPPPPVKHY 141

Query: 183 SPPPPYYSPSPKVYYKSPPP 242
           SPPP Y SP P V + SPPP
Sbjct: 142 SPPPVYKSPPPPVKHYSPPP 161

 Score = 55.8 bits (133), Expect(2) = 4e-13
 Identities = 30/55 (54%), Positives = 31/55 (56%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
           SP   YKSPPPP    SP   YKSPP P V    PPP   SP P V + SPPP Y
Sbjct: 110 SPPPVYKSPPPPVKHYSPPPVYKSPPPP-VKHYSPPPVYKSPPPPVKHYSPPPSY 163

 Score = 42.0 bits (97), Expect(2) = 4e-13
 Identities = 21/42 (50%), Positives = 25/42 (59%)
 Frame = +1

Query: 175 STIPHHHHTTHLLQKFTTSLLHHHLIILPLQRLNTNLHLHHR 300
           +T+ HH  TTHLLQ +TT  LHHH     L +L T  H H R
Sbjct: 164 TTLHHHRFTTHLLQSYTT--LHHHRFTTHLLQLYTTPHHHPR 203

[57][TOP]
>UniRef100_Q304C4 Putative uncharacterized protein At1g76930.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q304C4_ARATH
          Length = 256

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 60/106 (56%), Gaps = 8/106 (7%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPPYVYN 182
           +Y SPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPPPP  Y 
Sbjct: 26  FYSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYY 85

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP--SYSPSP 314
           SPPP Y SP P VY   PPP  +YSP P   YKSPPPP   YSP P
Sbjct: 86  SPPPVYKSPPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPP 129

 Score =  108 bits (270), Expect = 2e-22
 Identities = 63/111 (56%), Positives = 64/111 (57%), Gaps = 9/111 (8%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPP 170
           SP   YKSPPPP    SP   YKSPP P     PPP      PP    SP  VYKSPPPP
Sbjct: 38  SPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 97

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPP-SYYSPSPKVEYKSPPPP--SYSPSP 314
            VY SPPPP    SP   YKSPPPP  +YSP P   YKSPPPP   YSP P
Sbjct: 98  -VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPP 145

 Score =  103 bits (257), Expect = 6e-21
 Identities = 57/97 (58%), Positives = 61/97 (62%), Gaps = 2/97 (2%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           SP   YKSPPPP  YYSP P   YKSPP P     PPP   YSP P  VYKSPPPP  + 
Sbjct: 70  SPPPVYKSPPPPVKYYSPPP--VYKSPPPPVYKSPPPPVKHYSPPP--VYKSPPPPVKHY 125

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
           SPPP Y SP P V + S PPP Y SP P V++ SPPP
Sbjct: 126 SPPPVYKSPPPPVKHYS-PPPVYKSPPPPVKHYSPPP 161

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 42/80 (52%), Positives = 46/80 (57%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           ++ P   YKSPPPP    SP   YKSP        PPP   YSP P  VYKSPPPP  + 
Sbjct: 92  KSPPPPVYKSPPPPVKHYSPPPVYKSP--------PPPVKHYSPPP--VYKSPPPPVKHY 141

Query: 183 SPPPPYYSPSPKVYYKSPPP 242
           SPPP Y SP P V + SPPP
Sbjct: 142 SPPPVYKSPPPPVKHYSPPP 161

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 30/55 (54%), Positives = 31/55 (56%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
           SP   YKSPPPP    SP   YKSPP P V    PPP   SP P V + SPPP Y
Sbjct: 110 SPPPVYKSPPPPVKHYSPPPVYKSPPPP-VKHYSPPPVYKSPPPPVKHYSPPPSY 163

[58][TOP]
>UniRef100_O65375 F12F1.9 protein n=1 Tax=Arabidopsis thaliana RepID=O65375_ARATH
          Length = 744

 Score =  108 bits (271), Expect = 1e-22
 Identities = 62/118 (52%), Positives = 64/118 (54%), Gaps = 14/118 (11%)
 Frame = +3

Query: 3   RASPKVY-YKSPPPPYYSPSPKVYYKSPPHPHV--------CVCPPPPPCYSPSPKVVYK 155
           + SP V  Y  PPPP    SP V   SPP P             PPPPP  SP P  VY 
Sbjct: 414 KMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYS 473

Query: 156 SPPPPYVYNSPPPP---YYSPSPKVY-YKSPPPPSYY-SPSPKVEYKSPPPPSYSPSP 314
           SPPPPYVY+SPPPP   Y SP P  Y Y SPPPP  Y SP P   Y SPPPP  SP P
Sbjct: 474 SPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPP 531

 Score =  106 bits (265), Expect = 7e-22
 Identities = 60/109 (55%), Positives = 64/109 (58%), Gaps = 10/109 (9%)
 Frame = +3

Query: 3   RASPKVY-YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP-CYS--PSPKVVYKSPPPP 170
           + SP V  Y  PPPP  SP P   Y SPP P+V   PPPPP  YS  P P  VY SPPPP
Sbjct: 448 KMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPP 507

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPP-SYYSPSPKVEY-----KSPPPPS 299
           YVY+SPPPPY   SP     SPPPP    SP P V Y     +SPPPPS
Sbjct: 508 YVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPS 556

 Score =  101 bits (251), Expect = 3e-20
 Identities = 60/117 (51%), Positives = 63/117 (53%), Gaps = 9/117 (7%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYS---PSPKVYYKSPPHPHVCVCPPPPPCYS-PSPKVVYKS-PPP 167
           + SP V   SPPPP YS   PS + Y   PP P     PPPP  YS P P  VY S PPP
Sbjct: 431 KMSPSVRAYSPPPPPYSKMSPSVRAY---PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPP 487

Query: 168 PYVYNSPPPP---YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP-PSYSPSPKTEY 326
           PYVY+SPPPP   Y SP P   Y SPPPP  YS  P      PPP P  SP P   Y
Sbjct: 488 PYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVY 544

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 65/136 (47%), Positives = 69/136 (50%), Gaps = 35/136 (25%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-YS---PSPKVYYKSPPHPHVCVCPPPPPCYS-PSPKVVYKSPPPP-- 170
           P   Y SPPPPY YS   P P VY   PP P+V   PPPP  YS P P  VY SPPPP  
Sbjct: 468 PPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPP 527

Query: 171 -----YVYNSPPPP--YYSP---SP----KVYY----KSPPPPS--YYSPSPKVEYKSPP 290
                   +SPPPP  YY+P   SP     VYY    +SPPPPS  YY P       SPP
Sbjct: 528 SPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVT----NSPP 583

Query: 291 PPS--------YSPSP 314
           PPS        YSP P
Sbjct: 584 PPSPVYYPPVTYSPPP 599

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 49/105 (46%), Positives = 53/105 (50%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP +  SP+V    PP  +V   PPPPP    SP V   SPPPP      P    SP
Sbjct: 382 SPPPPTFKMSPEVRTLPPPI-YVYSSPPPPPSSKMSPTVRAYSPPPP------PSSKMSP 434

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           S + Y  SPPPP Y   SP V    PPPP  SPSP   Y  S  P
Sbjct: 435 SVRAY--SPPPPPYSKMSPSVRAYPPPPPP-SPSPPPPYVYSSPP 476

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 60/144 (41%), Positives = 66/144 (45%), Gaps = 49/144 (34%)
 Frame = +3

Query: 18   VYYK----SPPPP---YY---SPSPK----VYYK----SPP------HPHVCVCPPPP-P 122
            VYY     SPPPP   YY   +PSP     VYY     SPP      +P V   PPPP P
Sbjct: 603  VYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662

Query: 123  CYSPSPKVVYKSPPPPYVY-----NSPPP-------------PYYSPSPKVYYKSPPPP- 245
             Y PS     +SPPPP  Y      SPPP             P Y P P+  Y S PPP 
Sbjct: 663  VYYPSET---QSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPP 719

Query: 246  ---SYYSPSPKVEYKS--PPPPSY 302
               SY+ P P V Y +  PPPPSY
Sbjct: 720  SPTSYFPPMPSVSYDASPPPPPSY 743

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 73/191 (38%), Positives = 78/191 (40%), Gaps = 86/191 (45%)
 Frame = +3

Query: 12   PKVYYKSPPPPYY--SPSPKVYYKSPPHPHVCVCPPPPP------C--YSPSPKVVY--- 152
            P VY   PPPPY   SP P   Y SPP P+V   PPPPP      C   SP P VVY   
Sbjct: 488  PYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAP 547

Query: 153  -----------------KSPPPPY----------------VY-----NSPPPP---YY-- 203
                             +SPPPP                 VY      SPPPP   YY  
Sbjct: 548  VTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQ 607

Query: 204  -SPSP----KVYY----KSPPPPS--YY---SPSP----KVEY----KSPPPPS------ 299
             +PSP     +YY     SPPPPS  YY   +PSP     V Y     SPPPPS      
Sbjct: 608  VTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPS 667

Query: 300  --YSPSPKTEY 326
               SP P TEY
Sbjct: 668  ETQSPPPPTEY 678

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 62/148 (41%), Positives = 68/148 (45%), Gaps = 45/148 (30%)
 Frame = +3

Query: 18  VYY----KSPPPPYYSPSPKVYYKSPP-----HPHVCVCPPPP-PCYSPSPKVVYKSPPP 167
           VYY     SPPPP     P V Y  PP     +P V   PPPP P Y P    V  SPPP
Sbjct: 573 VYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPP---VTPSPPP 629

Query: 168 PY------VYNSPPPP---YY---SPSP----KVYY----KSPPPPS--YYSPSPKVEYK 281
           P       V  SPPPP   YY   +PSP     VYY    +SPPPP+  YYSPS     +
Sbjct: 630 PSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPS-----Q 684

Query: 282 SPPP-------------PSYSPSPKTEY 326
           SPPP             PSY P P+  Y
Sbjct: 685 SPPPTKACKEGHPPQATPSYEPPPEYSY 712

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 41/91 (45%), Positives = 46/91 (50%), Gaps = 12/91 (13%)
 Frame = +3

Query: 18  VYY----KSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPP---PCYSPSPKVVYKSPPP 167
           VYY    +SPPPP   YYSPS     +SPP    C    PP   P Y P P+  Y S PP
Sbjct: 663 VYYPSETQSPPPPTEYYYSPS-----QSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPP 717

Query: 168 PYVYNSPPPPYYSPSPKVYYKS--PPPPSYY 254
           P      P  Y+ P P V Y +  PPPPSYY
Sbjct: 718 P----PSPTSYFPPMPSVSYDASPPPPPSYY 744

[59][TOP]
>UniRef100_Q9STN0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STN0_ARATH
          Length = 437

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/110 (54%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK-VVYKSP------P 164
           SP   Y SPPP  YSP P  Y YKSPP+ +     PPP  YSP P   VYKSP      P
Sbjct: 83  SPPYVYSSPPPYAYSPPPSPYVYKSPPYVY---SSPPPYAYSPPPSPYVYKSPPYVYSSP 139

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPYVY+SPPP  YSP P  Y  SPPP  Y   SP   Y SPPP +YSP P
Sbjct: 140 PPYVYSSPPPYAYSPPPYAY--SPPPSPYVYKSPPYVYSSPPPYAYSPPP 187

 Score =  103 bits (258), Expect = 5e-21
 Identities = 57/106 (53%), Positives = 62/106 (58%), Gaps = 2/106 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK-VVYKSPPPPYVYN 182
           SP   Y SPPP  YSP P  Y YKSPP+ +     PPP  YSP P   VYKSPP  YVY+
Sbjct: 321 SPPYVYSSPPPYAYSPPPSPYVYKSPPYVY---SSPPPYAYSPPPSPYVYKSPP--YVYS 375

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           SPPP  YSP P  Y   PP P  Y P P V Y SPPP  Y+P P +
Sbjct: 376 SPPPYTYSPPPYAYSPPPPCPDVYKPPPYV-YSSPPPYVYNPPPSS 420

 Score =  103 bits (257), Expect = 6e-21
 Identities = 59/121 (48%), Positives = 64/121 (52%), Gaps = 19/121 (15%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCP----PPPPCYSPSPK-VVYKSPP-- 164
           SP   Y SPPP  YSP P  Y YKSPP+ +    P    PPP  YSP P   VYKSPP  
Sbjct: 170 SPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYV 229

Query: 165 ----PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP-------SPKVEYKSPPPPSYSPS 311
               PPY Y+ PP PY   SP   Y SPPP +Y  P       SP   Y SPPP +YSP 
Sbjct: 230 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 289

Query: 312 P 314
           P
Sbjct: 290 P 290

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/117 (49%), Positives = 63/117 (53%), Gaps = 15/117 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK-VVYKSPP------ 164
           SP   Y SPPP  YSP P  Y YKSPP+ +     PPP  YSP P   VYKSPP      
Sbjct: 225 SPPYVYSSPPPYAYSPPPSPYVYKSPPYVY---SSPPPYAYSPPPSPYVYKSPPYVYSSP 281

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP-------SPKVEYKSPPPPSYSPSP 314
           PPY Y+ PP PY   SP   Y SPPP +Y  P       SP   Y SPPP +YSP P
Sbjct: 282 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPP 338

 Score =  103 bits (257), Expect = 6e-21
 Identities = 63/119 (52%), Positives = 67/119 (56%), Gaps = 17/119 (14%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK-VVYKSPPPPYVYN 182
           SP   Y SPPP  YSP P  Y YKSPP+ +     PPP  YSP P   VYKSPP  YVY+
Sbjct: 249 SPPYVYSSPPPYAYSPPPSPYVYKSPPYVY---SSPPPYAYSPPPSPYVYKSPP--YVYS 303

Query: 183 SPPPPYYSPSPKVY-YKSPP------PPSYYSP--------SPKVEYKSPPPPSYSPSP 314
           SPPP  YSP P  Y YKSPP      PP  YSP        SP   Y SPPP +YSP P
Sbjct: 304 SPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPP 362

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/117 (49%), Positives = 63/117 (53%), Gaps = 15/117 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK-VVYKSPP------ 164
           SP   Y SPPP  YSP P  Y YKSPP+ +     PPP  YSP P   VYKSPP      
Sbjct: 273 SPPYVYSSPPPYAYSPPPSPYVYKSPPYVY---SSPPPYAYSPPPSPYVYKSPPYVYSSP 329

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP-------SPKVEYKSPPPPSYSPSP 314
           PPY Y+ PP PY   SP   Y SPPP +Y  P       SP   Y SPPP +YSP P
Sbjct: 330 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPP 386

 Score =  102 bits (255), Expect = 1e-20
 Identities = 56/108 (51%), Positives = 58/108 (53%), Gaps = 6/108 (5%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVY-YKSPPH-----PHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           SP   Y SPPP  YSP P  Y YKSPP+     P      PPP  YSP P   Y  PP P
Sbjct: 107 SPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPPYAYSP-PPYAYSPPPSP 165

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           YVY SPP  Y SP P  Y  SPPP  Y   SP   Y SPPP +YSP P
Sbjct: 166 YVYKSPPYVYSSPPPYAY--SPPPSPYVYKSPPYVYSSPPPYAYSPPP 211

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/118 (49%), Positives = 64/118 (54%), Gaps = 15/118 (12%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK-VVYKSPP----- 164
           +SP  Y  SPPP  YSP P  Y YKSPP+ +     PPP  YSP P   VYKSPP     
Sbjct: 200 SSPPPYAYSPPPYAYSPPPSPYVYKSPPYVY---SSPPPYAYSPPPSPYVYKSPPYVYSS 256

Query: 165 -PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP-------SPKVEYKSPPPPSYSPSP 314
            PPY Y+ PP PY   SP   Y SPPP +Y  P       SP   Y SPPP +YSP P
Sbjct: 257 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPP 314

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 59/125 (47%), Positives = 63/125 (50%), Gaps = 24/125 (19%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK-VVYKSPP------- 164
           P   Y SPPP  YSP P  Y YKSPP+ +     PPP  YSP P   VYKSPP       
Sbjct: 36  PPYVYSSPPPYTYSPPPSPYVYKSPPYVY---SSPPPYAYSPPPSPYVYKSPPYVYSSPP 92

Query: 165 ---------------PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
                          PPYVY+SPPP  YSP P  Y    PP  Y SP P V Y SPPP +
Sbjct: 93  PYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYV-YSSPPPYA 151

Query: 300 YSPSP 314
           YSP P
Sbjct: 152 YSPPP 156

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 63/127 (49%), Positives = 68/127 (53%), Gaps = 24/127 (18%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPK-VVYKSPPPPYVY 179
           +SP  Y  SPPP  YSP P  Y YKSPP+ +     PPP  YSP P   VYKSPP  YVY
Sbjct: 145 SSPPPYAYSPPPYAYSPPPSPYVYKSPPYVY---SSPPPYAYSPPPSPYVYKSPP--YVY 199

Query: 180 NSPPPPYYSPSPKVY--------YKSPP------PPSYYSP--------SPKVEYKSPPP 293
           +SPPP  YSP P  Y        YKSPP      PP  YSP        SP   Y SPPP
Sbjct: 200 SSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 259

Query: 294 PSYSPSP 314
            +YSP P
Sbjct: 260 YAYSPPP 266

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 59/116 (50%), Positives = 62/116 (53%), Gaps = 14/116 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPP-PYYSPSPKVY------YKSPPHPHVCVCP------PPPPCYSPSPK-V 146
           SP   Y SPPP  Y SP P  Y      Y  PP P+V   P      PPP  YSP P   
Sbjct: 131 SPPYVYSSPPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 190

Query: 147 VYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           VYKS  PPYVY+SPPP  YSP P  Y  SPPP  Y   SP   Y SPPP +YSP P
Sbjct: 191 VYKS--PPYVYSSPPPYAYSPPPYAY--SPPPSPYVYKSPPYVYSSPPPYAYSPPP 242

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/99 (51%), Positives = 53/99 (53%), Gaps = 1/99 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           SP   Y SPPP  YSP P  Y YKSPP+ +     PPP  YSP P      PP P VY  
Sbjct: 345 SPPYVYSSPPPYAYSPPPSPYVYKSPPYVY---SSPPPYTYSPPPYAYSPPPPCPDVYKP 401

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PP  Y SP P VY    PPPS   PSP   Y SPPPP Y
Sbjct: 402 PPYVYSSPPPYVY---NPPPSSPPPSPSYSYSSPPPPIY 437

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 49/99 (49%), Positives = 51/99 (51%), Gaps = 8/99 (8%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP--------PYVYNSPPPP 197
           PY  PSP  Y  S P P+    PPP P    SP  VY SPPP        PYVY SPP  
Sbjct: 29  PYSPPSPPPYVYSSPPPYT-YSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYV 87

Query: 198 YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           Y SP P  Y  SPPP  Y   SP   Y SPPP +YSP P
Sbjct: 88  YSSPPPYAY--SPPPSPYVYKSPPYVYSSPPPYAYSPPP 124

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/82 (50%), Positives = 42/82 (51%)
 Frame = +3

Query: 69  YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPS 248
           Y  SPP P       PP  YS  P   Y  PP PYVY SPP  Y SP P  Y  SPPP  
Sbjct: 28  YPYSPPSP-------PPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAY--SPPPSP 78

Query: 249 YYSPSPKVEYKSPPPPSYSPSP 314
           Y   SP   Y SPPP +YSP P
Sbjct: 79  YVYKSPPYVYSSPPPYAYSPPP 100

[60][TOP]
>UniRef100_P06599 Extensin n=1 Tax=Daucus carota RepID=EXTN_DAUCA
          Length = 306

 Score =  108 bits (269), Expect = 2e-22
 Identities = 60/149 (40%), Positives = 77/149 (51%), Gaps = 43/149 (28%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP---------PPPPCYSPSP--KVVYK 155
           +P   YKSPPPP +SP P  +++SPP P     P         PPPP +SP+P     YK
Sbjct: 73  TPVYKYKSPPPPMHSPPPPYHFESPPPPKHSPPPPTPVYKYKSPPPPKHSPAPVHHYKYK 132

Query: 156 SPPPP---YVYNSPPPPYYSPSPKVY--YKSPPPPSYY---------------------- 254
           SPPPP   Y Y SPPPP +SP+P+ +  YKSPPPP ++                      
Sbjct: 133 SPPPPTPVYKYKSPPPPKHSPAPEHHYKYKSPPPPKHFPAPEHHYKYKYKSPPPPTPVYK 192

Query: 255 -----SPSPKVEYKSPPPPSYSPSPKTEY 326
                 P+P  +YKSPPPP +SP+P   Y
Sbjct: 193 YKSPPPPTPVYKYKSPPPPKHSPAPVHHY 221

 Score =  107 bits (268), Expect = 3e-22
 Identities = 57/128 (44%), Positives = 72/128 (56%), Gaps = 21/128 (16%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP---------PPPCYSPSPKVVYKS 158
           +SP     SPPPP +SP P  +Y+SPP P     PP         PPP +SP P   ++S
Sbjct: 37  SSPPPPEHSPPPPEHSPPPPYHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPPYHFES 96

Query: 159 PPPP----------YVYNSPPPPYYSPSPKVY--YKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PPPP          Y Y SPPPP +SP+P  +  YKSPPP     P+P  +YKSPPPP +
Sbjct: 97  PPPPKHSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPP-----PTPVYKYKSPPPPKH 151

Query: 303 SPSPKTEY 326
           SP+P+  Y
Sbjct: 152 SPAPEHHY 159

 Score =  104 bits (259), Expect = 3e-21
 Identities = 60/132 (45%), Positives = 73/132 (55%), Gaps = 28/132 (21%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYK--SPPHPHVCVCPP---------PPPCYSPSPKVVYK 155
           +P   YKSPPPP +SP+P+ +YK  SPP P     P          PPP   P+P   YK
Sbjct: 138 TPVYKYKSPPPPKHSPAPEHHYKYKSPPPPKHFPAPEHHYKYKYKSPPP---PTPVYKYK 194

Query: 156 SPPPP---YVYNSPPPPYYSPSPKVYYK------------SPPPPSYYSP--SPKVEYKS 284
           SPPPP   Y Y SPPPP +SP+P  +YK            SPPPP +  P  +P  +YKS
Sbjct: 195 SPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEHSPPPPTPVYKYKS 254

Query: 285 PPPPSYSPSPKT 320
           PPPP +SP P T
Sbjct: 255 PPPPMHSPPPPT 266

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 60/130 (46%), Positives = 68/130 (52%), Gaps = 33/130 (25%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYK------------------SPPHPHVCVCPPPPPCYSPSP--K 143
           YKSPPPP + P+P+ +YK                   PP P      PPPP +SP+P   
Sbjct: 161 YKSPPPPKHFPAPEHHYKYKYKSPPPPTPVYKYKSPPPPTPVYKYKSPPPPKHSPAPVHH 220

Query: 144 VVYKSPPPPY-VYNSPPPPYYSPSPK--VY-YKSPPPPSYYSPSPKVEYK---------S 284
             YKSPPPP  VY SPPPP +SP P   VY YKSPPPP +  P P   YK         S
Sbjct: 221 YKYKSPPPPTPVYKSPPPPEHSPPPPTPVYKYKSPPPPMHSPPPPTPVYKYKSPPPPMHS 280

Query: 285 PPPPSYSPSP 314
           PPPP YSP P
Sbjct: 281 PPPPVYSPPP 290

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/113 (47%), Positives = 63/113 (55%), Gaps = 15/113 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYK--SPPHPHVCVCPPPPPCYSPSPKVV---YKSPPPP- 170
           +P   YKSPPPP +SP+P  +YK  SPP P      PPPP +SP P      YKSPPPP 
Sbjct: 200 TPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEHSPPPPTPVYKYKSPPPPM 259

Query: 171 ---------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
                    Y Y SPPPP +SP P VY  SPPPP ++       Y SPPPP +
Sbjct: 260 HSPPPPTPVYKYKSPPPPMHSPPPPVY--SPPPPKHH-----YSYTSPPPPHH 305

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query: 141 KVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP--SPKVEYKSPPPPSYSPSP 314
           K  Y SPPPP   +SPPPP +SP P  +Y+SPPPP +  P  +P  +YKSPPPP +SP P
Sbjct: 33  KYTYSSPPPPE--HSPPPPEHSPPPPYHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPP 90

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/63 (53%), Positives = 38/63 (60%), Gaps = 6/63 (9%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPK--VY-YKSPPHPHVCVCPPPPPCYSPSPK---VVYKSPPPP 170
           +P   YKSPPPP +SP P   VY YKSPP P   +  PPPP YSP P      Y SPPPP
Sbjct: 247 TPVYKYKSPPPPMHSPPPPTPVYKYKSPPPP---MHSPPPPVYSPPPPKHHYSYTSPPPP 303

Query: 171 YVY 179
           + Y
Sbjct: 304 HHY 306

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 25/50 (50%), Positives = 30/50 (60%)
 Frame = +3

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           Y Y+SPPPP +SP         PPP + SP P   Y+SPPPP +SP P T
Sbjct: 34  YTYSSPPPPEHSP---------PPPEH-SPPPPYHYESPPPPKHSPPPPT 73

[61][TOP]
>UniRef100_Q9FSG0 Extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG0_NICSY
          Length = 161

 Score =  107 bits (266), Expect = 5e-22
 Identities = 67/124 (54%), Positives = 67/124 (54%), Gaps = 22/124 (17%)
 Frame = +3

Query: 21  YYKSPPPP-----YYSPSPKVY-YKSPPHP---HVCVCPPPPPCYS----PSPKVVYKSP 161
           YY SPPPP     Y SP P VY YKSPP P   H    PPPPP Y     P P   YKSP
Sbjct: 29  YYSSPPPPTKKYVYSSPPPPVYKYKSPPPPVYKHKSP-PPPPPVYKYKSPPPPVYKYKSP 87

Query: 162 PPPY-VYNSPPPPYYS----PSPKVYYKSPPPPSYY---SPSPKVEYKSPPPPSY-SPSP 314
           PPP  VY SPPPP Y     P P   YKSPPPP Y     P P   YKSPPPP Y SP P
Sbjct: 88  PPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSPPP 147

Query: 315 KTEY 326
              Y
Sbjct: 148 PYHY 151

 Score =  107 bits (266), Expect = 5e-22
 Identities = 62/115 (53%), Positives = 63/115 (54%), Gaps = 18/115 (15%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYYS-----PSPKVY-YKSPPHP--HVCVCPPPPPCYSPSPKVVYK--- 155
           P VY YKSPPPP Y      P P VY YKSPP P       PPPPP Y   P  +YK   
Sbjct: 47  PPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKS 106

Query: 156 SPPPPYVYNSPPPPYYS----PSPKVYYKSPPPPSYYSPSPKVE--YKSPPPPSY 302
            PPPP VY SPPPP Y     P P   YKSPPPP Y SP P     Y SPPPP Y
Sbjct: 107 PPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSPPPPYHYYYTSPPPPHY 161

 Score =  104 bits (260), Expect = 3e-21
 Identities = 68/121 (56%), Positives = 70/121 (57%), Gaps = 21/121 (17%)
 Frame = +3

Query: 15  KVYYKSPPPPYY---SPSPKVY-YKSPPHPHVC--VCPPPPPCYS----PSPKVVYKSPP 164
           K  Y SPPPP Y   SP P VY +KSPP P        PPPP Y     P P  VYKSPP
Sbjct: 39  KYVYSSPPPPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPP 98

Query: 165 PP-YVYNSPPPP---YYSPSPKVY-YKSPPPPS--YYSPSPKVEYKSPPPPSY----SPS 311
           PP Y Y SPPPP   Y SP P VY YKSPPPP   Y SP P V YKSPPPP +    SP 
Sbjct: 99  PPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPV-YKSPPPPYHYYYTSPP 157

Query: 312 P 314
           P
Sbjct: 158 P 158

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/76 (47%), Positives = 40/76 (52%), Gaps = 15/76 (19%)
 Frame = +3

Query: 171 YVYNSPPPP-----YYSPSPKVY-YKSPPPPSYY-----SPSPKVEYKSPPPPSYS---- 305
           Y Y+SPPPP     Y SP P VY YKSPPPP Y       P P  +YKSPPPP Y     
Sbjct: 28  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSP 87

Query: 306 PSPKTEY*ISRLPLYE 353
           P P   Y     P+Y+
Sbjct: 88  PPPPPVYKSPPPPIYK 103

[62][TOP]
>UniRef100_Q9FS16 Extensin-3 n=1 Tax=Arabidopsis thaliana RepID=EXTN3_ARATH
          Length = 427

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/116 (48%), Positives = 65/116 (56%), Gaps = 9/116 (7%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSP 188
           YKSPPPP  +YSP P  +   PP  H     PPPP    SP  VY SPPPP   YVY SP
Sbjct: 118 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 177

Query: 189 PPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           PPP    SP   Y SPPPP     Y SP P V++ SPPP  +SP P  ++ + + P
Sbjct: 178 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 233

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/116 (48%), Positives = 65/116 (56%), Gaps = 9/116 (7%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSP 188
           YKSPPPP  +YSP P  +   PP  H     PPPP    SP  VY SPPPP   YVY SP
Sbjct: 202 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 261

Query: 189 PPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           PPP    SP   Y SPPPP     Y SP P V++ SPPP  +SP P  ++ + + P
Sbjct: 262 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 317

 Score =  107 bits (266), Expect = 5e-22
 Identities = 57/116 (49%), Positives = 64/116 (55%), Gaps = 9/116 (7%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSP 188
           YKSPPPP  +YSP P  +   PP  H     PPPP    SP  VY SPPPP   YVY SP
Sbjct: 286 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 345

Query: 189 PPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           PPP    SP   Y SPPPP     Y SP P V++ SPPP  +SP P  E  + + P
Sbjct: 346 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSP 401

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/117 (49%), Positives = 67/117 (57%), Gaps = 10/117 (8%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYK-SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNS 185
           YKSPPPP  +YSP P VY+   PP  H     PPPP    SP  VY SPPPP   YVY S
Sbjct: 146 YKSPPPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 204

Query: 186 PPPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           PPPP    SP   Y SPPPP     Y SP P V++ SPPP  +SP P  ++ + + P
Sbjct: 205 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 261

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/117 (49%), Positives = 67/117 (57%), Gaps = 10/117 (8%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYK-SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNS 185
           YKSPPPP  +YSP P VY+   PP  H     PPPP    SP  VY SPPPP   YVY S
Sbjct: 174 YKSPPPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 232

Query: 186 PPPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           PPPP    SP   Y SPPPP     Y SP P V++ SPPP  +SP P  ++ + + P
Sbjct: 233 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 289

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/117 (49%), Positives = 67/117 (57%), Gaps = 10/117 (8%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYK-SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNS 185
           YKSPPPP  +YSP P VY+   PP  H     PPPP    SP  VY SPPPP   YVY S
Sbjct: 230 YKSPPPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 288

Query: 186 PPPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           PPPP    SP   Y SPPPP     Y SP P V++ SPPP  +SP P  ++ + + P
Sbjct: 289 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 345

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/117 (49%), Positives = 67/117 (57%), Gaps = 10/117 (8%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYK-SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNS 185
           YKSPPPP  +YSP P VY+   PP  H     PPPP    SP  VY SPPPP   YVY S
Sbjct: 258 YKSPPPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 316

Query: 186 PPPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           PPPP    SP   Y SPPPP     Y SP P V++ SPPP  +SP P  ++ + + P
Sbjct: 317 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 373

 Score =  102 bits (255), Expect = 1e-20
 Identities = 55/130 (42%), Positives = 68/130 (52%), Gaps = 16/130 (12%)
 Frame = +3

Query: 3   RASPKVYYKSPPPP---------YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYK 155
           +++   +Y SPPPP         +YSP P  +   PP  H     PPPP    SP  VY 
Sbjct: 20  QSTANYFYSSPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYH 79

Query: 156 SPPPP---YVYNSPPPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSP 314
           SPPPP   YVY SPPPP    SP   Y SPPPP     Y SP P V++ SPPP  +SP P
Sbjct: 80  SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 139

Query: 315 KTEY*ISRLP 344
             ++ + + P
Sbjct: 140 PKKHYVYKSP 149

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 57/118 (48%), Positives = 67/118 (56%), Gaps = 11/118 (9%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPC--YSPSPKVVYKSPPPP---YVYN 182
           YKSPPPP  +YSP P  +   PP  H     PPPP   YSP P V + SPPPP   YVY 
Sbjct: 90  YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYH-SPPPPKKHYVYK 147

Query: 183 SPPPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           SPPPP    SP   Y SPPPP     Y SP P V++ SPPP  +SP P  ++ + + P
Sbjct: 148 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 205

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 57/111 (51%), Positives = 61/111 (54%), Gaps = 20/111 (18%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSP 188
           YKSPPPP  +YSP P  +   PP  H     PPPP    SP  VY SPPPP   YVY SP
Sbjct: 314 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 373

Query: 189 PPP---------YYSPSP---KVYYKSPPPPS--YYS-PSPKVEYKSPPPP 296
           PPP         Y+SP P   K  YKSPPPP   +YS P     YKSPPPP
Sbjct: 374 PPPVKHYSPPPVYHSPPPPKEKYVYKSPPPPPVHHYSPPHHPYLYKSPPPP 424

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/87 (56%), Positives = 53/87 (60%), Gaps = 10/87 (11%)
 Frame = +3

Query: 24  YKSPPPP--YYSPSPKVYYK-SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNS 185
           YKSPPPP  +YSP P VY+   PP  H     PPPP    SP  VY SPPPP   YVY S
Sbjct: 342 YKSPPPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKS 400

Query: 186 PPPP---YYSPSPKVY-YKSPPPPSYY 254
           PPPP   +YSP    Y YKSPPPP +Y
Sbjct: 401 PPPPPVHHYSPPHHPYLYKSPPPPYHY 427

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 48/107 (44%), Positives = 57/107 (53%), Gaps = 7/107 (6%)
 Frame = +3

Query: 45  YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSPPPPYYSPSP 215
           + S S   Y+ S P P V    PP   YSP P  VY SPPPP   Y Y SPPPP    SP
Sbjct: 17  FVSQSTANYFYSSPPPPVKHYTPPVKHYSPPP--VYHSPPPPKKHYEYKSPPPPVKHYSP 74

Query: 216 KVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
              Y SPPPP     Y SP P V++ SPPP  +SP P  ++ + + P
Sbjct: 75  PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 121

[63][TOP]
>UniRef100_Q76KW3 Hydroxyproline-rich glycoprotein-2 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW3_PEA
          Length = 155

 Score =  106 bits (265), Expect = 7e-22
 Identities = 55/100 (55%), Positives = 61/100 (61%), Gaps = 6/100 (6%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS---PSPKVVYK--SPPPP-YVYN 182
           YY+SPPPP +SP P  +Y SPP P     PPPP  YS   P PK  YK  SPPPP Y Y 
Sbjct: 44  YYQSPPPPVHSPPPPYHYSSPPPP--VHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYK 101

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           SPPPP +SP P  +Y SPPPP    P    +Y SPPPP Y
Sbjct: 102 SPPPPVHSPPPPYHYSSPPPP----PKKSYKYSSPPPPVY 137

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 47/91 (51%), Positives = 53/91 (58%), Gaps = 6/91 (6%)
 Frame = +3

Query: 72  YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP-- 245
           Y SPP       PPP P Y  SP     SPPPPY Y+SPPPP +SP P  +Y SPPPP  
Sbjct: 33  YSSPP-------PPPKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPK 85

Query: 246 ---SYYSPSPKV-EYKSPPPPSYSPSPKTEY 326
               Y SP P + +YKSPPPP +SP P   Y
Sbjct: 86  KSYKYSSPPPPIYKYKSPPPPVHSPPPPYHY 116

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 47/100 (47%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHP---HVCVCPPPPPCY---SPSPKVVYKSPPPPY 173
           P  +Y SPPPP +SP P  +Y SPP P         PPPP Y   SP P V   SPPPPY
Sbjct: 57  PPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPV--HSPPPPY 114

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPK---VEYKS 284
            + S PPP   P     Y SPPPP Y   SP     +YKS
Sbjct: 115 -HYSSPPP--PPKKSYKYSSPPPPVYKYKSPHQQVYKYKS 151

[64][TOP]
>UniRef100_Q43505 Extensin-like protein Dif54 n=1 Tax=Solanum lycopersicum
           RepID=Q43505_SOLLC
          Length = 436

 Score =  106 bits (265), Expect = 7e-22
 Identities = 63/119 (52%), Positives = 63/119 (52%), Gaps = 13/119 (10%)
 Frame = +3

Query: 9   SPKVYYKSPPPP----YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-- 170
           SP  YYKSP P     Y SPSP  YYKSP        PPPPP Y  SP V YKSPPPP  
Sbjct: 279 SPVKYYKSPAPSKHYYYKSPSPSQYYKSPAPSKYYKSPPPPPTYYKSP-VYYKSPPPPPT 337

Query: 171 YVYNSP-------PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           Y   SP       PPPYY  S   YYKSPPPP YY  S    YKSPPPP Y       Y
Sbjct: 338 YYEKSPSYYKSPLPPPYYKES-MPYYKSPPPPPYYKESTPY-YKSPPPPPYYKESTPSY 394

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/114 (50%), Positives = 59/114 (51%), Gaps = 16/114 (14%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY--SPSPKVYYKSPPHPHVCV-------CPPPPPCYSPSPKVVYKSP 161
           S   YYKSP P  Y  SP+P  YYKSPP P            PPPPP Y       YKSP
Sbjct: 290 SKHYYYKSPSPSQYYKSPAPSKYYKSPPPPPTYYKSPVYYKSPPPPPTYYEKSPSYYKSP 349

Query: 162 -PPPYV------YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
            PPPY       Y SPPPP Y      YYKSPPPP YY  S    YKSPPPP Y
Sbjct: 350 LPPPYYKESMPYYKSPPPPPYYKESTPYYKSPPPPPYYKESTP-SYKSPPPPPY 402

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 57/111 (51%), Positives = 59/111 (53%), Gaps = 16/111 (14%)
 Frame = +3

Query: 18  VYYKSPPPP--YYSPSPKVYYKSP-PHPHV------CVCPPPPPCYSPSPKVVYKSPPPP 170
           VYYKSPPPP  YY  SP  YYKSP P P+          PPPPP Y  S       PPPP
Sbjct: 327 VYYKSPPPPPTYYEKSPS-YYKSPLPPPYYKESMPYYKSPPPPPYYKESTPYYKSPPPPP 385

Query: 171 YV------YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP-PPSY 302
           Y       Y SPPPP Y      YYKSPPPP YY  S    YKSPP  P+Y
Sbjct: 386 YYKESTPSYKSPPPPPYYKESTPYYKSPPPPPYYKESTP-SYKSPPSSPTY 435

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 61/113 (53%), Positives = 63/113 (55%), Gaps = 11/113 (9%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY--SPSPKVYYKSP-PHPHVCVCPPPPPCY--SPSPKVVYKSPPPP- 170
           S   YYKSP P  Y  SPSP  YYKSP P  +     P P  Y  SPSP   YKSP P  
Sbjct: 232 SKNYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPVKYYKSPAPSK 291

Query: 171 -YVYNSPPPPYY--SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS--YSPSP 314
            Y Y SP P  Y  SP+P  YYKSPPPP  Y  SP V YKSPPPP   Y  SP
Sbjct: 292 HYYYKSPSPSQYYKSPAPSKYYKSPPPPPTYYKSP-VYYKSPPPPPTYYEKSP 343

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 61/137 (44%), Positives = 63/137 (45%), Gaps = 23/137 (16%)
 Frame = +3

Query: 9   SPKVYYKSPPPP----YYSPSPKVYYKSPPHPHVCVCPPPPPCY---SPSPKVVYKSPPP 167
           SP  YYKSP P     Y SPSP  YYKSP        P P   Y   SPSP   YKSP P
Sbjct: 192 SPAKYYKSPAPSKHYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSP 251

Query: 168 PYVYNSPPPP----YYSPSPKVYYKSPPPPSYY------------SPSPKVEYKSPPPPS 299
              Y SP P     Y SPSP  YYKSP P  YY            SPSP   YKSP P  
Sbjct: 252 AKYYKSPAPSKNYYYKSPSPVKYYKSPSPVKYYKSPAPSKHYYYKSPSPSQYYKSPAPSK 311

Query: 300 YSPSPKTEY*ISRLPLY 350
           Y  SP       + P+Y
Sbjct: 312 YYKSPPPPPTYYKSPVY 328

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 60/131 (45%), Positives = 61/131 (46%), Gaps = 25/131 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPP-------------YYSPSPKVYYKSPPHPHVCVCPPPPPCY---SPSP 140
           SP  YYKSP P              Y SPSP  YYKSP        P P   Y   SPSP
Sbjct: 125 SPAKYYKSPSPAKYYKSPTPSKHYYYKSPSPSKYYKSPSPAKYYKSPAPSKHYYYKSPSP 184

Query: 141 KVVYKSPPPPYVYNSPPPP----YYSPSPKVYYKSPPPPSYY---SPSPKVEYKSPPPPS 299
              YKSP P   Y SP P     Y SPSP  YYKSP P  YY   +PS    YKSP P  
Sbjct: 185 AKYYKSPSPAKYYKSPAPSKHYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVK 244

Query: 300 Y--SPSPKTEY 326
           Y  SPSP   Y
Sbjct: 245 YYKSPSPAKYY 255

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 63/141 (44%), Positives = 65/141 (46%), Gaps = 34/141 (24%)
 Frame = +3

Query: 6   ASPKVYYKSPPPP----------------------YYSPSPKVYYKSP-PHPHVCVCPPP 116
           A  K YYKSP P                       Y SPSP  YYKSP P  H     P 
Sbjct: 95  APSKKYYKSPSPSKYYYKSHTPSKKYYKSLSPAKYYKSPSPAKYYKSPTPSKHYYYKSPS 154

Query: 117 PPCY--SPSPKVVYKSPPPP--YVYNSPPPP--YYSPSPKVYYKSPPPPSYY---SPSPK 269
           P  Y  SPSP   YKSP P   Y Y SP P   Y SPSP  YYKSP P  +Y   SPSP 
Sbjct: 155 PSKYYKSPSPAKYYKSPAPSKHYYYKSPSPAKYYKSPSPAKYYKSPAPSKHYYYKSPSPV 214

Query: 270 VEYKSPPPPSY--SPSPKTEY 326
             YKSP P  Y  SP+P   Y
Sbjct: 215 KYYKSPSPAKYYKSPAPSKNY 235

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 59/122 (48%), Positives = 59/122 (48%), Gaps = 24/122 (19%)
 Frame = +3

Query: 9   SPKVYYKSPPPP----YYSPSPKVYYKSPPHPHVCVCPPPPPCY---SPSPKVVYKSPPP 167
           SP  YYKSP P     Y SPSP  YYKSP        P P   Y   SPSP   YKSP P
Sbjct: 250 SPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPVKYYKSPAPSKHYYYKSPSPSQYYKSPAP 309

Query: 168 PYVYNSPPPP--------YY-SPSP--------KVYYKSPPPPSYYSPSPKVEYKSPPPP 296
              Y SPPPP        YY SP P          YYKSP PP YY  S    YKSPPPP
Sbjct: 310 SKYYKSPPPPPTYYKSPVYYKSPPPPPTYYEKSPSYYKSPLPPPYYKESMPY-YKSPPPP 368

Query: 297 SY 302
            Y
Sbjct: 369 PY 370

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 55/122 (45%), Positives = 59/122 (48%), Gaps = 16/122 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY----SPSPKVYYKSPPHPHVCVCPPPPPCY---SPSPKVVYKSPPP 167
           SP  YYKSP P  Y    +PS   YYKSP        P P   Y   +PS    YKSP P
Sbjct: 183 SPAKYYKSPSPAKYYKSPAPSKHYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSP 242

Query: 168 PYVYNSPPPPYY----SPSPKVYYKSPPPPSYY-SPSPKVEYKSPPPPSY----SPSPKT 320
              Y SP P  Y    +PS   YYKSP P  YY SPSP   YKSP P  +    SPSP  
Sbjct: 243 VKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPVKYYKSPAPSKHYYYKSPSPSQ 302

Query: 321 EY 326
            Y
Sbjct: 303 YY 304

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 61/140 (43%), Positives = 65/140 (46%), Gaps = 34/140 (24%)
 Frame = +3

Query: 9   SPKVYYKSPPPP------------YYSPSP-KVYYKSP-PHPHVCVCPPPPPCY------ 128
           SP  YYKSP P             Y SP+P K YYKSP P  +      P   Y      
Sbjct: 67  SPSHYYKSPTPSKHYYKSPVVVKYYKSPAPSKKYYKSPSPSKYYYKSHTPSKKYYKSLSP 126

Query: 129 -----SPSPKVVYKSPPPP--YVYNSPPPP--YYSPSPKVYYKSPPPPSYY---SPSPKV 272
                SPSP   YKSP P   Y Y SP P   Y SPSP  YYKSP P  +Y   SPSP  
Sbjct: 127 AKYYKSPSPAKYYKSPTPSKHYYYKSPSPSKYYKSPSPAKYYKSPAPSKHYYYKSPSPAK 186

Query: 273 EYKSPPPPSY--SPSPKTEY 326
            YKSP P  Y  SP+P   Y
Sbjct: 187 YYKSPSPAKYYKSPAPSKHY 206

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 60/133 (45%), Positives = 63/133 (47%), Gaps = 29/133 (21%)
 Frame = +3

Query: 15  KVYYKSPPP-PYYSP-------SPKVYYKSP-PHPHVCVCPPPPPCY-SPSP-KVVYKSP 161
           K YYKSP P PYY         SP  YYKSP P  H    P     Y SP+P K  YKSP
Sbjct: 45  KKYYKSPSPSPYYKKSEKHAEHSPSHYYKSPTPSKHYYKSPVVVKYYKSPAPSKKYYKSP 104

Query: 162 -PPPYVYNSPPPP------------YYSPSPKVYYKSPPPPSYY---SPSPKVEYKSPPP 293
            P  Y Y S  P             Y SPSP  YYKSP P  +Y   SPSP   YKSP P
Sbjct: 105 SPSKYYYKSHTPSKKYYKSLSPAKYYKSPSPAKYYKSPTPSKHYYYKSPSPSKYYKSPSP 164

Query: 294 PSY--SPSPKTEY 326
             Y  SP+P   Y
Sbjct: 165 AKYYKSPAPSKHY 177

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 44/94 (46%), Positives = 47/94 (50%), Gaps = 16/94 (17%)
 Frame = +3

Query: 21  YYKSP-PPPYYSPSPKVYYKSPPHPHVCV-------CPPPPPCYSPSPKVVYKSPPPP-- 170
           YYKSP PPPYY  S   YYKSPP P            PPPPP Y  S    YKSPPPP  
Sbjct: 345 YYKSPLPPPYYKESMP-YYKSPPPPPYYKESTPYYKSPPPPPYYKESTPS-YKSPPPPPY 402

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYY 254
                 Y  + PPPPYY  S   Y   P  P+Y+
Sbjct: 403 YKESTPYYKSPPPPPYYKESTPSYKSPPSSPTYH 436

[65][TOP]
>UniRef100_Q40415 Extensin (Fragment) n=1 Tax=Nicotiana sylvestris RepID=Q40415_NICSY
          Length = 131

 Score =  106 bits (265), Expect = 7e-22
 Identities = 61/111 (54%), Positives = 61/111 (54%), Gaps = 17/111 (15%)
 Frame = +3

Query: 21  YYKSPPPP-----YYSPSPKVY-YKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPPPP 170
           YY SPPPP     Y SP P VY YKSPP P      PPPP Y     P P   YKSPPPP
Sbjct: 21  YYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIYKYKSPPPP 80

Query: 171 Y-VYNSPPPPYYS----PSPKVYYKSPPPPSYYSPSPKVEY--KSPPPPSY 302
             VY SPPPP Y     P P   YKSPPPP Y SP P   Y   SPPPP Y
Sbjct: 81  PPVYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSPPPPYHYYYTSPPPPHY 131

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/89 (53%), Positives = 51/89 (57%), Gaps = 9/89 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---SPSPKVY-YKSPPHPHVCVCPPPPPCYS----PSPKVVYKSPPP 167
           P   Y+SPPPP Y   SP P +Y YKSPP P      PPPP Y     P P  VYKSPPP
Sbjct: 50  PLPIYRSPPPPVYKYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPP 109

Query: 168 P-YVYNSPPPPYYSPSPKVYYKSPPPPSY 251
           P Y   SPPPPY+      YY SPPPP Y
Sbjct: 110 PVYK--SPPPPYH-----YYYTSPPPPHY 131

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/74 (51%), Positives = 42/74 (56%), Gaps = 13/74 (17%)
 Frame = +3

Query: 171 YVYNSPPPP-----YYSPSPKVY-YKSPPP--PSYYSPSPKV-EYKSPPPPSYS----PS 311
           Y Y+SPPPP     Y SP P VY YKSPPP  P Y SP P V +YKSPPPP Y     P 
Sbjct: 20  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIYKYKSPPP 79

Query: 312 PKTEY*ISRLPLYE 353
           P   Y     P+Y+
Sbjct: 80  PPPVYKSPPPPVYK 93

[66][TOP]
>UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC
          Length = 620

 Score =  106 bits (264), Expect = 9e-22
 Identities = 53/112 (47%), Positives = 58/112 (51%), Gaps = 9/112 (8%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN--- 182
           P   Y  PPPP YSP P  Y   PP        PPPP +SP P    +SPPPP  Y+   
Sbjct: 349 PPPVYSPPPPPSYSPPPPTYLPPPPPSS-----PPPPSFSPPPPTYEQSPPPPPAYSPPL 403

Query: 183 ------SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
                 SPPPP YSP P  Y + PP P  YSP P   Y  PPPP+YSP P T
Sbjct: 404 PAPPTYSPPPPTYSPPPPTYAQPPPLPPTYSPPPPA-YSPPPPPTYSPPPPT 454

 Score =  105 bits (261), Expect = 2e-21
 Identities = 53/110 (48%), Positives = 59/110 (53%), Gaps = 15/110 (13%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP--------PPPPCYSPSPKVVYKSP-------P 164
           SPPPP +SP P  Y +SPP P     P        PPPP YSP P    + P       P
Sbjct: 376 SPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSPPPPTYAQPPPLPPTYSP 435

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  Y+ PPPP YSP P  Y  SPPPP+Y  P P     SPPPP+YSP P
Sbjct: 436 PPPAYSPPPPPTYSPPPPTY--SPPPPAYAQPPPPPPTYSPPPPAYSPPP 483

 Score =  104 bits (260), Expect = 3e-21
 Identities = 57/105 (54%), Positives = 61/105 (58%), Gaps = 1/105 (0%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP   Y SPPPP Y P P     SPP P     PPPPP YSP P   Y  PPPP   +SP
Sbjct: 325 SPPPTY-SPPPPTYLPLPSSPIYSPPPP--VYSPPPPPSYSPPPP-TYLPPPPP---SSP 377

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPS-PKVEYKSPPPPSYSPSPKT 320
           PPP +SP P  Y +SPPPP  YSP  P     SPPPP+YSP P T
Sbjct: 378 PPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSPPPPT 422

 Score =  103 bits (256), Expect = 8e-21
 Identities = 53/118 (44%), Positives = 56/118 (47%), Gaps = 19/118 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY------ 173
           P  Y   PP P YSP P  Y  SPP        PPPP YSP P   Y  PPP Y      
Sbjct: 286 PPTYSPPPPSPIYSPPPPAYSPSPPPTPTPTFSPPPPAYSPPP--TYSPPPPTYLPLPSS 343

Query: 174 --------VYNSPPPPYYSPSPKVYY-----KSPPPPSYYSPSPKVEYKSPPPPSYSP 308
                   VY+ PPPP YSP P  Y       SPPPPS+  P P  E   PPPP+YSP
Sbjct: 344 PIYSPPPPVYSPPPPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSP 401

 Score =  101 bits (251), Expect = 3e-20
 Identities = 55/112 (49%), Positives = 57/112 (50%), Gaps = 11/112 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPP-----------YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           P  Y +SPPPP            YSP P  Y  SPP P     PP PP YSP P     S
Sbjct: 386 PPTYEQSPPPPPAYSPPLPAPPTYSPPPPTY--SPPPPTYAQPPPLPPTYSPPPPAY--S 441

Query: 159 PPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP  Y SPPPP YSP P  Y + PPPP  YSP P      PP P YSP P
Sbjct: 442 PPPPPTY-SPPPPTYSPPPPAYAQPPPPPPTYSPPPPAYSPPPPSPIYSPPP 492

 Score =  100 bits (249), Expect = 5e-20
 Identities = 51/108 (47%), Positives = 57/108 (52%), Gaps = 6/108 (5%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHV------CVCPPPPPCYSPSPKVVYKSPPPP 170
           +P  Y  SPPPP YSP P  Y + PP P           PPPPP YSP P   Y  PPP 
Sbjct: 405 APPTY--SPPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPT-YSPPPPA 461

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           Y    PPPP YSP P  Y   PP P Y  P P+V+   P PP++SP P
Sbjct: 462 YAQPPPPPPTYSPPPPAYSPPPPSPIYSPPPPQVQ---PLPPTFSPPP 506

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 50/107 (46%), Positives = 56/107 (52%), Gaps = 8/107 (7%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP YSP P   Y  PP  ++   PPPPP   P P   +  PPP Y  + PPPP YSP
Sbjct: 347 SPPPPVYSPPPPPSYSPPPPTYL---PPPPPSSPPPPS--FSPPPPTYEQSPPPPPAYSP 401

Query: 210 --------SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
                   SP     SPPPP+Y  P P     SPPPP+YSP P   Y
Sbjct: 402 PLPAPPTYSPPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTY 448

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 56/114 (49%), Positives = 59/114 (51%), Gaps = 16/114 (14%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSP-------PHPHVCVCPPPPPCYSPSPKVVYKSPPP-PYVYN 182
           + P PP YSP P  Y +SP       P P     PPP P YSP P     SPPP P    
Sbjct: 258 RQPQPPTYSPPPPAYAQSPQPSPTYSPPPPTYSPPPPSPIYSPPPPAYSPSPPPTPTPTF 317

Query: 183 SPPPPYYSPSPKVYYKSPPPPSY--------YSPSPKVEYKSPPPPSYSPSPKT 320
           SPPPP YSP P     SPPPP+Y        YSP P V Y  PPPPSYSP P T
Sbjct: 318 SPPPPAYSPPPTY---SPPPPTYLPLPSSPIYSPPPPV-YSPPPPPSYSPPPPT 367

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/106 (50%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +3

Query: 12  PKVYYKSPPP-PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           P  Y +SP P P YSP P  Y   PP P   +  PPPP YSPSP      PP P    SP
Sbjct: 269 PPAYAQSPQPSPTYSPPPPTYSPPPPSP---IYSPPPPAYSPSP------PPTPTPTFSP 319

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPP YSP P     SPPPP+Y  P P     SPPPP YSP P   Y
Sbjct: 320 PPPAYSPPPTY---SPPPPTYL-PLPSSPIYSPPPPVYSPPPPPSY 361

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 47/112 (41%), Positives = 53/112 (47%), Gaps = 15/112 (13%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV----------- 176
           SPPPP YSP P  Y + PP P      PPPP YSP P     SPPPP V           
Sbjct: 449 SPPPPTYSPPPPAYAQPPPPPPTY--SPPPPAYSPPPPSPIYSPPPPQVQPLPPTFSPPP 506

Query: 177 ---YNSPPPPYYSPSPKV-YYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
               + PPPP+  P P    Y  PP P  +SP P  +  SPPPP + P   T
Sbjct: 507 PRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPPHWQPRTPT 558

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/125 (40%), Positives = 55/125 (44%), Gaps = 14/125 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y  PPPP YSP P  Y  SPP P     PPPPP YSP P   Y  PPP  +Y+ PP
Sbjct: 436 PPPAYSPPPPPTYSPPPPTY--SPPPPAYAQPPPPPPTYSPPPPA-YSPPPPSPIYSPPP 492

Query: 192 P------PYYSPSPKVYYKSPPPPSY--------YSPSPKVEYKSPPPPSYSPSPKTEY* 329
           P      P +SP P      PPPP          Y   P     SPPPP    SP   + 
Sbjct: 493 PQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPPHW 552

Query: 330 ISRLP 344
             R P
Sbjct: 553 QPRTP 557

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/109 (46%), Positives = 55/109 (50%), Gaps = 3/109 (2%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PP P   P P  Y  SPP P     P P P YSP P     SPPPP    SPPPP YSPS
Sbjct: 253 PPSPRRQPQPPTY--SPPPPAYAQSPQPSPTYSPPPPTY--SPPPPSPIYSPPPPAYSPS 308

Query: 213 PKVYYK---SPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPLY 350
           P        SPPPP+Y SP P     SPPPP+Y P P +       P+Y
Sbjct: 309 PPPTPTPTFSPPPPAY-SPPPTY---SPPPPTYLPLPSSPIYSPPPPVY 353

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 56/151 (37%), Positives = 61/151 (40%), Gaps = 50/151 (33%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVY----YKSPPHPHVCVCPPPP-------------------- 119
           P  Y + PP P YSPSP+V     Y  PP  HV   P PP                    
Sbjct: 180 PPTYAQPPPTPIYSPSPQVQPPPTYSPPPPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRH 239

Query: 120 -----------------------PCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYK 230
                                  P YSP P    +SP P   Y SPPPP YSP P     
Sbjct: 240 APPTHQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPSPTY-SPPPPTYSPPPPSPIY 298

Query: 231 SPPPPSYYSPSP---KVEYKSPPPPSYSPSP 314
           SPPPP+ YSPSP        SPPPP+YSP P
Sbjct: 299 SPPPPA-YSPSPPPTPTPTFSPPPPAYSPPP 328

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 54/142 (38%), Positives = 61/142 (42%), Gaps = 38/142 (26%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPY---------YSPSPKVY----YKSPPHPHVCVCP--------PPP 119
           R SP   +  PPPP          YSPSP+V     Y  PP  HV   P        P P
Sbjct: 168 RPSPPSRHGHPPPPTYAQPPPTPIYSPSPQVQPPPTYSPPPPTHVQPTPSPPSRGHQPQP 227

Query: 120 PCYSPSPKVVYKSPP----------PPYVYNSPPPPYYSPSPKVYYKSP-------PPPS 248
           P +  +P     +PP          PP     P PP YSP P  Y +SP       PPP 
Sbjct: 228 PTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPSPTYSPPPP 287

Query: 249 YYSPSPKVEYKSPPPPSYSPSP 314
            YSP P     SPPPP+YSPSP
Sbjct: 288 TYSPPPPSPIYSPPPPAYSPSP 309

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/106 (41%), Positives = 51/106 (48%), Gaps = 9/106 (8%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPP--------PCYSPSPKVVYKSPPPPYVYNS 185
           SPPPP   P P  +  SPP P     PPPP        P Y   P     SPPPP   +S
Sbjct: 489 SPPPPQVQPLPPTF--SPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPPRQIHS 546

Query: 186 PPPPYYSP-SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           PPPP++ P +P   Y  PP P  +S  P  +  SPPPP   P P T
Sbjct: 547 PPPPHWQPRTPTPTYGQPPSPPTFSAPPPRQIHSPPPPHRQPRPPT 592

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/123 (37%), Positives = 53/123 (43%), Gaps = 18/123 (14%)
 Frame = +3

Query: 12  PKVYYKSPPP------PYYSPSPKVYYKSPPHPH--------VCVCPPPPPCYSPSPKVV 149
           P   Y  PPP      P +SP P      PP PH            PP PP +SP P   
Sbjct: 484 PSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPPRQ 543

Query: 150 YKSPPPPYVYNSPPPPYYS--PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS--PSPK 317
             SPPPP+     P P Y   PSP   + +PPP   +SP P      PP P+Y   PSP 
Sbjct: 544 IHSPPPPHWQPRTPTPTYGQPPSPPT-FSAPPPRQIHSPPPPHRQPRPPTPTYGQPPSPP 602

Query: 318 TEY 326
           T Y
Sbjct: 603 TTY 605

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/125 (35%), Positives = 54/125 (43%), Gaps = 21/125 (16%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPK-------VYYKSPPHPHVCVCPP-----------PPPCYSP 134
           SP +    PPP Y +P P         + + PP P     PP           PP    P
Sbjct: 110 SPVISPSHPPPSYGAPPPSHGPGHLPSHGQRPPSPSHGHAPPSGGHTPPRGQHPPSHRRP 169

Query: 135 SPKVVYKSPPPPYVYNSPPPPYYSPSPKVY---YKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           SP   +  PPPP     PP P YSPSP+V      SPPPP++  P+P     SPP   + 
Sbjct: 170 SPPSRHGHPPPPTYAQPPPTPIYSPSPQVQPPPTYSPPPPTHVQPTP-----SPPSRGHQ 224

Query: 306 PSPKT 320
           P P T
Sbjct: 225 PQPPT 229

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 38/101 (37%), Positives = 46/101 (45%), Gaps = 11/101 (10%)
 Frame = +3

Query: 33  PPPPYYSPSPKV-YYKSPPHPHVCVCPPPPPCYSP--------SPKVVYKSPPPPYVYNS 185
           PPPP+  P P    Y  PP P     PPP   +SP        +P   Y  PP P  +++
Sbjct: 513 PPPPHRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPPHWQPRTPTPTYGQPPSPPTFSA 572

Query: 186 PPP-PYYSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSY 302
           PPP   +SP P      PP P+Y   PSP   Y  P PP Y
Sbjct: 573 PPPRQIHSPPPPHRQPRPPTPTYGQPPSPPTTYSPPSPPPY 613

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/122 (34%), Positives = 52/122 (42%), Gaps = 26/122 (21%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPH-----PHVCVCPPPPPCYSPS-PKVVYKSPPP-------PYV 176
           PPP +   P      PPH     P     PPP P  SPS P   Y +PPP       P  
Sbjct: 78  PPPSHGHLPPSVGGPPPHRGHLPPSRGFNPPPSPVISPSHPPPSYGAPPPSHGPGHLPSH 137

Query: 177 YNSPPPPYYSPSPKVYYKSPP----PPSYYSPSPKVEYKSPPPPSY---------SPSPK 317
              PP P +  +P     +PP    PPS+  PSP   +  PPPP+Y         SPSP+
Sbjct: 138 GQRPPSPSHGHAPPSGGHTPPRGQHPPSHRRPSPPSRHGHPPPPTYAQPPPTPIYSPSPQ 197

Query: 318 TE 323
            +
Sbjct: 198 VQ 199

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 40/123 (32%), Positives = 52/123 (42%), Gaps = 27/123 (21%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPK-------VVYKSPPPPYVYNSP- 188
           PPP      P   +  PP P +    PPP   +P P           + PP P   ++P 
Sbjct: 92  PPPHRGHLPPSRGFNPPPSPVISPSHPPPSYGAPPPSHGPGHLPSHGQRPPSPSHGHAPP 151

Query: 189 -----------PPPYYSPSPKVYYKSPPPPSY--------YSPSPKVEYKSPPPPSYSPS 311
                      PP +  PSP   +  PPPP+Y        YSPSP+V+    PPP+YSP 
Sbjct: 152 SGGHTPPRGQHPPSHRRPSPPSRHGHPPPPTYAQPPPTPIYSPSPQVQ----PPPTYSPP 207

Query: 312 PKT 320
           P T
Sbjct: 208 PPT 210

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 31/77 (40%), Positives = 36/77 (46%), Gaps = 3/77 (3%)
 Frame = +3

Query: 30  SPPPPYYSP-SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP++ P +P   Y  PP P     PPP   +         SPPPP+    PP P Y 
Sbjct: 546 SPPPPHWQPRTPTPTYGQPPSPPTFSAPPPRQIH---------SPPPPHRQPRPPTPTYG 596

Query: 207 --PSPKVYYKSPPPPSY 251
             PSP   Y  P PP Y
Sbjct: 597 QPPSPPTTYSPPSPPPY 613

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 39/126 (30%), Positives = 51/126 (40%), Gaps = 31/126 (24%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHV--CVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS- 206
           P P ++P P+  Y  P H H+   V  PPP      P   +  PP P +  S PPP Y  
Sbjct: 66  PSPRHAP-PRHAYPPPSHGHLPPSVGGPPPHRGHLPPSRGFNPPPSPVISPSHPPPSYGA 124

Query: 207 -----------------PSPKVYYKSPP-----------PPSYYSPSPKVEYKSPPPPSY 302
                            PSP  +  +PP           PPS+  PSP   +  PPPP+Y
Sbjct: 125 PPPSHGPGHLPSHGQRPPSPS-HGHAPPSGGHTPPRGQHPPSHRRPSPPSRHGHPPPPTY 183

Query: 303 SPSPKT 320
           +  P T
Sbjct: 184 AQPPPT 189

[67][TOP]
>UniRef100_Q5ZB68 Os01g0594300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5ZB68_ORYSJ
          Length = 551

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/102 (52%), Positives = 59/102 (57%), Gaps = 3/102 (2%)
 Frame = +3

Query: 18  VYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS--PP 191
           VYY SPPPPYY  SP+  Y SPP P      PPPP Y  SP+  Y SPPPP  Y    PP
Sbjct: 450 VYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPP 509

Query: 192 PPYYSPSPKVYYKSPPPPSYYS-PSPKVEYKSPPPPSYSPSP 314
           PP Y  SP+  Y SPPPPS      P  EY SPPPP+ +  P
Sbjct: 510 PPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 551

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/104 (49%), Positives = 57/104 (54%), Gaps = 5/104 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPH----VCVCPPPPPCYSPSPKVVYKSPPPPYVYN-SPPP 194
           SPPPP  SPSP      PP P     V    PPPP Y  SP+  Y SPPPP  Y+ +PPP
Sbjct: 426 SPPPP--SPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPPP 483

Query: 195 PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PYY  SP+  Y SPPPP  Y  +P      PPPP Y  SP+  Y
Sbjct: 484 PYYEVSPEDRYLSPPPPPAYQETP------PPPPQYEVSPEDRY 521

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/108 (47%), Positives = 55/108 (50%), Gaps = 6/108 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPK--VVYKSPPPPYVYNSPPPPY 200
           SPPPP  SP P      SPP P     PP PP  SP P   V Y SPPPPY   SP   Y
Sbjct: 409 SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRY 468

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP---SYSPSPKTEY*IS 335
            SP P   Y   PPP YY  SP+  Y SPPPP     +P P  +Y +S
Sbjct: 469 LSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVS 516

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/105 (49%), Positives = 55/105 (52%), Gaps = 1/105 (0%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP 194
           K    SPPPP  SP P     SPP P     PP PP   PSP     SPPPP    SPPP
Sbjct: 394 KFVLPSPPPP--SPPPP----SPPPPSPSPPPPSPP--PPSPPPPSPSPPPP----SPPP 441

Query: 195 PYYSPSPKVYYKSPPPPSYYSPSPKVEYKS-PPPPSYSPSPKTEY 326
           P   P   VYY SPPPP YY  SP+  Y S PPPP+Y  +P   Y
Sbjct: 442 PSPPPPSPVYYSSPPPP-YYEVSPEDRYLSPPPPPAYHEAPPPPY 485

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/72 (50%), Positives = 42/72 (58%), Gaps = 10/72 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCV-CPPPPPCYSPSPKVVYKSPPPP------ 170
           P  Y+++PPPPYY  SP+  Y SPP P      PPPPP Y  SP+  Y SPPPP      
Sbjct: 474 PPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPPSPVKWK 533

Query: 171 ---YVYNSPPPP 197
              Y Y+SPPPP
Sbjct: 534 LPVYEYSSPPPP 545

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 38/84 (45%), Positives = 38/84 (45%)
 Frame = +3

Query: 102 VCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYK 281
           V P PPP           SPPPP    SPPPP  SP P     SPPPPS   PSP     
Sbjct: 396 VLPSPPP----------PSPPPP----SPPPPSPSPPPP----SPPPPSPPPPSPSPPPP 437

Query: 282 SPPPPSYSPSPKTEY*ISRLPLYE 353
           SPPPPS  P     Y     P YE
Sbjct: 438 SPPPPSPPPPSPVYYSSPPPPYYE 461

[68][TOP]
>UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=O81765_ARATH
          Length = 699

 Score =  105 bits (262), Expect = 2e-21
 Identities = 55/107 (51%), Positives = 61/107 (57%), Gaps = 5/107 (4%)
 Frame = +3

Query: 9   SPKVYYKSPPP-PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           SP    +SPPP P  SP P VY  SPP P   V  PPPP +SP P  VY  PPPP   +S
Sbjct: 510 SPVTKRRSPPPAPVNSPPPPVY--SPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHS 567

Query: 186 PPPPYYSPSPKVYYKSP----PPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP +SP P VY   P    PPP  +SP P     SPPPP +SP P
Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPP 614

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/100 (51%), Positives = 57/100 (57%), Gaps = 5/100 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP +SP P VY  SPP P   V  PPPP +SP P     SPPPP     PPPP YSP
Sbjct: 567 SPPPPVFSPPPPVY--SPPPP---VHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSP 621

Query: 210 SPKVYYKSPP----PPSYYSPSPK-VEYKSPPPPSYSPSP 314
            P V+  SPP    PP  YSP P+  +  SPP  S  P+P
Sbjct: 622 PPPVF--SPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAP 659

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 50/114 (43%), Positives = 59/114 (51%), Gaps = 10/114 (8%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY  SPPPP +SP P V+   PP P   V  PPPP +SP        PPPP VY SPP
Sbjct: 577 PPVY--SPPPPVHSPPPPVHSPPPPAP---VHSPPPPVHSP--------PPPPPVY-SPP 622

Query: 192 PPYYSP----SPKVYYKSPP------PPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           PP +SP    SP V Y  PP       P   SP P    K   PP+++P+P  +
Sbjct: 623 PPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAPAPSDD 676

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 49/120 (40%), Positives = 59/120 (49%), Gaps = 21/120 (17%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP---PPYVY 179
           SP     SPPPP +SP P     SPP P V   PPPPP YSP P  V+  PP   PP VY
Sbjct: 581 SPPPPVHSPPPPVHSPPPPAPVHSPP-PPVHSPPPPPPVYSPPPP-VFSPPPSQSPPVVY 638

Query: 180 NSPP-------PPYYSPSPKVYYKSPPPPSYYSPSPK-----------VEYKSPPPPSYS 305
           + PP       PP  SP P    K   PP+ ++P+P             +Y SPPPP ++
Sbjct: 639 SPPPRPPKINSPPVQSPPPAPVEKKETPPA-HAPAPSDDEFIIPPFIGHQYASPPPPMFA 697

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/113 (40%), Positives = 51/113 (45%), Gaps = 19/113 (16%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYY---KSPPHPHVCVCPPPPPCYSPSPKVVY-KSP------PPPYVYN 182
           P  P + PSP +     K  P P   V  P PP  SP P   Y +SP      PPP   N
Sbjct: 465 PTTPVHEPSPVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVN 524

Query: 183 SPPPPYYSP---------SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           SPPPP YSP          P   +  PPPP Y  P P     SPPPP +SP P
Sbjct: 525 SPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPP 577

[69][TOP]
>UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9EXV1_ORYSJ
          Length = 532

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/102 (52%), Positives = 59/102 (57%), Gaps = 3/102 (2%)
 Frame = +3

Query: 18  VYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS--PP 191
           VYY SPPPPYY  SP+  Y SPP P      PPPP Y  SP+  Y SPPPP  Y    PP
Sbjct: 431 VYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPP 490

Query: 192 PPYYSPSPKVYYKSPPPPSYYS-PSPKVEYKSPPPPSYSPSP 314
           PP Y  SP+  Y SPPPPS      P  EY SPPPP+ +  P
Sbjct: 491 PPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 532

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/104 (49%), Positives = 57/104 (54%), Gaps = 5/104 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPH----VCVCPPPPPCYSPSPKVVYKSPPPPYVYN-SPPP 194
           SPPPP  SPSP      PP P     V    PPPP Y  SP+  Y SPPPP  Y+ +PPP
Sbjct: 407 SPPPP--SPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPPP 464

Query: 195 PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PYY  SP+  Y SPPPP  Y  +P      PPPP Y  SP+  Y
Sbjct: 465 PYYEVSPEDRYLSPPPPPAYQETP------PPPPQYEVSPEDRY 502

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/108 (47%), Positives = 55/108 (50%), Gaps = 6/108 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPK--VVYKSPPPPYVYNSPPPPY 200
           SPPPP  SP P      SPP P     PP PP  SP P   V Y SPPPPY   SP   Y
Sbjct: 390 SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRY 449

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP---SYSPSPKTEY*IS 335
            SP P   Y   PPP YY  SP+  Y SPPPP     +P P  +Y +S
Sbjct: 450 LSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVS 497

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 51/101 (50%), Positives = 54/101 (53%), Gaps = 2/101 (1%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHV-CVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP  SPSP      PP P      PPPP    PSP     SPPPP    SPPPP   
Sbjct: 373 SPPPP--SPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP----SPPPPSPP 426

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKS-PPPPSYSPSPKTEY 326
           P   VYY SPPPP YY  SP+  Y S PPPP+Y  +P   Y
Sbjct: 427 PPSPVYYSSPPPP-YYEVSPEDRYLSPPPPPAYHEAPPPPY 466

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 54/107 (50%), Positives = 55/107 (51%), Gaps = 3/107 (2%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP---SPKVVYKSPPPPYVYNS 185
           K    SPPPP  SP P     SPP P     PP PP  SP   SP     SPPPP    S
Sbjct: 356 KFVLPSPPPPPPSPPPP----SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP----S 407

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPPP  SP P     SPPPPS   PSP V Y SPPPP Y  SP+  Y
Sbjct: 408 PPPPSPSPPPP----SPPPPSPPPPSP-VYYSSPPPPYYEVSPEDRY 449

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/72 (50%), Positives = 42/72 (58%), Gaps = 10/72 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCV-CPPPPPCYSPSPKVVYKSPPPP------ 170
           P  Y+++PPPPYY  SP+  Y SPP P      PPPPP Y  SP+  Y SPPPP      
Sbjct: 455 PPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPPSPVKWK 514

Query: 171 ---YVYNSPPPP 197
              Y Y+SPPPP
Sbjct: 515 LPVYEYSSPPPP 526

[70][TOP]
>UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa
           RepID=Q8L3T8_ORYSJ
          Length = 570

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/102 (52%), Positives = 59/102 (57%), Gaps = 3/102 (2%)
 Frame = +3

Query: 18  VYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS--PP 191
           VYY SPPPPYY  SP+  Y SPP P      PPPP Y  SP+  Y SPPPP  Y    PP
Sbjct: 469 VYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPP 528

Query: 192 PPYYSPSPKVYYKSPPPPSYYS-PSPKVEYKSPPPPSYSPSP 314
           PP Y  SP+  Y SPPPPS      P  EY SPPPP+ +  P
Sbjct: 529 PPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 570

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/104 (49%), Positives = 57/104 (54%), Gaps = 5/104 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPH----VCVCPPPPPCYSPSPKVVYKSPPPPYVYN-SPPP 194
           SPPPP  SPSP      PP P     V    PPPP Y  SP+  Y SPPPP  Y+ +PPP
Sbjct: 445 SPPPP--SPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPPP 502

Query: 195 PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PYY  SP+  Y SPPPP  Y  +P      PPPP Y  SP+  Y
Sbjct: 503 PYYEVSPEDRYLSPPPPPAYQETP------PPPPQYEVSPEDRY 540

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/108 (47%), Positives = 55/108 (50%), Gaps = 6/108 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPK--VVYKSPPPPYVYNSPPPPY 200
           SPPPP  SP P      SPP P     PP PP  SP P   V Y SPPPPY   SP   Y
Sbjct: 428 SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRY 487

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP---SYSPSPKTEY*IS 335
            SP P   Y   PPP YY  SP+  Y SPPPP     +P P  +Y +S
Sbjct: 488 LSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVS 535

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 51/101 (50%), Positives = 54/101 (53%), Gaps = 2/101 (1%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHV-CVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP  SPSP      PP P      PPPP    PSP     SPPPP    SPPPP   
Sbjct: 411 SPPPP--SPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP----SPPPPSPP 464

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKS-PPPPSYSPSPKTEY 326
           P   VYY SPPPP YY  SP+  Y S PPPP+Y  +P   Y
Sbjct: 465 PPSPVYYSSPPPP-YYEVSPEDRYLSPPPPPAYHEAPPPPY 504

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 54/107 (50%), Positives = 55/107 (51%), Gaps = 3/107 (2%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP---SPKVVYKSPPPPYVYNS 185
           K    SPPPP  SP P     SPP P     PP PP  SP   SP     SPPPP    S
Sbjct: 394 KFVLPSPPPPPPSPPPP----SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP----S 445

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPPP  SP P     SPPPPS   PSP V Y SPPPP Y  SP+  Y
Sbjct: 446 PPPPSPSPPPP----SPPPPSPPPPSP-VYYSSPPPPYYEVSPEDRY 487

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/72 (50%), Positives = 42/72 (58%), Gaps = 10/72 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCV-CPPPPPCYSPSPKVVYKSPPPP------ 170
           P  Y+++PPPPYY  SP+  Y SPP P      PPPPP Y  SP+  Y SPPPP      
Sbjct: 493 PPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPPSPVKWK 552

Query: 171 ---YVYNSPPPP 197
              Y Y+SPPPP
Sbjct: 553 LPVYEYSSPPPP 564

[71][TOP]
>UniRef100_C6TK91 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TK91_SOYBN
          Length = 146

 Score =  105 bits (261), Expect = 2e-21
 Identities = 58/103 (56%), Positives = 61/103 (59%), Gaps = 2/103 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSP-SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           P  YY  P PP Y   +P  YYKSPP+ +      PPP   PSP     SPPPPYVY SP
Sbjct: 33  PSNYYPHPTPPTYRQINPPYYYKSPPYYY----KSPPP---PSP-----SPPPPYVYKSP 80

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPK-VEYKSPPPPSYSPSP 314
           PPP  SP P   YKSPPPPS   P P    YKSPPPPS SPSP
Sbjct: 81  PPPSPSPPPPYIYKSPPPPSPSPPPPSPYVYKSPPPPSPSPSP 123

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 53/99 (53%), Positives = 54/99 (54%), Gaps = 1/99 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY-SPSPKVVYKSPPPPYVYNS 185
           SP  YYKSPPPP  SP P   YKSPP P     PPPP  Y SP P      PP PYVY S
Sbjct: 56  SPPYYYKSPPPPSPSPPPPYVYKSPPPPSPS--PPPPYIYKSPPPPSPSPPPPSPYVYKS 113

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PPPP  SPSP   +  PPP   Y       Y SPPPP Y
Sbjct: 114 PPPPSPSPSPPPSHSPPPPHHPYL------YNSPPPPVY 146

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/95 (52%), Positives = 52/95 (54%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKV 221
           PYY   P  YY     PH    P PP     +P   YKSPP  Y Y SPPPP  SP P  
Sbjct: 28  PYYG-QPSNYY-----PH----PTPPTYRQINPPYYYKSPP--YYYKSPPPPSPSPPPPY 75

Query: 222 YYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            YKSPPPPS  SP P   YKSPPPPS SP P + Y
Sbjct: 76  VYKSPPPPSP-SPPPPYIYKSPPPPSPSPPPPSPY 109

[72][TOP]
>UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis
           thaliana RepID=Q9XIL9_ARATH
          Length = 727

 Score =  104 bits (260), Expect = 3e-21
 Identities = 55/107 (51%), Positives = 62/107 (57%), Gaps = 5/107 (4%)
 Frame = +3

Query: 9   SPKVYYKSPPPP-YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           SP  + +SPPPP  +SP P     SPP P V   PPPPP YSP P     SPPPP   +S
Sbjct: 485 SPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHS 544

Query: 186 PPPPYYSPSPKVYYKSP----PPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP +SP P V+   P    PPP  +SP P V   SPPPP YSP P
Sbjct: 545 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVH--SPPPPVYSPPP 589

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 55/109 (50%), Positives = 62/109 (56%), Gaps = 8/109 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPP--HPHVCVCPPPPPCYSPSPKV------VYKSPPP 167
           P VY   PPPP +SP P V+   PP   P   V  PPPP +SP P V      VY  PPP
Sbjct: 531 PPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 590

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P   +SPPPP +SP P V+  SPPPP  YSP P     SPPPP +SP P
Sbjct: 591 P--VHSPPPPVHSPPPPVH--SPPPP-VYSPPPPPPVHSPPPPVFSPPP 634

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 56/102 (54%), Positives = 60/102 (58%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP +SP P V+  SPP P     PPPPP +SP P V   SPPPP    SP
Sbjct: 558 SPPPPVHSPPPPVHSPPPPVH--SPPPP--VYSPPPPPVHSPPPPV--HSPPPPVH--SP 609

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP YSP P     SPPPP  +SP P V   SPPPP YSP P
Sbjct: 610 PPPVYSPPPPPPVHSPPPP-VFSPPPPVH--SPPPPVYSPPP 648

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 54/115 (46%), Positives = 61/115 (53%), Gaps = 4/115 (3%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPP----HPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           P   Y  PPPP +SP P V+   PP     P V   PPPPP +SP P V   SPPPP   
Sbjct: 581 PPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVF--SPPPPV-- 636

Query: 180 NSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           +SPPPP YSP P VY  SPPPP   SP P   Y  P  P    SP T+  ++  P
Sbjct: 637 HSPPPPVYSPPPPVY--SPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPP 689

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/111 (46%), Positives = 61/111 (54%), Gaps = 8/111 (7%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPY-------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP 164
           ++P   +K  PP         Y  SP  + +SPP P V   PPP P +SP P  VY  PP
Sbjct: 461 STPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPP 520

Query: 165 PPYVYN-SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP VY+  PPPP YSP P     SPPPP  +SP P V   SPPPP +SP P
Sbjct: 521 PPPVYSPPPPPPVYSPPPPPPVHSPPPP-VHSPPPPVH--SPPPPVHSPPP 568

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 55/119 (46%), Positives = 61/119 (51%), Gaps = 13/119 (10%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV------VYKSPPPP 170
           SP     SPPPP +SP P VY   PP P   V  PPPP +SP P V      VY SPPPP
Sbjct: 594 SPPPPVHSPPPPVHSPPPPVYSPPPPPP---VHSPPPPVFSPPPPVHSPPPPVY-SPPPP 649

Query: 171 YVYNSPPPPYYSPSPKVYYKSPP--PPSYYSPSPKVEYKSPPP--PSY---SPSPKTEY 326
              + PPPP  SP P   Y SPP  PP   SP  +    SPPP  PS    +P P  E+
Sbjct: 650 VY-SPPPPPVKSPPPPPVY-SPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEF 706

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 52/139 (37%), Positives = 58/139 (41%), Gaps = 45/139 (32%)
 Frame = +3

Query: 33  PPPPYYSPSPK-VYYKSP------------PHPHVCVCPPP------------------- 116
           P PP  SP P   Y +SP            PH HV   PPP                   
Sbjct: 409 PQPPKESPQPNDPYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHK 468

Query: 117 --PPCYSPSPKVVY--------KSPPPPYVYNSPPP-PYYSPSPKVYYKSPPPPSYYSPS 263
             PP  SP P   Y        +SPPPP V++ PPP P +SP P   Y  PPPP  YSP 
Sbjct: 469 PQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPP 528

Query: 264 PKVEYKSPPPPS--YSPSP 314
           P     SPPPP   +SP P
Sbjct: 529 PPPPVYSPPPPPPVHSPPP 547

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 44/115 (38%), Positives = 52/115 (45%), Gaps = 9/115 (7%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP-------PPCYSPSPKVVYKSPPP 167
           SP  + +SPPPP             PH HV   PPP       PP +S +P  V+K P P
Sbjct: 425 SPVKFRRSPPPP-----------QQPHHHVVHSPPPASSPPTSPPVHS-TPSPVHK-PQP 471

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS--YSPSPKTEY 326
           P     P  PY   SP  + +SPPPP  +SP P     SPPPP     P P   Y
Sbjct: 472 PKESPQPNDPY-DQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVY 525

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 44/125 (35%), Positives = 51/125 (40%), Gaps = 45/125 (36%)
 Frame = +3

Query: 75  KSP-PHPHVCVCPPPPPCYSPSPKVVY--------KSPPPP-----YVYNSPPP------ 194
           KSP P P   V  P PP  SP P   Y        +SPPPP     +V +SPPP      
Sbjct: 396 KSPSPVPTRPVHKPQPPKESPQPNDPYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSPPT 455

Query: 195 ---------PYYSP---------------SPKVYYKSPPPPSYYSPSPKVEYKSPPPPS- 299
                    P + P               SP  + +SPPPP  +SP P     SPPPP  
Sbjct: 456 SPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPV 515

Query: 300 YSPSP 314
           YSP P
Sbjct: 516 YSPPP 520

[73][TOP]
>UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RZI2_RICCO
          Length = 829

 Score =  103 bits (258), Expect = 5e-21
 Identities = 58/105 (55%), Positives = 61/105 (58%), Gaps = 3/105 (2%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP---SPKVVYKSPPPPYVY 179
           SP    +SPPPP  SP P VY   PP P   V  PPPP YSP   SP     SPPPP   
Sbjct: 648 SPPPPTQSPPPPVNSPPPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPPV-- 705

Query: 180 NSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           +SPPPP +SP P VY  SPPPPS   PSP     SPPPP YSP P
Sbjct: 706 HSPPPPVHSPPPPVY--SPPPPS--PPSPPPPMHSPPPPVYSPPP 746

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/123 (44%), Positives = 61/123 (49%), Gaps = 26/123 (21%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV------VYK------------ 155
            SPPPP +SP P VY   PP P   V  PPPP +SP P V      VY             
Sbjct: 674  SPPPPVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPSPPSPPPP 733

Query: 156  --SPPPPYV------YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
              SPPPP          SPPPP +SP P V+  SPPPP Y  P P+    SPPPP +SP 
Sbjct: 734  MHSPPPPVYSPPPPPVRSPPPPVHSPPPPVH--SPPPPIYSPPPPRF---SPPPPRFSPP 788

Query: 312  PKT 320
            P T
Sbjct: 789  PPT 791

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 50/110 (45%), Positives = 58/110 (52%), Gaps = 7/110 (6%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP---PPPPCYSPSPKVVYKSPPPPYVY 179
            SP     SPPPP +SP P VY   PP P     P   PPPP YSP P  V +SPPPP   
Sbjct: 700  SPPPPVHSPPPPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPPPPPV-RSPPPPV-- 756

Query: 180  NSPPPPYYSPSPKVYYKSPP----PPSYYSPSPKVEYKSPPPPSYSPSPK 317
            +SPPPP +SP P +Y   PP    PP  +SP P      P P   +P P+
Sbjct: 757  HSPPPPVHSPPPPIYSPPPPRFSPPPPRFSPPPPTSSPPPTPTVAAPPPE 806

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 44/99 (44%), Positives = 52/99 (52%), Gaps = 8/99 (8%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPP---HPHVCVCPPPPPCYSPSPKVVYKSPP---PPYVYNSPP 191
            SPPPP +SP P VY   PP    P   V  PPPP +SP P +    PP   PP    SPP
Sbjct: 729  SPPPPMHSPPPPVYSPPPPPVRSPPPPVHSPPPPVHSPPPPIYSPPPPRFSPPPPRFSPP 788

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKV--EYKSPPPPSY 302
            PP  SP P     +PPP  +  P P +  +Y SPPPP +
Sbjct: 789  PPTSSPPPTPTVAAPPPEDFILP-PNIGFQYSSPPPPMF 826

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 47/100 (47%), Positives = 51/100 (51%), Gaps = 6/100 (6%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCP------PPPPCYSPSPKVVYKSPPPPYVYNSPPP 194
           P  P  +PSP+    SP  P +   P      PPP     SP    +SPPPP    SPPP
Sbjct: 601 PQSPTSTPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPPPPT--QSPPP 658

Query: 195 PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P  SP P VY  SPPPP   SP P V   SPPPP YSP P
Sbjct: 659 PVNSPPPPVY--SPPPP---SPPPPVH--SPPPPVYSPPP 691

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 43/107 (40%), Positives = 48/107 (44%), Gaps = 5/107 (4%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCV-CPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           SP      P  P  SPSP+ Y  S P P       P  P  +PSP+    SP  P +  S
Sbjct: 567 SPSPEPSEPTSPTTSPSPE-YNSSEPSPTPSPESEPQSPTSTPSPESPLSSPTSPTLEQS 625

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSP----SPKVEYKSPPPPSYSPSP 314
           P PP  SP P    +SP PP    P    SP     SPPPP YSP P
Sbjct: 626 PSPPGQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVNSPPPPVYSPPP 672

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/83 (43%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP +SP P +Y  SPP P      PPPP +SP P     SPPP     +P
Sbjct: 751 SPPPPVHSPPPPVHSPPPPIY--SPPPPRFS---PPPPRFSPPPPT--SSPPPTPTVAAP 803

Query: 189 PPPYYSPSPKV--YYKSPPPPSY 251
           PP  +   P +   Y SPPPP +
Sbjct: 804 PPEDFILPPNIGFQYSSPPPPMF 826

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 44/123 (35%), Positives = 56/123 (45%), Gaps = 17/123 (13%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPY--YSPSPKV-----YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP 164
           +SP+    S P P   Y P+P       Y  +P  P+V   P P   Y P+P     SPP
Sbjct: 404 SSPRPSTPSVPTPSTPYVPTPSTPPSTSYGPTPSTPYV---PTPSTPYVPTPSTPSPSPP 460

Query: 165 PPYV--YNSPPPPYYSPSPKVYYKSP---PPPS-----YYSPSPKVEYKSPPPPSYSPSP 314
              V    +P    Y+PSP  + +SP   P PS       SPSP  E   P PP+ SPSP
Sbjct: 461 QQEVPTPQTPSSEPYNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSP 520

Query: 315 KTE 323
            +E
Sbjct: 521 SSE 523

[74][TOP]
>UniRef100_A9SW33 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SW33_PHYPA
          Length = 284

 Score =  102 bits (255), Expect = 1e-20
 Identities = 61/99 (61%), Positives = 65/99 (65%), Gaps = 6/99 (6%)
 Frame = +3

Query: 39  PPYYSPSPKVYYKSPPH-PHVCVCPPPPPCYSPSPKVVYKSPPPPY-----VYNSPPPPY 200
           PPY SPSP   Y+SPP+ P      PP P YSPSP  VYKSPP P      VY SPP P 
Sbjct: 147 PPYASPSP--VYESPPYSPSPVYKSPPSPTYSPSP--VYKSPPSPTYSPSPVYKSPPSPT 202

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           YSPSP   YKSPP P+Y SPSP   YKSPP PSYSPSP+
Sbjct: 203 YSPSP--VYKSPPSPTY-SPSPV--YKSPPSPSYSPSPQ 236

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 54/92 (58%), Positives = 55/92 (59%), Gaps = 5/92 (5%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY----- 173
           SP   YKSPP P YSPSP   YKS          PP P YSPSP  VYKSPP P      
Sbjct: 162 SPSPVYKSPPSPTYSPSP--VYKS----------PPSPTYSPSP--VYKSPPSPTYSPSP 207

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPK 269
           VY SPP P YSPSP   YKSPP PS YSPSP+
Sbjct: 208 VYKSPPSPTYSPSP--VYKSPPSPS-YSPSPQ 236

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 53/89 (59%), Positives = 58/89 (65%), Gaps = 8/89 (8%)
 Frame = +3

Query: 72  YKSPPHPHVCVCPPPP--PCY-SP---SPKVVYKSPP--PPYVYNSPPPPYYSPSPKVYY 227
           +K P  P +  CPPPP  P Y SP   SP  VY+SPP  P  VY SPP P YSPSP   Y
Sbjct: 124 FKLPKLPTLPSCPPPPESPVYESPPYASPSPVYESPPYSPSPVYKSPPSPTYSPSP--VY 181

Query: 228 KSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           KSPP P+ YSPSP   YKSPP P+YSPSP
Sbjct: 182 KSPPSPT-YSPSP--VYKSPPSPTYSPSP 207

[75][TOP]
>UniRef100_Q06802 Extensin n=1 Tax=Nicotiana tabacum RepID=Q06802_TOBAC
          Length = 318

 Score =  102 bits (254), Expect = 1e-20
 Identities = 67/133 (50%), Positives = 72/133 (54%), Gaps = 17/133 (12%)
 Frame = +3

Query: 6   ASPKVYYKSPPPP-----YYSPSPKVY-YKSPPHPHVCVCPPPPPC-YSPSPKVVYKSPP 164
           +S    Y SPPPP     Y SP P V+ Y SPPH  V   PPPP   Y P    VYKSPP
Sbjct: 24  SSANYQYSSPPPPKKSYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYYPPHTPVYKSPP 83

Query: 165 PPY-VYNSPPP---PYYSPSPKVYYKSPPPPS--YYSPSPKVEYKSPPPPS----YSPSP 314
           PP  VY SPPP   PYY P   V YKSPPPP   YY P   V YKSPPPP+      P P
Sbjct: 84  PPTPVYKSPPPPKKPYYPPHTPV-YKSPPPPKKPYYPPHTPV-YKSPPPPTPVYKSPPPP 141

Query: 315 KTEY*ISRLPLYE 353
           K  Y     P+Y+
Sbjct: 142 KKPYYPPHTPVYK 154

 Score =  101 bits (251), Expect = 3e-20
 Identities = 66/125 (52%), Positives = 69/125 (55%), Gaps = 15/125 (12%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPPPC--YSPSPKVVYKSPPPPY-VYNS 185
           YKSPPPP   YY P   VY KSPP P      PPPP   Y P    VYKSPPPP  VY S
Sbjct: 107 YKSPPPPKKPYYPPHTPVY-KSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKS 165

Query: 186 PPP---PYYSPSPKVYYKSPPPPS--YYSPSPKVEYKSPPPPS----YSPSPKTEY*ISR 338
           PPP   PYY P   V YKSPPPP   YY P   V YKSPPPP+      P PK  Y    
Sbjct: 166 PPPHKKPYYPPHTPV-YKSPPPPKKPYYPPHTPV-YKSPPPPTPVYKSPPPPKKPYYPPH 223

Query: 339 LPLYE 353
            P+Y+
Sbjct: 224 TPVYK 228

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 67/142 (47%), Positives = 70/142 (49%), Gaps = 32/142 (22%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPPPCYS--PSPKVVYKSPPPPY----- 173
           YKSPPPP   Y SP     YKSPP P     PP  P Y   P P  VYKSPPPP      
Sbjct: 42  YKSPPPPVHVYPSPPHHPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYP 101

Query: 174 ----VYNSPPPP---YYSPSPKVY---------YKSPPPPS--YYSPSPKVEYKSPPPPS 299
               VY SPPPP   YY P   VY         YKSPPPP   YY P   V YKSPPPP+
Sbjct: 102 PHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPV-YKSPPPPT 160

Query: 300 ---YSPSP-KTEY*ISRLPLYE 353
               SP P K  Y     P+Y+
Sbjct: 161 PVYKSPPPHKKPYYPPHTPVYK 182

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 65/128 (50%), Positives = 67/128 (52%), Gaps = 27/128 (21%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPPPC--YSPSPKVVYKSPPPPY-VYNS 185
           YKSPPPP   YY P   VY KSPP P      PPPP   Y P    VYKSPPPP  VY S
Sbjct: 181 YKSPPPPKKPYYPPHTPVY-KSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKS 239

Query: 186 PPP---PYYSPSPKVY---------YKSPPPPS---YYSPS---PKVEYKSPPPPS---Y 302
           PPP   PYY P   VY         YKSPPPP    Y SP+   P   YKSPPPP+    
Sbjct: 240 PPPPKKPYYPPYTPVYKSPPPPTPVYKSPPPPKKPYYPSPTPYHPAPVYKSPPPPTPVYK 299

Query: 303 SPSPKTEY 326
           SP P   Y
Sbjct: 300 SPPPHHPY 307

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 69/154 (44%), Positives = 71/154 (46%), Gaps = 41/154 (26%)
 Frame = +3

Query: 12  PKVYYKSPPPP-----------YYSPSP--KVYYKSPPH------PHVCVC---PPPPPC 125
           P   YKSPPPP           Y SP P   VY   PPH      PH  V    PPP   
Sbjct: 131 PTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPHKKPYYPPHTPVYKSPPPPKKP 190

Query: 126 YSPSPKVVYKSPPPPY-VYNSPPP---PYYSPSPKVY---------YKSPPPPS--YYSP 260
           Y P    VYKSPPPP  VY SPPP   PYY P   VY         YKSPPPP   YY P
Sbjct: 191 YYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPP 250

Query: 261 SPKVEYKSPPPPS----YSPSPKTEY*ISRLPLY 350
              V YKSPPPP+      P PK  Y  S  P +
Sbjct: 251 YTPV-YKSPPPPTPVYKSPPPPKKPYYPSPTPYH 283

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 59/111 (53%), Positives = 60/111 (54%), Gaps = 15/111 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPPPC--YSPSPKVVYKSPPPPY- 173
           P   YKSPPPP   YY P   VY KSPP P      PPPP   Y P    VYKSPPPP  
Sbjct: 205 PTPVYKSPPPPKKPYYPPHTPVY-KSPPPPTPVYKSPPPPKKPYYPPYTPVYKSPPPPTP 263

Query: 174 VYNSPPPPY--YSPSPKVY-----YKSPPPPS--YYSPSPKVEYKSPPPPS 299
           VY SPPPP   Y PSP  Y     YKSPPPP+  Y SP P   Y    PPS
Sbjct: 264 VYKSPPPPKKPYYPSPTPYHPAPVYKSPPPPTPVYKSPPPHHPYVYASPPS 314

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 40/85 (47%), Positives = 41/85 (48%), Gaps = 21/85 (24%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPP--------------PCYS--P 134
           P   YKSPPPP   YY P   VY   PP   V   PPPP              P Y   P
Sbjct: 233 PTPVYKSPPPPKKPYYPPYTPVYKSPPPPTPVYKSPPPPKKPYYPSPTPYHPAPVYKSPP 292

Query: 135 SPKVVYKSPPP--PYVYNSPPPPYY 203
            P  VYKSPPP  PYVY SPP PY+
Sbjct: 293 PPTPVYKSPPPHHPYVYASPPSPYH 317

[76][TOP]
>UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859A1
          Length = 377

 Score =  102 bits (253), Expect = 2e-20
 Identities = 66/125 (52%), Positives = 68/125 (54%), Gaps = 19/125 (15%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY----SPSPKVY-YKSPPHPHVCVCPPPPPCYSPS--PKVVYKSPPP 167
           S   +Y SPPPPYY     P P VY YKSPP        PPPP YSP   P   YKSPPP
Sbjct: 31  SANYHYSSPPPPYYYKSPPPPPPVYKYKSPP--------PPPPVYSPPHHPPYKYKSPPP 82

Query: 168 P---YVYNSPPPP--YYSPS--PKVYYKSPPPPS-YYSPS--PKVEYKSPPPPS--YSPS 311
           P   Y Y SPPPP   YSP   P   YKSPPPP   YSP   P  +YKSPPPP   YSP 
Sbjct: 83  PPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPP 142

Query: 312 PKTEY 326
               Y
Sbjct: 143 HHPPY 147

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 62/115 (53%), Positives = 63/115 (54%), Gaps = 20/115 (17%)
 Frame = +3

Query: 12  PKVY-YKSPPPP-----YYSPSPKVY-YKSPPHPHVCVCPPPPPCYS------PSPKVVY 152
           P VY YKSPPPP     Y SP P  Y YKSPP P +    PPPP Y       P P   Y
Sbjct: 263 PPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKY 322

Query: 153 KSPPPP-YVYNSPPPPYYS-----PSPKVY-YKSPPPPSYYSPSPKVEYKSPPPP 296
           KSPPPP Y Y SPPPP Y      P P VY YKSPPPP      PK  Y SPPPP
Sbjct: 323 KSPPPPVYKYKSPPPPPYMYKSPPPPPPVYKYKSPPPPP-----PKYYYSSPPPP 372

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 63/145 (43%), Positives = 69/145 (47%), Gaps = 31/145 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPS------------PKVYYKSPPHPHVCV----CPPPPPCYS---P 134
           P  Y   PPPPY  PS            P   YKSPP P         PPPPP +S   P
Sbjct: 191 PYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPP 250

Query: 135 SPKVVYKSPPPP---YVYNSPPPPYYSPSPKVYYKSPPPPSY---YSPSPKVEYKSPPPP 296
            P   YKSPPPP   Y Y SPPP    PSP   YKSPPPP Y     P P ++YKSPPPP
Sbjct: 251 PPPYKYKSPPPPPPVYKYKSPPP----PSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPP 306

Query: 297 SYS------PSPKTEY*ISRLPLYE 353
            Y       P P  +Y     P+Y+
Sbjct: 307 PYKYKSPPPPPPVYKYKSPPPPVYK 331

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 67/155 (43%), Positives = 70/155 (45%), Gaps = 41/155 (26%)
 Frame = +3

Query: 3   RASPKVYYKSPPPP-----YYSPSPKVYYKSPPHP----HVCVCPPPPPCYS------PS 137
           ++ P   YKSPPPP     Y SP P     SPP P         PPPPP Y       PS
Sbjct: 216 KSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPS 275

Query: 138 PKVVYKSPPPP-YVYNSPPPP---YYSPSPKVY-------------YKSPPPP--SYYS- 257
           P   YKSPPPP Y Y SPPPP   Y SP P  Y             YKSPPPP   Y S 
Sbjct: 276 PPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSP 335

Query: 258 PSPKVEYKSPPPP------SYSPSPKTEY*ISRLP 344
           P P   YKSPPPP         P P  +Y  S  P
Sbjct: 336 PPPPYMYKSPPPPPPVYKYKSPPPPPPKYYYSSPP 370

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 60/126 (47%), Positives = 62/126 (49%), Gaps = 25/126 (19%)
 Frame = +3

Query: 12  PKVYYKSPPPP--YYSPS--PKVYYKSPPHPHVCVCPP------------PPPCYSPS-- 137
           P   YKSPPPP   YSP   P   YKSPP P     PP            PPP YSP   
Sbjct: 105 PPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHH 164

Query: 138 PKVVYKSPPPP--YV-YNSPPPPYYSPSPKVYYKSPPPPSYYSPS----PKVEYKSPPPP 296
           P   YKSPPPP     Y SPPPP+  P     YKSPPPP Y  PS     + EYKSPPP 
Sbjct: 165 PPYKYKSPPPPPPVYKYKSPPPPHKKP---YKYKSPPPPPYNLPSGTSADEYEYKSPPPY 221

Query: 297 SYSPSP 314
            Y   P
Sbjct: 222 KYKSPP 227

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 58/123 (47%), Positives = 61/123 (49%), Gaps = 25/123 (20%)
 Frame = +3

Query: 12  PKVY-YKSPPPP--YYSPS--PKVYYKSPPHPHVCVCPP------------PPPCYSPS- 137
           P VY YKSPPPP   YSP   P   YKSPP P     PP            PPP YSP  
Sbjct: 84  PPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPH 143

Query: 138 -PKVVYKSPPPPYVYNSPP--PPYY----SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            P   YKSPPPP    SPP  PPY      P P VY    PPP +  P    +YKSPPPP
Sbjct: 144 HPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKP---YKYKSPPPP 200

Query: 297 SYS 305
            Y+
Sbjct: 201 PYN 203

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 57/129 (44%), Positives = 60/129 (46%), Gaps = 28/129 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPP--YYSPS--PKVYYKSPPHPHVCVCPPPPPCYS------PSPKVVYKSP 161
           P   YKSPPPP   YSP   P   YKSPP P     PP  P Y       P P   YKSP
Sbjct: 125 PPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSP 184

Query: 162 PPP----YVYNSPPPPYYS------------PSPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
           PPP    Y Y SPPPP Y+             SP  Y    PPP    P P  +YKSPPP
Sbjct: 185 PPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPP----PPPVYKYKSPPP 240

Query: 294 PS--YSPSP 314
           P   +SP P
Sbjct: 241 PPPVHSPPP 249

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 49/102 (48%), Positives = 51/102 (50%), Gaps = 23/102 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYS----PSPKVYYKSPPHPHVCVC--PPPPPCYS------------- 131
           SP   YKSPPPP Y     P P + YKSPP P       PPPPP Y              
Sbjct: 275 SPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKS 334

Query: 132 -PSPKVVYKSPPPP---YVYNSPPPPYYSPSPKVYYKSPPPP 245
            P P  +YKSPPPP   Y Y SPPP    P PK YY SPPPP
Sbjct: 335 PPPPPYMYKSPPPPPPVYKYKSPPP----PPPKYYYSSPPPP 372

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 41/86 (47%), Positives = 42/86 (48%), Gaps = 5/86 (5%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYYS----PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV 176
           P VY YKSPPPP Y     P P   YKSP        PPPPP Y       YKSPPP   
Sbjct: 317 PPVYKYKSPPPPVYKYKSPPPPPYMYKSP--------PPPPPVYK------YKSPPP--- 359

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPSYY 254
              PPP YY  SP      PPPP +Y
Sbjct: 360 ---PPPKYYYSSP-----PPPPPHHY 377

[77][TOP]
>UniRef100_Q9LJ64 Extensin protein-like n=1 Tax=Arabidopsis thaliana
           RepID=Q9LJ64_ARATH
          Length = 956

 Score =  102 bits (253), Expect = 2e-20
 Identities = 53/102 (51%), Positives = 62/102 (60%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP +SP P V+  SPP P   V  PPPP  SP P  V+  PPP  +Y+ P
Sbjct: 698 SPPPPVHSPPPPVHSPPPPVH--SPPPP---VHSPPPPVQSPPPPPVFSPPPPAPIYSPP 752

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP +SP P V+  SPPPP  +SP P V   SPPPP +SP P
Sbjct: 753 PPPVHSPPPPVH--SPPPPPVHSPPPPVH--SPPPPVHSPPP 790

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 56/105 (53%), Positives = 66/105 (62%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP V+   PPPP +SP P V+  SPP P   +  PPPP YSP P V   SPPPP V+ SP
Sbjct: 641 SPPVHSPPPPPPVHSPPPPVF--SPPPP---MHSPPPPVYSPPPPV--HSPPPPPVH-SP 692

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           PPP +SP P V+  SPPPP  +SP P V   SPPPP +SP P  +
Sbjct: 693 PPPVHSPPPPVH--SPPPP-VHSPPPPVH--SPPPPVHSPPPPVQ 732

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 44/117 (37%), Positives = 54/117 (46%), Gaps = 13/117 (11%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP---PPPPCYSPSPKVVYKSPPPPYVYN 182
            P   Y  PPPP +SP P V+   PP  H    P   PPPP +SP P V   SPPPP    
Sbjct: 745  PAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPV--HSPPPPVHSP 802

Query: 183  SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP----------PSYSPSPKTE 323
             PP P YSP P V+   P P +   P+      +P P          P  +P+P +E
Sbjct: 803  PPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTPSSSESGEISTPVQAPTPDSE 859

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/101 (43%), Positives = 52/101 (51%), Gaps = 5/101 (4%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY-----SPSPKVVYKSPPPPYVYNSPP 191
           K   PP  SP P   Y + P       PP P        SP    V+  PPPP V+ SPP
Sbjct: 599 KMGSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVH-SPP 657

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP +SP P ++  SPPPP  YSP P V +  PPPP +SP P
Sbjct: 658 PPVFSPPPPMH--SPPPP-VYSPPPPV-HSPPPPPVHSPPP 694

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 42/116 (36%), Positives = 53/116 (45%), Gaps = 11/116 (9%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY-VYNS 185
            SP     SPPPP +SP P V+   PP P   +  PPPP +SP PK V   PP    + N+
Sbjct: 780  SPPPPVHSPPPPVHSPPPPVHSPPPPSP---IYSPPPPVFSPPPKPVTPLPPATSPMANA 836

Query: 186  PPP----------PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
            P P          P  +P+P       P  S +SP     +KS P PS    P+ E
Sbjct: 837  PTPSSSESGEISTPVQAPTPDSEDIEAPSDSNHSP----VFKSSPAPSPDSEPEVE 888

[78][TOP]
>UniRef100_Q39599 Extensin n=1 Tax=Catharanthus roseus RepID=Q39599_CATRO
          Length = 225

 Score =  102 bits (253), Expect = 2e-20
 Identities = 58/112 (51%), Positives = 64/112 (57%), Gaps = 10/112 (8%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY---SPSPKVVYKS-PPPPYVYNSP 188
           +Y SPPPP+YSP P  Y   PP P V   PPPPP +    P P  VYKS PPPPY Y SP
Sbjct: 15  HYSSPPPPHYSP-PYHYKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSP 73

Query: 189 PPPYYSPSPKVYYKSPPPPS--YYSPSP----KVEYKSPPPPSYSPSPKTEY 326
           PPP + P     YKSPPPP   Y SP P      +YKSPPPP   P    +Y
Sbjct: 74  PPPPHKP---YKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKY 122

 Score =  102 bits (253), Expect = 2e-20
 Identities = 63/136 (46%), Positives = 65/136 (47%), Gaps = 30/136 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPP----YYSPSPKVYYKSPPHPHVCVCPPPPPCYS--------------- 131
           SP  +YKSPPPP     Y P P  +YKSPP P      PPPP Y                
Sbjct: 25  SPPYHYKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYK 84

Query: 132 --PSPKVVYKSPPPP----YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
             P P  VYKSPPPP    Y Y SPPPP   P     YKSPPPP  Y P P V YKSPPP
Sbjct: 85  SPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKP-PYV-YKSPPP 142

Query: 294 PSY-----SPSPKTEY 326
           P        PSP   Y
Sbjct: 143 PPSVHKYPPPSPPPVY 158

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 66/130 (50%), Positives = 67/130 (51%), Gaps = 25/130 (19%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPKVY-YKSPPHP-----HVCVCPPPPPCY-SPSPK----VV 149
           P  +YKSPPPP   Y SP P  Y YKSPP P          PPPPP Y SP P       
Sbjct: 46  PPPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYK 105

Query: 150 YKSPPPP-------YVYNSPPPP-YYSPSPKVYYKSPPPPS---YYSPSPKVEYKSPPPP 296
           YKSPPPP       Y Y SPPPP  Y P P VY   PPPPS   Y  PSP   YKSPP  
Sbjct: 106 YKSPPPPPPPPHKPYKYKSPPPPPVYKP-PYVYKSPPPPPSVHKYPPPSPPPVYKSPP-- 162

Query: 297 SYSPSPKTEY 326
             SP PK  Y
Sbjct: 163 --SPPPKKPY 170

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 56/122 (45%), Positives = 58/122 (47%), Gaps = 21/122 (17%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSP--------SPKVYYKSPPHPH--VCVCPPPPPCYSPSPKVVYKSP 161
           P   YKSPPPP + P         P VY   PP PH       PPPP   P     YKSP
Sbjct: 66  PPYKYKSPPPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSP 125

Query: 162 P------PPYVYNSPPPP-----YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           P      PPYVY SPPPP     Y  PSP   YKSPP P    P    +YKSPPPP    
Sbjct: 126 PPPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSP---PPKKPYKYKSPPPPPIHK 182

Query: 309 SP 314
           SP
Sbjct: 183 SP 184

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 55/125 (44%), Positives = 58/125 (46%), Gaps = 31/125 (24%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPP------HPHVCVCPPPPPCY----SPSPKVVYKSPP--- 164
           YKSPPPP   P     YKSPP       P+V   PPPPP       PSP  VYKSPP   
Sbjct: 106 YKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPP 165

Query: 165 --PPYVYNSPPPP----------------YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP 290
              PY Y SPPPP                Y  P P   YKSPPPP +Y       Y SPP
Sbjct: 166 PKKPYKYKSPPPPPIHKSPLPSPPKKPYKYKYPPPTPVYKSPPPPHHYL------YTSPP 219

Query: 291 PPSYS 305
           PP Y+
Sbjct: 220 PPPYN 224

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 64/140 (45%), Positives = 67/140 (47%), Gaps = 43/140 (30%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVY----YKSPP-------HPHVCVCPPPPPCYSPSPKVVYKSP 161
           YKSPPPP   Y SP P  +    YKSPP        P+    PPPPP Y P    VYKSP
Sbjct: 83  YKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPP--YVYKSP 140

Query: 162 PPP-----YVYNSPPPPYYSP-SP---KVY-YKSPPPP---------------SYYSPSP 266
           PPP     Y   SPPP Y SP SP   K Y YKSPPPP                Y  P P
Sbjct: 141 PPPPSVHKYPPPSPPPVYKSPPSPPPKKPYKYKSPPPPPIHKSPLPSPPKKPYKYKYPPP 200

Query: 267 KVEYKSPPPPSY----SPSP 314
              YKSPPPP +    SP P
Sbjct: 201 TPVYKSPPPPHHYLYTSPPP 220

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 40/82 (48%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           SP   YKSPP P   P  K Y YKSPP P +   P P P   P     YK PPP  VY S
Sbjct: 153 SPPPVYKSPPSP---PPKKPYKYKSPPPPPIHKSPLPSP---PKKPYKYKYPPPTPVYKS 206

Query: 186 PPPPYYSPSPKVYYKSPPPPSY 251
           PPPP++       Y SPPPP Y
Sbjct: 207 PPPPHH-----YLYTSPPPPPY 223

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 30/57 (52%), Positives = 33/57 (57%), Gaps = 5/57 (8%)
 Frame = +3

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPP---SYYSPSPKVEYKSPPPPS--YSPSPKTEY 326
           Y Y+SPPPP+Y  SP  +YKSPPPP     Y P P   YKSPPPP   Y   P   Y
Sbjct: 14  YHYSSPPPPHY--SPPYHYKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPY 68

[79][TOP]
>UniRef100_Q43504 Extensin-like protein Dif10 (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q43504_SOLLC
          Length = 396

 Score =  101 bits (252), Expect = 2e-20
 Identities = 64/124 (51%), Positives = 66/124 (53%), Gaps = 26/124 (20%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY---SPSPKVYYKSP-PHPHVCVCPPPPPCY--SPSPKVVYKSPPP- 167
           SP  YYKSP P  Y   SPSP+ YYKSP P  H     P P  Y  SP+P   YKSP P 
Sbjct: 191 SPAKYYKSPAPSKYYYKSPSPRKYYKSPAPSKHYYYKSPSPSKYYKSPAPYKYYKSPAPQ 250

Query: 168 -----PYVYNSPPPP--YYSPSPKVYYKSPPPPSYYS----------PSP--KVEYKSPP 290
                P  Y SPPPP  YY  SP  YYKSPPPP YY           PSP  K  YKSPP
Sbjct: 251 KYYKSPVYYKSPPPPTTYYEKSPS-YYKSPPPPPYYKESTPYYKSPPPSPYYKESYKSPP 309

Query: 291 PPSY 302
           PP Y
Sbjct: 310 PPPY 313

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 60/116 (51%), Positives = 61/116 (52%), Gaps = 14/116 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCV--------CPPPPPCYSPSPKVVYKSPP 164
           +P  YYKSP P  Y  SP VYYKSPP P             PPPPP Y  S    YKSPP
Sbjct: 239 APYKYYKSPAPQKYYKSP-VYYKSPPPPTTYYEKSPSYYKSPPPPPYYKESTPY-YKSPP 296

Query: 165 P-PYV---YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP--SYSPSP 314
           P PY    Y SPPPP Y       YKSPPPP YY  S    YKSPPPP   Y  SP
Sbjct: 297 PSPYYKESYKSPPPPPYYEEFTPSYKSPPPPPYYKESTP-SYKSPPPPPKHYDQSP 351

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 55/110 (50%), Positives = 57/110 (51%), Gaps = 17/110 (15%)
 Frame = +3

Query: 18  VYYKSPPPP--YYSPSPKVYYKSPPHPHVCV-------CPPPPPCYSPSPKVVYKSPPPP 170
           VYYKSPPPP  YY  SP  YYKSPP P            PPP P Y  S    YKSPPPP
Sbjct: 257 VYYKSPPPPTTYYEKSPS-YYKSPPPPPYYKESTPYYKSPPPSPYYKES----YKSPPPP 311

Query: 171 YVY--------NSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
             Y        + PPPPYY  S   Y   PPPP +Y  SP   Y SPPPP
Sbjct: 312 PYYEEFTPSYKSPPPPPYYKESTPSYKSPPPPPKHYDQSP-TSYNSPPPP 360

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 61/129 (47%), Positives = 66/129 (51%), Gaps = 25/129 (19%)
 Frame = +3

Query: 15  KVYYKSPPPPYY---SPSPKVYYKSP-PHPHVCVCPPPPPCY---SPSPKVVYKSPPPPY 173
           K YYKSP P  Y   SPSP  YYKSP P  +    P P   Y   +PS    YKSP P  
Sbjct: 174 KYYYKSPAPSKYYYKSPSPAKYYKSPAPSKYYYKSPSPRKYYKSPAPSKHYYYKSPSPSK 233

Query: 174 VYNSPPP--PYYSPSPK------VYYKSPPPP-SYYSPSPKVEYKSPPPPSY-------- 302
            Y SP P   Y SP+P+      VYYKSPPPP +YY  SP   YKSPPPP Y        
Sbjct: 234 YYKSPAPYKYYKSPAPQKYYKSPVYYKSPPPPTTYYEKSPSY-YKSPPPPPYYKESTPYY 292

Query: 303 -SPSPKTEY 326
            SP P   Y
Sbjct: 293 KSPPPSPYY 301

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 57/128 (44%), Positives = 63/128 (49%), Gaps = 26/128 (20%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPP----HPHVCVCPPPPPCY---SPSPKVVYKSPPPPYV- 176
           YYKSPPPP Y      YYKSPP    +      PPPPP Y   +PS    YKSPPPP   
Sbjct: 275 YYKSPPPPPYYKESTPYYKSPPPSPYYKESYKSPPPPPYYEEFTPS----YKSPPPPPYY 330

Query: 177 ------YNSPPPP--YYSPSPKVYYK-SPPPPSYYSPSPKVEYKSPPPP---------SY 302
                 Y SPPPP  +Y  SP  Y    PPPP+YY  +P   Y SPPPP         + 
Sbjct: 331 KESTPSYKSPPPPPKHYDQSPTSYNSPPPPPPAYYKQTP--TYASPPPPQKYEQSVTYAS 388

Query: 303 SPSPKTEY 326
            P P T Y
Sbjct: 389 PPPPSTNY 396

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 58/127 (45%), Positives = 60/127 (47%), Gaps = 30/127 (23%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY--------SPSPKVYYKS-----PPHPHV------CVCPPPPPCYS 131
           SP  Y   PPPPYY        SP P  YYK      PP P+          PPPPP Y 
Sbjct: 272 SPSYYKSPPPPPYYKESTPYYKSPPPSPYYKESYKSPPPPPYYEEFTPSYKSPPPPPYYK 331

Query: 132 PSPKVVYKSPPP--------PYVYNSPPPP---YYSPSPKVYYKSPPPPSYYSPSPKVEY 278
            S    YKSPPP        P  YNSPPPP   YY  +P   Y SPPPP  Y  S  V Y
Sbjct: 332 ESTP-SYKSPPPPPKHYDQSPTSYNSPPPPPPAYYKQTPT--YASPPPPQKYEQS--VTY 386

Query: 279 KSPPPPS 299
            SPPPPS
Sbjct: 387 ASPPPPS 393

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 58/119 (48%), Positives = 65/119 (54%), Gaps = 21/119 (17%)
 Frame = +3

Query: 21  YYKSPPPP---YYSPSP-KVYYKSP-PHPHVCVCPPPPPCY-SPSP-KVVYKSPPPPYVY 179
           YYKSP P    Y +P+P K YYKSP P  +    P P   Y SP+P K  YKSP P   Y
Sbjct: 156 YYKSPAPSKNYYKAPTPSKYYYKSPAPSKYYYKSPSPAKYYKSPAPSKYYYKSPSPRKYY 215

Query: 180 NSPPPP----YYSPSPKVYYKSPPPPSYY--SPSPK------VEYKSPPPPS--YSPSP 314
            SP P     Y SPSP  YYKSP P   Y  SP+P+      V YKSPPPP+  Y  SP
Sbjct: 216 KSPAPSKHYYYKSPSPSKYYKSPAPYK-YYKSPAPQKYYKSPVYYKSPPPPTTYYEKSP 273

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/131 (38%), Positives = 57/131 (43%), Gaps = 24/131 (18%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPS---PKVYYKSPPHPHVCVCPPPPPCYSPSPKVV--YKSPPPP 170
           A  K YYK+P    Y  S    K YYK+P          P   Y  +P V   YKSP P 
Sbjct: 85  APSKHYYKAPIVAKYYKSHAPSKHYYKAPIVTKYYRSHAPSKHYYKAPVVAKYYKSPAPS 144

Query: 171 YVYNSPPPP---YYSPSP-KVYYKSPPPPSYY------------SPSPKVEYKSPPPPSY 302
             Y   P     Y SP+P K YYK+P P  YY            SPSP   YKSP P  Y
Sbjct: 145 KQYYKAPVVVKYYKSPAPSKNYYKAPTPSKYYYKSPAPSKYYYKSPSPAKYYKSPAPSKY 204

Query: 303 ---SPSPKTEY 326
              SPSP+  Y
Sbjct: 205 YYKSPSPRKYY 215

[80][TOP]
>UniRef100_Q9XIB6 F13F21.7 protein n=1 Tax=Arabidopsis thaliana RepID=Q9XIB6_ARATH
          Length = 847

 Score =  100 bits (250), Expect = 4e-20
 Identities = 59/105 (56%), Positives = 64/105 (60%), Gaps = 1/105 (0%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP +SP P V Y SPP PH  V  PPPP  SP P     SPPPP V++ P
Sbjct: 544 SPPSPIYSPPPPVHSPPPPV-YSSPPPPH--VYSPPPPVASPPP----PSPPPP-VHSPP 595

Query: 189 PPPYYSPSPKVYYKSPPPPS-YYSPSPKVEYKSPPPPSYSPSPKT 320
           PPP +SP P V+  SPPPPS  YSP P     SPPPP YSP P T
Sbjct: 596 PPPVFSPPPPVF--SPPPPSPVYSPPPPSH--SPPPPVYSPPPPT 636

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 55/112 (49%), Positives = 61/112 (54%), Gaps = 9/112 (8%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYS------PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP 167
           ASP    +SPPPP         P P +   SPP P   +  PPPP +SP P V Y SPPP
Sbjct: 514 ASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSP---IYSPPPPVHSPPPPV-YSSPPP 569

Query: 168 PYVYNSPPPPYYSP---SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P+VY SPPPP  SP   SP     SPPPP  +SP P V    PP P YSP P
Sbjct: 570 PHVY-SPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPP 620

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/109 (48%), Positives = 61/109 (55%), Gaps = 5/109 (4%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCV-CPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           P VY   PPP  YSP P V    PP P   V  PPPPP +SP P V   SPPPP    SP
Sbjct: 561 PPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVF--SPPPPSPVYSP 618

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP----PPPSYSPSPKTE 323
           PPP +SP P VY  SPPPP+ +SP P      P    P P+ +P+P +E
Sbjct: 619 PPPSHSPPPPVY--SPPPPT-FSPPPTHNTNQPPMGAPTPTQAPTPSSE 664

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 46/106 (43%), Positives = 50/106 (47%), Gaps = 12/106 (11%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPP-------PPPCYSPSPKVVYKSPPPPYVYNS-- 185
           P  P    SPK      P P   V PP       P   Y  SP    +SPPPP V ++  
Sbjct: 474 PEQPKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRV 533

Query: 186 --PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS-YSPSP 314
             P PP  SPSP     SPPPP  +SP P V Y SPPPP  YSP P
Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPP-VHSPPPPV-YSSPPPPHVYSPPP 577

[81][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 55/124 (44%), Positives = 64/124 (51%), Gaps = 16/124 (12%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY-- 203
           SPPPP  SPSP      PP P      PPPP Y  SP+  Y SPPPP     PPPPYY  
Sbjct: 479 SPPPP--SPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPPYYEV 536

Query: 204 -------SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY-------*ISRL 341
                  SP P   +  PPPP YY  SP+  Y SPPPPS +  PK +Y        + +L
Sbjct: 537 SPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRYLSPPPPSPASLPKYDYSSPPPPRALPKL 596

Query: 342 PLYE 353
           P+Y+
Sbjct: 597 PVYD 600

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 53/119 (44%), Positives = 61/119 (51%), Gaps = 17/119 (14%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPPYY  SP+  Y SPP P     PPPP  Y  SP+  Y SPPPP V++ P
Sbjct: 496 SPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPP-YYEVSPEDRYLSPPPPPVHHDP 554

Query: 189 PPPYY---------------SPS--PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP Y               SP+  PK  Y SPPPP      P  +Y SPPPP+   +P
Sbjct: 555 PPPPYYEVSPEDRYLSPPPPSPASLPKYDYSSPPPPRALPKLPVYDYSSPPPPAAGSTP 613

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 51/110 (46%), Positives = 54/110 (49%), Gaps = 11/110 (10%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SPSP      PP P     PPPP    PSP     SPPPP    SPPPP  SP
Sbjct: 435 SPPPP--SPSPPPPSPPPPSPPP-PSPPPPSPPPPSPSPPPPSPPPP----SPPPPSPSP 487

Query: 210 SPKVYYKSPPPPS-----------YYSPSPKVEYKSPPPPSYSPSPKTEY 326
            P     SPPPPS           YY  SP+  Y SPPPP+Y+  P   Y
Sbjct: 488 PPP----SPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPPY 533

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 53/116 (45%), Positives = 54/116 (46%), Gaps = 9/116 (7%)
 Frame = +3

Query: 30  SPPPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP  SP P      SPP P     PP PP  SP P     SPPPP    SPPPP  S
Sbjct: 418 SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPP----SPPPP----SPPPPSPS 469

Query: 207 --------PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPLY 350
                   PSP     SPPPPS   PSP     SPPPP Y  SP+  Y     P Y
Sbjct: 470 PPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAY 525

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 45/94 (47%), Positives = 45/94 (47%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           P PP   PSP      PP P     PPPP    PSP     SPPPP    SPPPP   P 
Sbjct: 405 PSPPLPPPSPPPPSPPPPSP----SPPPPSPPPPSPPPPSPSPPPP----SPPPP-SPPP 455

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P     SPPPPS   P P     SPPPPS SP P
Sbjct: 456 PSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPP 489

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 44/84 (52%), Positives = 44/84 (52%)
 Frame = +3

Query: 63  KVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPP 242
           K    SPP P     PP PP  SPSP     SPPPP    SPPPP  SP P     SPPP
Sbjct: 401 KFVLPSPPLPPPSPPPPSPPPPSPSPPP--PSPPPP----SPPPPSPSPPP----PSPPP 450

Query: 243 PSYYSPSPKVEYKSPPPPSYSPSP 314
           PS   PSP     SPPPPS SP P
Sbjct: 451 PSPPPPSPPP--PSPPPPSPSPPP 472

[82][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 61/132 (46%), Positives = 63/132 (47%), Gaps = 21/132 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN--- 182
           P VY  SPPPP  SP P VY   PP P V   PPPPP YSP P      PPPP VY+   
Sbjct: 262 PPVY--SPPPPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPP 319

Query: 183 -------SPPPPYYSPSPKVYYKSPPPPSYYSPS-----------PKVEYKSPPPPSYSP 308
                  SPPPP YSP P     SPPPPS   PS           P      PPPP +SP
Sbjct: 320 PPSPPPPSPPPPVYSPPPPP--PSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSP 377

Query: 309 SPKTEY*ISRLP 344
            P T Y  S  P
Sbjct: 378 PPPTPYYYSSPP 389

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 58/131 (44%), Positives = 62/131 (47%), Gaps = 16/131 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY---------YSPSPKV--YYKSPPHPHVCVCPPPPPCYSP-----SP 140
           SP     SPPPP          +SP P +  Y   PP PH    PPPPP YSP      P
Sbjct: 396 SPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPP 455

Query: 141 KVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
             +   PPPP    SPPPP  SP P   YK PP PS   P P V Y SPPPPS SP P  
Sbjct: 456 PCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPS--PPPPPVHYYSPPPPSQSPPPPA 513

Query: 321 EY*ISRLPLYE 353
                  P+YE
Sbjct: 514 -------PVYE 517

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 56/116 (48%), Positives = 59/116 (50%), Gaps = 18/116 (15%)
 Frame = +3

Query: 33  PPPPYYSPSPKV--YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-------YVYNS 185
           PPPP +SP P    YY SPP P     PPPPP   P P   +  PPPP       Y Y S
Sbjct: 370 PPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLS 429

Query: 186 PPP---PYYSPSPKVYYKSPPPPS------YYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PPP   P YSP P   Y  PPPPS         P P  EY SPPPPS SP P T+Y
Sbjct: 430 PPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEY-SPPPPSPSPPPPTQY 484

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 56/112 (50%), Positives = 57/112 (50%), Gaps = 1/112 (0%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV-VYKSPPPPYVYNSP 188
           P VY   PPPP YSP P     SPP P     PPPPP YSP P   VY  PPPP     P
Sbjct: 253 PPVYSPPPPPPVYSPPPPP--PSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPP 310

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           PPP YSP        PPPPS   PSP     SPPPP  SP P +    S LP
Sbjct: 311 PPPVYSP--------PPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLP 354

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/116 (46%), Positives = 58/116 (50%), Gaps = 11/116 (9%)
 Frame = +3

Query: 12  PKVY-YKSPPPP---YYSPSPKVYYKSPPHPHVCVC---PPPPPCYSPSPKVVYKSPPPP 170
           P +Y Y SPPPP    YSP P   Y  PP P    C   PPPPPC   SP     SPPPP
Sbjct: 422 PPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPP 481

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP----SYSPSPKTEY 326
             Y  PP P   P P V+Y SPPPPS   P P   Y+ P PP    SY+  P   Y
Sbjct: 482 TQYKPPPSP-SPPPPPVHYYSPPPPSQSPPPPAPVYEGPLPPITGVSYASPPPPPY 536

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 54/120 (45%), Positives = 58/120 (48%), Gaps = 21/120 (17%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHV------CVCPPPPP----------CYSPSPKV--VYK 155
           SPPPP YSP P      PP P        CV PPPPP           +SP P     Y 
Sbjct: 327 SPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYS 386

Query: 156 SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS---YSPSPKTEY 326
           SPPPP   +SPPPP +SP P     SPPPP +  P P   Y SPPPP    YSP P   Y
Sbjct: 387 SPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVY 446

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/113 (47%), Positives = 57/113 (50%), Gaps = 12/113 (10%)
 Frame = +3

Query: 12  PKVYYKSPPP--PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           P VY   PPP  P  SP P VY  SPP P     PP PP  SP P  V   PPPP     
Sbjct: 312 PPVYSPPPPPSPPPPSPPPPVY--SPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPP 369

Query: 186 PPPPYYSPSPKV--YYKSPPPPS--------YYSPSPKVEYKSPPPPSYSPSP 314
           PPPP +SP P    YY SPPPPS         +SP P     SPPPP +SP P
Sbjct: 370 PPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPP 422

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/112 (44%), Positives = 52/112 (46%), Gaps = 11/112 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP--------P 167
           P VY   PPPP   P P   Y  PP P      PPPP YSP P      PP        P
Sbjct: 295 PPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLP 354

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPS---YYSPSPKVEYKSPPPPSYSPSP 314
           P V   PPPP  SP P     SPPPP+   Y SP P     SPPPP +SP P
Sbjct: 355 PCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPP 406

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 50/107 (46%), Positives = 51/107 (47%), Gaps = 3/107 (2%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           R  P V     PPP   PSP +   SPP     V  PPP    P P  VY  PPPP    
Sbjct: 224 RCKPFVPTLPAPPP---PSPPMPVPSPP-----VYLPPPVYSPPPPPPVYSPPPPP---P 272

Query: 183 SPPPPYYS---PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           SPPPP YS   P P VY   PPPP Y  P P      PPPP YSP P
Sbjct: 273 SPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPP 319

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/106 (49%), Positives = 53/106 (50%), Gaps = 12/106 (11%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-YVYNSPPPPYYS- 206
           P PP   PSP VY   P +      PPPPP YSP P     SPPPP Y    PPPP YS 
Sbjct: 238 PSPPMPVPSPPVYLPPPVYSP----PPPPPVYSPPPPP--PSPPPPVYSPPPPPPPVYSP 291

Query: 207 -PSPKVYYKSPPPPS-------YYS--PSPKVEYKSPPPPSYSPSP 314
            P P VY   PPPPS        YS  P P     SPPPP YSP P
Sbjct: 292 PPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPP 337

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 49/101 (48%), Positives = 50/101 (49%), Gaps = 2/101 (1%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           +PPPP           SPP P      P PP Y P P  VY  PPPP VY SPPPP  SP
Sbjct: 234 APPPP-----------SPPMP-----VPSPPVYLPPP--VYSPPPPPPVY-SPPPPPPSP 274

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPP--SYSPSPKTEY 326
            P VY   PPPP  YSP P     SPPPP  S  P P   Y
Sbjct: 275 PPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVY 315

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 38/83 (45%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY-VYNS 185
           SP     SPPPP         YK PP P     PPPPP +  SP    +SPPPP  VY  
Sbjct: 470 SPPPPSPSPPPPT-------QYKPPPSP----SPPPPPVHYYSPPPPSQSPPPPAPVYEG 518

Query: 186 PPPPYYSPSPKVYYKSPPPPSYY 254
           P PP       V Y SPPPP YY
Sbjct: 519 PLPPITG----VSYASPPPPPYY 537

[83][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 61/126 (48%), Positives = 68/126 (53%), Gaps = 28/126 (22%)
 Frame = +3

Query: 21  YYKSPPPPY-----------YSPSPKVY-YKSPPHPHVCVCPPPP-PCYS--PSPKVVYK 155
           YY SPPPP+           +SP P +Y Y SPP P   V  PPP P YS  P P  +  
Sbjct: 559 YYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEP 618

Query: 156 SPPPPYVYNSPPPP----YYS--PSPKVYYKSPPPPS-YYS---PSPKVEYKSPPPPS-- 299
            PPPP +  SPPPP    +YS  P P VYY SPPPP  YYS   P P V Y SPPPP   
Sbjct: 619 PPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVH 678

Query: 300 -YSPSP 314
            +SP P
Sbjct: 679 YHSPPP 684

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 56/110 (50%), Positives = 67/110 (60%), Gaps = 14/110 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPP--YYS--PSPKVYYKSPPHPHVCVCPPPPPCYS--PSPKVVYKSPPP-P 170
           P V+Y SPPPP  YYS  P P VYY SPP       PPPP  YS  P P+V Y SPPP P
Sbjct: 634 PVVHYSSPPPPPVYYSSPPPPPVYYSSPP-------PPPPVHYSSPPPPEVHYHSPPPSP 686

Query: 171 YVYNSPPPPYYSP-------SPKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
             Y+SPPPP  +P       +P V++  PPP  ++SP P V ++SPPPPS
Sbjct: 687 VHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPS 736

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 56/120 (46%), Positives = 58/120 (48%), Gaps = 9/120 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPPP   P P VY   PP P     PPPPP YSP P      PPPP     PP
Sbjct: 461 PPVYSPPPPPPPPPPPPPVYSPPPPSPP----PPPPPVYSPPPP-----PPPP-----PP 506

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEY---------KSPPPPSYSPSPKTEY*ISRLP 344
           PP YSP P   Y SPPPP   SP+P   Y          SPPPP +SP P   Y  S  P
Sbjct: 507 PPVYSPPPPPVYSSPPPPP--SPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPP 564

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 52/108 (48%), Positives = 56/108 (51%), Gaps = 10/108 (9%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPH-------VCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           PPPP YSP P   Y SPP P         C  PPPPP +SP P      PP PY Y+SPP
Sbjct: 505 PPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPP 564

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS---YSPSPKTEY 326
           PP+ SP P     SPPPP +  P P   Y SPPPP     SP P   Y
Sbjct: 565 PPHSSPPP----HSPPPP-HSPPPPIYPYLSPPPPPTPVSSPPPTPVY 607

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 58/116 (50%), Positives = 68/116 (58%), Gaps = 19/116 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPP--YYS---PSPKVYYKSPPHPHVCV-CPPPPPCYSPSP-----KVVYKS 158
           P VYY SPPPP  YYS   P P V+Y SPP P V    PPP P +  SP         +S
Sbjct: 644 PPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEES 703

Query: 159 PPP-PYVYNSPPPP--YYSPSPKVYYKSPPPPS--YYSPSPK---VEYKSPPPPSY 302
           PPP P V++SPPPP  ++SP P V ++SPPPPS  Y  P P    V Y SPPPP +
Sbjct: 704 PPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPPPPF 759

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 55/114 (48%), Positives = 59/114 (51%), Gaps = 13/114 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP------- 170
           P VY  SPPPP   P P   Y  PP P     PPPPP YSP P  VY SPPPP       
Sbjct: 477 PPVY--SPPPPSPPPPPPPVYSPPPPPPP---PPPPPVYSPPPPPVYSSPPPPPSPAPTP 531

Query: 171 -YVYNSPPPPYYSPSPKVYYKSPPPPS-YYSPSPKVEYKSP----PPPSYSPSP 314
            Y    PPPP +SP P  +  SPPPP  YY  SP   + SP    PPP +SP P
Sbjct: 532 VYCTRPPPPPPHSPPPPQF--SPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP 583

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 54/110 (49%), Positives = 56/110 (50%), Gaps = 5/110 (4%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPPP   P P VY   PP P     PPPPP YSP P      PPPP VY+ PP
Sbjct: 433 PPVYSPPPPPP---PPPPVYSPPPPPPP----PPPPPVYSPPPPPP-PPPPPPPVYSPPP 484

Query: 192 PPYYSPSPKVYY-----KSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           P    P P VY        PPPP  YSP P   Y SPPPP  SP+P   Y
Sbjct: 485 PSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP-SPAPTPVY 533

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%), Gaps = 1/106 (0%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y  PPPP   P P VY  SPP P V   PPPPP  +P+P  VY + PPP   +SPP
Sbjct: 491 PPPVYSPPPPPPPPPPPPVY--SPPPPPVYSSPPPPPSPAPTP--VYCTRPPPPPPHSPP 546

Query: 192 PPYYS-PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP +S P P+ YY S PPP + SP P     SPPPP   P P   Y
Sbjct: 547 PPQFSPPPPEPYYYSSPPPPHSSPPP----HSPPPPHSPPPPIYPY 588

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 60/144 (41%), Positives = 65/144 (45%), Gaps = 36/144 (25%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPK-VYYKSPPHPHVCVCP--------PPPPCY--------- 128
           R  P   +  PPP +  P P+  YY SPP PH    P        PPPP Y         
Sbjct: 536 RPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPP 595

Query: 129 ----SPSPKVVYKSPPPPYVYNSPPPP---YYSPSPK---VYYKSPPPPS-YYS--PSPK 269
               SP P  VY  PPPP     PPPP    YSP P    V+Y SPPPP  YYS  P P 
Sbjct: 596 TPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655

Query: 270 VEYKSPPPP-----SYSPSPKTEY 326
           V Y SPPPP     S  P P+  Y
Sbjct: 656 VYYSSPPPPPPVHYSSPPPPEVHY 679

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 53/105 (50%), Positives = 54/105 (51%), Gaps = 6/105 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P VY  SPP P     PPPPP YSP P      PPPP VY+ PPPP   P
Sbjct: 425 SPPPP--SPPPPVY--SPPPPP----PPPPPVYSPPPPP--PPPPPPPVYSPPPPPPPPP 474

Query: 210 SPKVYYK------SPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            P   Y        PPPP  YSP P      PPPP YSP P   Y
Sbjct: 475 PPPPVYSPPPPSPPPPPPPVYSPPPPPP-PPPPPPVYSPPPPPVY 518

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 48/96 (50%), Positives = 57/96 (59%), Gaps = 15/96 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPK-VYYKSPPHPHVCVC---PPPPPC--YSPSPKVVYKSPP 164
           P V+Y SPPPP   Y+SP P  V+Y SPP P    C   PPP P   +SP P +V+ SPP
Sbjct: 665 PPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPP 724

Query: 165 PPYVYNSPPPP---YYSPSPKVY---YKSPPPPSYY 254
           PP ++ SPPPP   Y  P P V    Y SPPPP +Y
Sbjct: 725 PPVIHQSPPPPSPEYEGPLPPVIGVSYASPPPPPFY 760

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/105 (44%), Positives = 51/105 (48%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P +    PP P +S  P +   SPP P      PPPP YSP P      PPPP VY+ PP
Sbjct: 405 PSLPSPPPPAPIFSTPPTL--TSPPPPS-----PPPPVYSPPPP----PPPPPPVYSPPP 453

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP   P P VY   PPPP    P P     SPPPPS  P P   Y
Sbjct: 454 PPPPPPPPPVYSPPPPPP---PPPPPPPVYSPPPPSPPPPPPPVY 495

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 44/99 (44%), Positives = 45/99 (45%), Gaps = 4/99 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPP----PPCYSPSPKVVYKSPPPPYVYNSPPPP 197
           SP PP  +P P     SPP P      PP    PP  SP P V    PPPP     PPP 
Sbjct: 393 SPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP----PPPPV 448

Query: 198 YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           Y  P P      PPPP  YSP P      PPPP YSP P
Sbjct: 449 YSPPPPP---PPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484

[84][TOP]
>UniRef100_Q76KW2 Hydroxyproline-rich glycoprotein-3 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW2_PEA
          Length = 137

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 62/116 (53%), Positives = 63/116 (54%), Gaps = 19/116 (16%)
 Frame = +3

Query: 12  PKVY-YKSPPPP------YYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP 167
           P VY YKSPPPP      Y SP P VY Y SPP P      PPPP Y       YKSPPP
Sbjct: 8   PPVYKYKSPPPPVKKPYKYSSPPPPVYKYNSPPPPVYKYKSPPPPVYK------YKSPPP 61

Query: 168 P-YVYNSPPPP------YYSPSPKVY-YKSPPPPSYYSPSPKV---EYKSPPPPSY 302
           P Y Y SPPPP      Y SP P VY Y SPPPP Y   SP     +YKSPPP  Y
Sbjct: 62  PVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKYKSPXTPIYKYKSPPPXVY 117

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 60/125 (48%), Positives = 64/125 (51%), Gaps = 15/125 (12%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-YVYNSPPPPY 200
           YKSPPPP Y       YKSPP          PP   P     Y SPPPP Y YNSPPPP 
Sbjct: 3   YKSPPPPVYK------YKSPP----------PPVKKPYK---YSSPPPPVYKYNSPPPPV 43

Query: 201 Y---SPSPKVY-YKSPPPP--SYYSPSPKV----EYKSPPPPSYS----PSPKTEY*ISR 338
           Y   SP P VY YKSPPPP   Y SP P V    +Y SPPPP Y     P P  +Y    
Sbjct: 44  YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKYKSPX 103

Query: 339 LPLYE 353
            P+Y+
Sbjct: 104 TPIYK 108

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 34/61 (55%), Positives = 35/61 (57%), Gaps = 13/61 (21%)
 Frame = +3

Query: 171 YVYNSPPPPYY---SPSPKV----YYKSPPPP--SYYSPSPKV-EYKSPPPPSY---SPS 311
           Y Y SPPPP Y   SP P V     Y SPPPP   Y SP P V +YKSPPPP Y   SP 
Sbjct: 1   YKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPP 60

Query: 312 P 314
           P
Sbjct: 61  P 61

[85][TOP]
>UniRef100_B9HRV2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HRV2_POPTR
          Length = 711

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 56/99 (56%), Positives = 62/99 (62%), Gaps = 4/99 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP----PPYVYNSPPPP 197
           SPPPP YSP P VY  SPP P   V  PPPP +SP P V    PP    PP V++ PPPP
Sbjct: 444 SPPPPIYSPPPLVY--SPPPP---VHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPP 498

Query: 198 YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            YSP P V+  SPPPP  YSP P V+  SPPPP +SP P
Sbjct: 499 VYSPPPPVH--SPPPP-VYSPPPLVQ--SPPPPVHSPPP 532

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/115 (46%), Positives = 61/115 (53%), Gaps = 13/115 (11%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPP----------HPHVCVCPPPPPCYSPSPKVVYKS 158
           SP     SPPPP +SP P V+   PP           P     PPPPP YSP P V    
Sbjct: 451 SPPPLVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPPPPVHSPP 510

Query: 159 PP---PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP   PP +  SPPPP +SP P ++  SPPPP  YSP P V   SPPPP +SP P
Sbjct: 511 PPVYSPPPLVQSPPPPVHSPPPPLH--SPPPPPVYSPPPPVH--SPPPPVHSPPP 561

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/106 (50%), Positives = 62/106 (58%), Gaps = 2/106 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPP--HPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           P   +  PPPP YSP P V+   PP   P   V  PPPP +SP P +   SPPPP VY S
Sbjct: 488 PPPVHSPPPPPVYSPPPPVHSPPPPVYSPPPLVQSPPPPVHSPPPPL--HSPPPPPVY-S 544

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           PPPP +SP P V+  SPPPP   SP P V +  PPPP +SP P  +
Sbjct: 545 PPPPVHSPPPPVH--SPPPP-IQSPPPPV-HSPPPPPIHSPPPPVQ 586

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/109 (51%), Positives = 63/109 (57%), Gaps = 8/109 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP----PPPCYSPSPKVVYKSPPPPYVY 179
           P +Y  SPPP  YSP P V+  SPP P     PP    PPP +SP P V   SPPPP VY
Sbjct: 447 PPIY--SPPPLVYSPPPPVH--SPPPPVHSPPPPVQSFPPPVHSPPPPV--HSPPPPPVY 500

Query: 180 NSPPPPYYSPSPKVYYKSP----PPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SPPPP +SP P VY   P    PPP  +SP P + +  PPPP YSP P
Sbjct: 501 -SPPPPVHSPPPPVYSPPPLVQSPPPPVHSPPPPL-HSPPPPPVYSPPP 547

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 52/104 (50%), Positives = 60/104 (57%), Gaps = 3/104 (2%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPP---HPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           P +++  PPPP +SP P   +  PP    P   V  PPPP +SP P V   SPPPP    
Sbjct: 425 PSIHF--PPPPVHSPPPPPVHSPPPPIYSPPPLVYSPPPPVHSPPPPV--HSPPPP--VQ 478

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           S PPP +SP P V+  SPPPP  YSP P V   SPPPP YSP P
Sbjct: 479 SFPPPVHSPPPPVH--SPPPPPVYSPPPPVH--SPPPPVYSPPP 518

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 50/101 (49%), Positives = 60/101 (59%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP +SP P   Y  PP  H     PPPP +SP P +  +SPPPP V++ P
Sbjct: 522 SPPPPVHSPPPPLHSPPPPPVYSPPPPVH----SPPPPVHSPPPPI--QSPPPP-VHSPP 574

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
           PPP +SP P V  +S PPP   SP P V   SPPPP +SP+
Sbjct: 575 PPPIHSPPPPV--QSLPPPPVNSPLPPVH--SPPPPVHSPT 611

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 54/116 (46%), Positives = 62/116 (53%), Gaps = 15/116 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPY------YSPSPKVY-----YKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           P V+   PPP Y      +SP P VY      +SPP P   V  PPPP +SP P  VY  
Sbjct: 489 PPVHSPPPPPVYSPPPPVHSPPPPVYSPPPLVQSPPPP---VHSPPPPLHSPPPPPVYSP 545

Query: 159 PP----PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP    PP   +SPPPP  SP P V+  SPPPP  +SP P V+   PPPP  SP P
Sbjct: 546 PPPVHSPPPPVHSPPPPIQSPPPPVH--SPPPPPIHSPPPPVQ-SLPPPPVNSPLP 598

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 49/106 (46%), Positives = 57/106 (53%), Gaps = 11/106 (10%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPP--HPHVCVCPPPPPCYSPSPKVVYKSP-----PPPYVYNSP 188
           SPPP   S  P V+   PP   P   +  PPPP +SP P  V+  P     PPP VY SP
Sbjct: 401 SPPPSSQSLPPLVHSLPPPAHSPPPSIHFPPPPVHSPPPPPVHSPPPPIYSPPPLVY-SP 459

Query: 189 PPPYYSPSPKVYYKSPP----PPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP +SP P V+   PP    PP  +SP P V +  PPPP YSP P
Sbjct: 460 PPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPV-HSPPPPPVYSPPP 504

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 50/125 (40%), Positives = 65/125 (52%), Gaps = 23/125 (18%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP-----PPCYSPSPKV------VYK 155
           SP    +SPPPP +SP P   + SPP P   + PPP     PP +SP P V      ++ 
Sbjct: 558 SPPPPIQSPPPPVHSPPPPPIH-SPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHS 616

Query: 156 SPPP------------PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
            PPP            P   NSPPPP +SP+P ++  SPP    +SP P +  +SPPPP 
Sbjct: 617 HPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPSPP---LHSPPPPI--RSPPPPV 671

Query: 300 YSPSP 314
           +SP P
Sbjct: 672 FSPPP 676

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 45/114 (39%), Positives = 59/114 (51%), Gaps = 16/114 (14%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVY-----YKSPPHPHVCVCPPP-----PPCYSPSPKVVYKS 158
           SP     SPPPP +SP+  ++       SPP P   + PPP     PP +SP+P +   S
Sbjct: 595 SPLPPVHSPPPPVHSPTSPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPS 654

Query: 159 PP---PPYVYNSPPPPYYSPSPKVYYKSPPPPS---YYSPSPKVEYKSPPPPSY 302
           PP   PP    SPPPP +SP P +    PPPP       P+   +Y SPPPP++
Sbjct: 655 PPLHSPPPPIRSPPPPVFSPPPVIVSPPPPPPEEDFILPPNLGFQYASPPPPTF 708

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/106 (44%), Positives = 54/106 (50%), Gaps = 9/106 (8%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP 215
           PPP     P + +  PP  H     PPP  + P P V   SPPPP V+ SPPPP YSP P
Sbjct: 402 PPPSSQSLPPLVHSLPPPAH----SPPPSIHFPPPPV--HSPPPPPVH-SPPPPIYSPPP 454

Query: 216 KVYYKSP----PPPSYYSPSPKVE-----YKSPPPPSYSPSPKTEY 326
            VY   P    PPP  +SP P V+       SPPPP +SP P   Y
Sbjct: 455 LVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVY 500

[86][TOP]
>UniRef100_Q94ES6 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES6_PEA
          Length = 181

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 64/148 (43%), Positives = 72/148 (48%), Gaps = 39/148 (26%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKV---YYKSPP--------HPHVCVCPPPPPCYS-PSPKVVYKSPPP 167
           Y SPPPP +SP P     +Y SPP        HPH     PPPP ++ P P  VY SPPP
Sbjct: 32  YSSPPPPVHSPPPPKDPHHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPP 91

Query: 168 ------PYVYNSPPPP-----------YYSPSP------KVY-YKSPPPPSYYSPSPKVE 275
                 PY Y SPPPP           Y+SP P      K Y Y SPPPP  ++  P V 
Sbjct: 92  PTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVP 151

Query: 276 ---YKSPPPPSYSPSPKTEY*ISRLPLY 350
              Y SPPPP+YSP P   Y  S  P Y
Sbjct: 152 TPVYHSPPPPAYSPPPPAYYYKSPPPPY 179

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/114 (46%), Positives = 59/114 (51%), Gaps = 19/114 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPP------HPHVCVCPPPPPCYS-PSPKVVYKSPPP 167
           P   Y SPPPP ++ P P   Y SPP       P+    PPPPP ++ P P  VY SPPP
Sbjct: 65  PHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPP 124

Query: 168 -------PYVYNSPPPP----YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
                  PY Y SPPPP    Y    P   Y SPPPP+Y  P P   YKSPPPP
Sbjct: 125 PPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAYSPPPPAYYYKSPPPP 178

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 40/92 (43%), Positives = 48/92 (52%), Gaps = 11/92 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPP-------HPHVCVCPPPPPCYSPSPKV---VYKS 158
           P  Y   PPPP ++ P P   Y SPP        P+    PPPPP ++  P V   VY S
Sbjct: 98  PYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHS 157

Query: 159 PPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYY 254
           PPPP  Y+ PPP Y       YYKSPPPP ++
Sbjct: 158 PPPP-AYSPPPPAY-------YYKSPPPPYHH 181

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/57 (47%), Positives = 34/57 (59%), Gaps = 5/57 (8%)
 Frame = +3

Query: 171 YVYNSPPPPYYSPSPKV---YYKSPPPPSYYS-PSPKVEYKSPPPPSYS-PSPKTEY 326
           Y Y+SPPPP +SP P     +Y SPPPP  ++ P P   Y SPPPP ++ P P   Y
Sbjct: 30  YSYSSPPPPVHSPPPPKDPHHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVY 86

[87][TOP]
>UniRef100_Q40503 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40503_TOBAC
          Length = 224

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 66/137 (48%), Positives = 73/137 (53%), Gaps = 27/137 (19%)
 Frame = +3

Query: 24  YKSPPPPY--YSPSPKVY-----YKSPPHPHVCVCPPPPPCYS--PSPKV--------VY 152
           YKSPPPP   Y PSP  Y     YKSPP P     PP PP Y   P PK         VY
Sbjct: 61  YKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPVYKSPPPPKKPYSLPHTPVY 120

Query: 153 KSPPPPY-VYNSPPPP---YYSPSPKVYYKSPPPPS--YYSPSPKVEYKSPPPPS----Y 302
           KSPPPP  VY SPPPP   +Y P   +Y KSPPPP+  YY P   V YKSPPPP+     
Sbjct: 121 KSPPPPTPVYKSPPPPKKPHYPPHTPIY-KSPPPPNKPYYPPHTPV-YKSPPPPTPVYKS 178

Query: 303 SPSPKTEY*ISRLPLYE 353
            P PK  +     P+Y+
Sbjct: 179 PPPPKKPHYPPHTPVYK 195

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 61/133 (45%), Positives = 67/133 (50%), Gaps = 17/133 (12%)
 Frame = +3

Query: 6   ASPKVYYKSPPPP-----YYSPSPKVY-YKSPPHPHVCVCPPPPPC-YSPSPKV-----V 149
           +S    Y SPPPP     Y SP P V+ Y SPPH  V   PPPP   Y PSP       V
Sbjct: 24  SSANYQYSSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPV 83

Query: 150 YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPS----YSPSP 314
           YKSPPPP        PYY P P VY KSPPPP   YS      YKSPPPP+      P P
Sbjct: 84  YKSPPPP------KKPYYPPHPPVY-KSPPPPKKPYSLPHTPVYKSPPPPTPVYKSPPPP 136

Query: 315 KTEY*ISRLPLYE 353
           K  +     P+Y+
Sbjct: 137 KKPHYPPHTPIYK 149

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 56/104 (53%), Positives = 59/104 (56%), Gaps = 13/104 (12%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPP--PCYSPSPKVVYKSPPPPY-VYNS 185
           YKSPPPP   Y SP P      PPH  +   PPPP  P Y P   V YKSPPPP  VY S
Sbjct: 120 YKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYPPHTPV-YKSPPPPTPVYKS 178

Query: 186 PPPP---YYSPSPKVYYKSPPPPS--YYSPSP--KVEYKSPPPP 296
           PPPP   +Y P   VY KSPPPP+  Y SP P     Y SPPPP
Sbjct: 179 PPPPKKPHYPPHTPVY-KSPPPPTPVYKSPPPHHPYVYASPPPP 221

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 57/130 (43%), Positives = 60/130 (46%), Gaps = 26/130 (20%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY------- 173
           K YY   PP Y SP P     S PH  V   PPP       P  VYKSPPPP        
Sbjct: 92  KPYYPPHPPVYKSPPPPKKPYSLPHTPVYKSPPP-------PTPVYKSPPPPKKPHYPPH 144

Query: 174 --VYNSPPP---PYYSPSPKVY---------YKSPPPPS--YYSPSPKVEYKSPPPPS-- 299
             +Y SPPP   PYY P   VY         YKSPPPP   +Y P   V YKSPPPP+  
Sbjct: 145 TPIYKSPPPPNKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPV-YKSPPPPTPV 203

Query: 300 -YSPSPKTEY 326
             SP P   Y
Sbjct: 204 YKSPPPHHPY 213

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 45/85 (52%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPP--PCYSPSPKVVYKSPPPPY-VYNS 185
           YKSPPPP   YY P   VY   PP   V   PPPP  P Y P   V YKSPPPP  VY S
Sbjct: 148 YKSPPPPNKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPV-YKSPPPPTPVYKS 206

Query: 186 PPP--PYYSPSPKVYYKSPPPPSYY 254
           PPP  PY        Y SPPPP +Y
Sbjct: 207 PPPHHPY-------VYASPPPPYHY 224

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/66 (53%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP--PYVYNS 185
           P   YKSPPPP      K +Y  PPH  V   PPP       P  VYKSPPP  PYVY S
Sbjct: 172 PTPVYKSPPPP-----KKPHY--PPHTPVYKSPPP-------PTPVYKSPPPHHPYVYAS 217

Query: 186 PPPPYY 203
           PPPPY+
Sbjct: 218 PPPPYH 223

[88][TOP]
>UniRef100_Q40402 Extensin (ext) n=1 Tax=Nicotiana plumbaginifolia RepID=Q40402_NICPL
          Length = 416

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 68/132 (51%), Positives = 69/132 (52%), Gaps = 27/132 (20%)
 Frame = +3

Query: 12  PKVYYKSPPPPY--YSPSPKVY-----YKSPPHPHVCVCPPPPP--CYSPS-----PKVV 149
           P   YKSPPPP   Y PSP  Y     YKSPP P      PPPP   Y PS     P  V
Sbjct: 283 PTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPAPV 342

Query: 150 YKSPPPPY-VYNSPPPPY--YSPSPKVY-----YKSPPPPS--YYSPSPKVE-YKSPPP- 293
           YKSPPPP  VY SPPPP   Y PSP  Y     YKSPPPP+  Y SP P    YKSPPP 
Sbjct: 343 YKSPPPPTPVYKSPPPPVKPYHPSPTPYHPAPVYKSPPPPTPVYKSPPPPTPVYKSPPPH 402

Query: 294 -PSYSPSPKTEY 326
            P    SP   Y
Sbjct: 403 HPYVYASPPPPY 414

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 69/147 (46%), Positives = 71/147 (48%), Gaps = 38/147 (25%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPPPC--YSPSP-----KVVYKSPPPPY 173
           YKSPPPP   YY P   VY KSPP P      PPPP   Y PSP       VYKSPPPP 
Sbjct: 193 YKSPPPPKKPYYPPHTPVY-KSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPT 251

Query: 174 -VYNSPPPPY--YSPSPKVY---------------YKSPPPPSY-YSPS-----PKVEYK 281
            VY SPPPP   Y PSP  Y               YKSPPPP   Y PS     P   YK
Sbjct: 252 PVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYK 311

Query: 282 SPPPPS----YSPSPKTEY*ISRLPLY 350
           SPPPP+      P PK  Y  S  P +
Sbjct: 312 SPPPPTPVYKSPPPPKKPYHPSPTPYH 338

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 69/151 (45%), Positives = 69/151 (45%), Gaps = 50/151 (33%)
 Frame = +3

Query: 12  PKVYYKSPPPPY--YSPSPKVY-----YKSPPHPHVCVCPPPPPC--YSPSP-----KVV 149
           P   YKSPPPP   Y PSP  Y     YKSPP P      PPPP   Y PSP       V
Sbjct: 217 PTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPV 276

Query: 150 YKSPPPPY-VYNSPPPPY--YSPSPKVY---------------YKSPPPPS--------- 248
           YKSPPPP  VY SPPPP   Y PSP  Y               YKSPPPP          
Sbjct: 277 YKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTP 336

Query: 249 ------YYSPSPKVE-YKSPPPP--SYSPSP 314
                 Y SP P    YKSPPPP   Y PSP
Sbjct: 337 YHPAPVYKSPPPPTPVYKSPPPPVKPYHPSP 367

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 67/144 (46%), Positives = 74/144 (51%), Gaps = 28/144 (19%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPY--YSPSPKVYY-----KSPPHPHVCVCPPPPPC--YSPSPKVVYKS 158
           +S    Y SPPPP   Y PSP  YY     KSPP P      PPPP   Y P    VYKS
Sbjct: 24  SSANYQYSSPPPPKKPYHPSPTPYYPAPVYKSPPPPIPVYKSPPPPKKPYYPPHTPVYKS 83

Query: 159 PPPPY-VYNSPPP---PYYSPSPKVYYKSPPPPS--YYS-PSPKVE--------YKSPPP 293
           PPPP  VY SPPP   P+Y P   V YKSPPPP+  Y S PSPK          YKSPPP
Sbjct: 84  PPPPTPVYKSPPPPKKPHYPPHTPV-YKSPPPPTPVYKSPPSPKKPHYPPHTPVYKSPPP 142

Query: 294 PS----YSPSPKTEY*ISRLPLYE 353
           P+      P PK  +     P+Y+
Sbjct: 143 PTPVYKSPPPPKKPHYPPHTPVYK 166

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 63/128 (49%), Positives = 67/128 (52%), Gaps = 15/128 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPP--PCYSPSPKVVYKSPPPPY- 173
           P   YKSPP P   +Y P   VY   PP   V   PPPP  P Y P   V YKSPPPP  
Sbjct: 115 PTPVYKSPPSPKKPHYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPV-YKSPPPPTP 173

Query: 174 VYNSPPP---PYYSPSPKVYYKSPPPPS--YYSPSPKVEYKSPPPPS----YSPSPKTEY 326
           VY SPPP   P+Y P   V YKSPPPP   YY P   V YKSPPPP+      P PK  Y
Sbjct: 174 VYKSPPPPKKPHYPPHTPV-YKSPPPPKKPYYPPHTPV-YKSPPPPTPVYKSPPPPKKPY 231

Query: 327 *ISRLPLY 350
             S  P +
Sbjct: 232 HPSPTPYH 239

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 63/138 (45%), Positives = 69/138 (50%), Gaps = 24/138 (17%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPP--PCYSPSPKVVYKSPPPPY- 173
           P   YKSPPPP   YY P   VY   PP   V   PPPP  P Y P   V YKSPPPP  
Sbjct: 59  PIPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPV-YKSPPPPTP 117

Query: 174 VYNSPPPP---YYSPSPKVY---------YKSPPPPS--YYSPSPKVEYKSPPPPS---- 299
           VY SPP P   +Y P   VY         YKSPPPP   +Y P   V YKSPPPP+    
Sbjct: 118 VYKSPPSPKKPHYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPV-YKSPPPPTPVYK 176

Query: 300 YSPSPKTEY*ISRLPLYE 353
             P PK  +     P+Y+
Sbjct: 177 SPPPPKKPHYPPHTPVYK 194

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 65/143 (45%), Positives = 67/143 (46%), Gaps = 34/143 (23%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPPPC-YSPSPKVVYKSPPPPY-VYNSP 188
           YKSPPPP   Y SP P      PPH  V   PPPP   Y P    VYKSPPPP  VY SP
Sbjct: 165 YKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSP 224

Query: 189 PPPY--YSPSPKVY---------------YKSPPPPSY--------YSPSPKVEYKSPPP 293
           PPP   Y PSP  Y               YKSPPPP          Y PSP   YKSPPP
Sbjct: 225 PPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSP--VYKSPPP 282

Query: 294 PS----YSPSPKTEY*ISRLPLY 350
           P+      P PK  Y  S  P +
Sbjct: 283 PTPVYKSPPPPKKPYHPSPTPYH 305

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 59/111 (53%), Positives = 62/111 (55%), Gaps = 10/111 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY-VYNSP 188
           P   YKSPPPP       VY KSPP P     P P P Y PSP  VYKSPPPP  VY SP
Sbjct: 273 PSPVYKSPPPP-----TPVY-KSPPPPKKPYHPSPTP-YHPSP--VYKSPPPPTPVYKSP 323

Query: 189 PPPY--YSPSPKVY-----YKSPPPPS--YYSPSPKVEYKSPPPPSYSPSP 314
           PPP   Y PSP  Y     YKSPPPP+  Y SP P V+   P P  Y P+P
Sbjct: 324 PPPKKPYHPSPTPYHPAPVYKSPPPPTPVYKSPPPPVKPYHPSPTPYHPAP 374

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 65/140 (46%), Positives = 68/140 (48%), Gaps = 39/140 (27%)
 Frame = +3

Query: 12  PKVYYKSPPPP-----------YYSPSP--KVYYKSPPHPHVCVCPPPP-PCY------- 128
           P   YKSPPPP           Y SP P  K YY  PPH  V   PPPP P Y       
Sbjct: 171 PTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYY--PPHTPVYKSPPPPTPVYKSPPPPK 228

Query: 129 -----SPS---PKVVYKSPPPPY-VYNSPPPPY--YSPSPKVY-----YKSPPPPS--YY 254
                SP+   P  VYKSPPPP  VY SPPPP   Y PSP  Y     YKSPPPP+  Y 
Sbjct: 229 KPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYK 288

Query: 255 SPSPKVEYKSPPPPSYSPSP 314
           SP P  +   P P  Y PSP
Sbjct: 289 SPPPPKKPYHPSPTPYHPSP 308

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 53/101 (52%), Positives = 54/101 (53%), Gaps = 20/101 (19%)
 Frame = +3

Query: 12  PKVYYKSPPPPY--YSPSPKVY-----YKSPPHPHVCVCPPPPPC--YSPSPKV-----V 149
           P   YKSPPPP   Y PSP  Y     YKSPP P      PPPP   Y PSP       V
Sbjct: 316 PTPVYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPTPVYKSPPPPVKPYHPSPTPYHPAPV 375

Query: 150 YKSPPPPY-VYNSPPPP---YYSPSPK--VYYKSPPPPSYY 254
           YKSPPPP  VY SPPPP   Y SP P     Y SPPPP +Y
Sbjct: 376 YKSPPPPTPVYKSPPPPTPVYKSPPPHHPYVYASPPPPYHY 416

[89][TOP]
>UniRef100_Q06446 Extensin n=1 Tax=Solanum tuberosum RepID=Q06446_SOLTU
          Length = 291

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 63/130 (48%), Positives = 67/130 (51%), Gaps = 23/130 (17%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKV-YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY-VYNSP 188
           YKSPPPP   Y SP P    YKSPP P      PPPP     P  VYKSPPPP  VY SP
Sbjct: 159 YKSPPPPTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPVKPYHPAPVYKSPPPPTPVYKSP 218

Query: 189 PPPYYSPSPKVYYKSPPPPS--YYSPSPKVE--------------YKSPPPPS--YSPSP 314
           P   Y P+P   YKSPPPP+  Y SP P V+              YKSPPPP+  Y   P
Sbjct: 219 PVKPYHPAP--VYKSPPPPTPIYKSPPPPVKPYHPSPTPYHPKPVYKSPPPPTPVYKSPP 276

Query: 315 KTEY*ISRLP 344
            T Y  S  P
Sbjct: 277 PTHYVYSSPP 286

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 64/129 (49%), Positives = 67/129 (51%), Gaps = 24/129 (18%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPKVYYKSPPHPHVCVC---PPPPPCYS--PSPK-------- 143
           P   YKSPPPP   +Y P   VY   PPH H  V    PPP P Y   P PK        
Sbjct: 97  PTPVYKSPPPPKTPHYPPHTPVYKSPPPHHHHPVYKFPPPPTPVYKSPPPPKDPHYPPHT 156

Query: 144 VVYKSPPPPY-VYNSPPPP---YYSPSPKV-YYKSPPPP-SYYSPSPKVEYKSPPPPS-- 299
            VYKSPPPP  VY SPPPP   Y SP P    YKSPPPP   Y P+P   YKSPPPP+  
Sbjct: 157 PVYKSPPPPTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPVKPYHPAP--VYKSPPPPTPV 214

Query: 300 YSPSPKTEY 326
           Y   P   Y
Sbjct: 215 YKSPPVKPY 223

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 62/124 (50%), Positives = 64/124 (51%), Gaps = 29/124 (23%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPKV-YYKSPPHP-------HVCVCPPPPPCYSPSPKV---- 146
           P   YKSPPPP   Y SP P    YKSPP P        V   PPPP     SP V    
Sbjct: 165 PTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPVKPYHPAPVYKSPPPPTPVYKSPPVKPYH 224

Query: 147 ---VYKSPPPPY-VYNSPPPPY--YSPSPKVY-----YKSPPPPS--YYSPSP-KVEYKS 284
              VYKSPPPP  +Y SPPPP   Y PSP  Y     YKSPPPP+  Y SP P    Y S
Sbjct: 225 PAPVYKSPPPPTPIYKSPPPPVKPYHPSPTPYHPKPVYKSPPPPTPVYKSPPPTHYVYSS 284

Query: 285 PPPP 296
           PPPP
Sbjct: 285 PPPP 288

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 55/109 (50%), Positives = 58/109 (53%), Gaps = 12/109 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY-VYNSP 188
           P   YKSPPPP     P   YKSPP P      PP   Y P+P  VYKSPPPP  +Y SP
Sbjct: 185 PTPVYKSPPPPVKPYHPAPVYKSPPPPTPVYKSPPVKPYHPAP--VYKSPPPPTPIYKSP 242

Query: 189 PPPY--YSPSPKVY-----YKSPPPPS--YYSPSPK--VEYKSPPPPSY 302
           PPP   Y PSP  Y     YKSPPPP+  Y SP P   V    PPP  Y
Sbjct: 243 PPPVKPYHPSPTPYHPKPVYKSPPPPTPVYKSPPPTHYVYSSPPPPYHY 291

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 58/126 (46%), Positives = 63/126 (50%), Gaps = 29/126 (23%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPK-------VYYKSPP------HPHVCVC---PPPPPCYS--PSPKVV 149
           YKSPPP ++ P  K       VY   PP       PH  V    PPP P Y   P P  V
Sbjct: 119 YKSPPPHHHHPVYKFPPPPTPVYKSPPPPKDPHYPPHTPVYKSPPPPTPVYKSPPPPTPV 178

Query: 150 YKSPPPPY-VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVE-------YKSPPPPS-- 299
           YKSPPPP  VY SPPPP     P   YKSPPPP+    SP V+       YKSPPPP+  
Sbjct: 179 YKSPPPPTPVYKSPPPPVKPYHPAPVYKSPPPPTPVYKSPPVKPYHPAPVYKSPPPPTPI 238

Query: 300 -YSPSP 314
             SP P
Sbjct: 239 YKSPPP 244

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 56/121 (46%), Positives = 62/121 (51%), Gaps = 22/121 (18%)
 Frame = +3

Query: 24  YKSPPP---PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP- 191
           YKSPPP   P+Y P   VY   PPH H  V   PPP     P  VYKSPPPP   + PP 
Sbjct: 61  YKSPPPSEKPHYPPHTPVYKSPPPHHHHPVYKSPPP-----PTPVYKSPPPPKTPHYPPH 115

Query: 192 -PPYYSPSPKVY---YKSPPPPS--YYSPSPKVE---------YKSPPPPS---YSPSPK 317
            P Y SP P  +   YK PPPP+  Y SP P  +         YKSPPPP+    SP P 
Sbjct: 116 TPVYKSPPPHHHHPVYKFPPPPTPVYKSPPPPKDPHYPPHTPVYKSPPPPTPVYKSPPPP 175

Query: 318 T 320
           T
Sbjct: 176 T 176

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 56/125 (44%), Positives = 60/125 (48%), Gaps = 28/125 (22%)
 Frame = +3

Query: 6   ASPKVYYKSPPPP---YYSPSPKVYYKSPP--HPHVCVCPPPP---PCYSPSPKV----- 146
           +S    Y SPPPP   Y SP     YKSPP  H H     PPP   P Y P   V     
Sbjct: 24  SSANYQYSSPPPPVHVYPSPPHHPVYKSPPPHHHHPVYKSPPPSEKPHYPPHTPVYKSPP 83

Query: 147 ------VYKSPPPP--YVYNSPPP--PYYSPSPKVYYKSPPP----PSY-YSPSPKVEYK 281
                 VYKSPPPP     + PPP  P+Y P   V YKSPPP    P Y + P P   YK
Sbjct: 84  PHHHHPVYKSPPPPTPVYKSPPPPKTPHYPPHTPV-YKSPPPHHHHPVYKFPPPPTPVYK 142

Query: 282 SPPPP 296
           SPPPP
Sbjct: 143 SPPPP 147

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 51/110 (46%), Positives = 57/110 (51%), Gaps = 11/110 (10%)
 Frame = +3

Query: 57  SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY---VYNSPPP---PYYSPSPK 218
           S    Y SPP P V V P PP  + P    VYKSPPP +   VY SPPP   P+Y P   
Sbjct: 25  SANYQYSSPPPP-VHVYPSPP--HHP----VYKSPPPHHHHPVYKSPPPSEKPHYPPHTP 77

Query: 219 VYYKSPPP----PSYYSPSPKVE-YKSPPPPSYSPSPKTEY*ISRLPLYE 353
           V YKSPPP    P Y SP P    YKSPPP      PKT +     P+Y+
Sbjct: 78  V-YKSPPPHHHHPVYKSPPPPTPVYKSPPP------PKTPHYPPHTPVYK 120

[90][TOP]
>UniRef100_Q9STN1 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STN1_ARATH
          Length = 350

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 54/105 (51%), Positives = 61/105 (58%), Gaps = 7/105 (6%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY----SPSPKVVYKSPPPP-Y 173
           SP VY KSPPP     SP +Y   PP P+V   PPPPP Y     P P  VYKSPPPP +
Sbjct: 48  SPYVY-KSPPP-----SPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPF 101

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVE--YKSPPPPSY 302
           VY+SPPPP Y     +Y   PPPP  Y   P++   Y SPPPP Y
Sbjct: 102 VYSSPPPPTY-----IYNSPPPPPYVYKSVPRITFIYSSPPPPPY 141

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/139 (40%), Positives = 73/139 (52%), Gaps = 28/139 (20%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY---------------SPSPKVYYKSPPHPHVCVCPPPPP-CYSPSPK 143
           P   Y SPPPP Y                P P VY  +P  P +   PPPPP  Y+ +P+
Sbjct: 109 PTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPR 168

Query: 144 VVY---KSPPPPYVYNSPPPP--YYSPSPKV--YYKSPPPPSY-YSPSPKVE--YKSPPP 293
           V++     PPPPYVYNSPPPP   Y   P++   Y SPPPP Y Y+ +P++   Y SPPP
Sbjct: 169 VLFIYSSPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPP 228

Query: 294 PS--YSPSPKTEY*ISRLP 344
           P   Y+ +P+  +  S  P
Sbjct: 229 PPYVYNSAPRVPFIYSSPP 247

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 56/132 (42%), Positives = 69/132 (52%), Gaps = 35/132 (26%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-----------YS---PSPKVYYKSPPHPHVCVCPPPPP-CYSPSPKV 146
           P VY   PPPPY           YS   P P VY  +P  P +   PPPPP  Y+ +P+V
Sbjct: 180 PYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRV 239

Query: 147 --VYKSPPPP-YVYNS-----------PPPPY-YSPSPKV---YYKSPPPPSYYSPSPKV 272
             +Y SPPPP YVY S           PPPPY Y+ +P++   Y   PPPP  Y+ +P+V
Sbjct: 240 PFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSLPPPPYVYNSAPRV 299

Query: 273 E--YKSPPPPSY 302
              Y SPPPP Y
Sbjct: 300 PFIYSSPPPPPY 311

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 52/106 (49%), Positives = 55/106 (51%), Gaps = 8/106 (7%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           S +  Y    PP   P P VY    P P+V   PPP P    SP      PPPPYVYNSP
Sbjct: 25  SAQCKYSPQSPP---PQPYVYSPPLPSPYVYKSPPPSPYLYSSP------PPPPYVYNSP 75

Query: 189 PPP----YYS-PSPKVYYKSPPPPSY-YS--PSPKVEYKSPPPPSY 302
           PPP    Y S P P   YKSPPPP + YS  P P   Y SPPPP Y
Sbjct: 76  PPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPPY 121

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 55/129 (42%), Positives = 68/129 (52%), Gaps = 35/129 (27%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-----------YS---PSPKVYYKSPPHPHVCVCPPPPP-CYSPSPKV 146
           P +Y   PPPPY           YS   P P VY  +P  P +   PPPPP  Y   P++
Sbjct: 200 PFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRI 259

Query: 147 --VYKSPPPP-YVYNS-----------PPPPY-YSPSPKV--YYKSPPPPSY-YSPSPKV 272
             +Y SPPPP YVYNS           PPPPY Y+ +P+V   Y SPPPP Y Y+ +P++
Sbjct: 260 PFIYSSPPPPPYVYNSAPRIPFIYSSLPPPPYVYNSAPRVPFIYSSPPPPPYVYNSAPRI 319

Query: 273 E--YKSPPP 293
              Y SPPP
Sbjct: 320 PFIYSSPPP 328

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 54/143 (37%), Positives = 76/143 (53%), Gaps = 30/143 (20%)
 Frame = +3

Query: 6   ASPKVY--YKSPPPPYY-----SPSPKVYYKSPPHPHVCVCPPPPP-CYSPSPKV--VYK 155
           ++P+V   Y SPPPP Y      P P VY   P  P +   PPPPP  Y+ +P++  +Y 
Sbjct: 165 SAPRVLFIYSSPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYS 224

Query: 156 SPPPP-----------YVYNSPPPP--YYSPSPKV--YYKSPPPPSY-YSPSPKVE--YK 281
           SPPPP           ++Y+SPPPP   Y   P++   Y SPPPP Y Y+ +P++   Y 
Sbjct: 225 SPPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYS 284

Query: 282 SPPPPS--YSPSPKTEY*ISRLP 344
           S PPP   Y+ +P+  +  S  P
Sbjct: 285 SLPPPPYVYNSAPRVPFIYSSPP 307

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 40/81 (49%), Positives = 42/81 (51%), Gaps = 11/81 (13%)
 Frame = +3

Query: 111 PPPPCYSPSPKVVYKSPPPPYVYNSPPPP---YYSPSPKVY-YKSPPPPSYY----SPSP 266
           PPP  Y  SP +     P PYVY SPPP    Y SP P  Y Y SPPPP  Y     P P
Sbjct: 35  PPPQPYVYSPPL-----PSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRP 89

Query: 267 KVEYKSPPPPSY---SPSPKT 320
              YKSPPPP +   SP P T
Sbjct: 90  PYVYKSPPPPPFVYSSPPPPT 110

[91][TOP]
>UniRef100_Q94ES9 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES9_PEA
          Length = 183

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 64/150 (42%), Positives = 72/150 (48%), Gaps = 41/150 (27%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKV---YYKSPP----------HPHVCVCPPPPPCYS-PSPKVVYKSP 161
           Y SPPPP +SP P     +Y SPP          HPH     PPPP ++ P P  VY SP
Sbjct: 32  YSSPPPPVHSPPPPKDPHHYSSPPPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSP 91

Query: 162 PP------PYVYNSPPPP-----------YYSPSP------KVY-YKSPPPPSYYSPSPK 269
           PP      PY Y SPPPP           Y+SP P      K Y Y SPPPP  ++  P 
Sbjct: 92  PPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPH 151

Query: 270 VE---YKSPPPPSYSPSPKTEY*ISRLPLY 350
           V    Y SPPPP+YSP P   Y  S  P Y
Sbjct: 152 VPTPVYHSPPPPAYSPPPPAYYYKSPPPPY 181

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/114 (46%), Positives = 59/114 (51%), Gaps = 19/114 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPP------HPHVCVCPPPPPCYS-PSPKVVYKSPPP 167
           P   Y SPPPP ++ P P   Y SPP       P+    PPPPP ++ P P  VY SPPP
Sbjct: 67  PHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPP 126

Query: 168 -------PYVYNSPPPP----YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
                  PY Y SPPPP    Y    P   Y SPPPP+Y  P P   YKSPPPP
Sbjct: 127 PPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAYSPPPPAYYYKSPPPP 180

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 40/92 (43%), Positives = 48/92 (52%), Gaps = 11/92 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPP-------HPHVCVCPPPPPCYSPSPKV---VYKS 158
           P  Y   PPPP ++ P P   Y SPP        P+    PPPPP ++  P V   VY S
Sbjct: 100 PYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHS 159

Query: 159 PPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYY 254
           PPPP  Y+ PPP Y       YYKSPPPP ++
Sbjct: 160 PPPP-AYSPPPPAY-------YYKSPPPPYHH 183

[92][TOP]
>UniRef100_Q39600 Extensin n=1 Tax=Catharanthus roseus RepID=Q39600_CATRO
          Length = 217

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 63/137 (45%), Positives = 68/137 (49%), Gaps = 32/137 (23%)
 Frame = +3

Query: 12  PKVY-YKSPPPP---YYSPSPKVY-YKSPPHP---HVCVCPPPPPCYSPSPKVVYKSPPP 167
           P VY YKSPPPP   + SP P  Y YKSPP P   +    PPPPP     P  +YKSPPP
Sbjct: 49  PPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPP 108

Query: 168 PY-VYNSPPPPYYS--PSPK---VYYKSPPPPSYYS----------------PSPKVEYK 281
           P  +Y SPPPP Y   P PK   VY   PPPP  Y                 P P   +K
Sbjct: 109 PPPIYKSPPPPVYKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHK 168

Query: 282 SPPPPSYS--PSPKTEY 326
           SPPPP Y   P PK  Y
Sbjct: 169 SPPPPVYKSPPPPKKPY 185

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 53/102 (51%), Positives = 57/102 (55%), Gaps = 7/102 (6%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPK-VY-YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YV 176
           P  +Y SPPPP +SP P  VY YKSPP P      PPPP Y      VYKSPPPP   Y 
Sbjct: 32  PPYHYSSPPPPVHSPPPPPVYKYKSPPPPPPIHKSPPPPPY------VYKSPPPPPPVYK 85

Query: 177 YNSPPPP--YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
           Y SPPPP   +   P +Y   PPPP  Y   P   YKSPPPP
Sbjct: 86  YKSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPPVYKSPPPP 127

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 69/154 (44%), Positives = 75/154 (48%), Gaps = 43/154 (27%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY-----SPSPKVY-YKSPPHP--------HVCVCPPPPP--CYSPSPK 143
           P   +KSPPPP Y      P P VY YKSPP P        ++   PPPPP    SP P 
Sbjct: 60  PPPIHKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPP 119

Query: 144 VVYKSPPP---PYVYNSPPPP-----------------YYSPSPKVY-YKSPPPPSYYSP 260
            VYKSPPP   PYVY SPPPP                 Y SP P  + +KSPPPP Y SP
Sbjct: 120 -VYKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPPVYKSP 178

Query: 261 SPKVE---YKSPPPP---SYSPSPKTEY*ISRLP 344
            P  +   YKSPPPP     SP P   Y  S  P
Sbjct: 179 PPPKKPYVYKSPPPPPPIHKSPPPPYHYYYSSPP 212

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 60/119 (50%), Positives = 63/119 (52%), Gaps = 18/119 (15%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS----PSPKVVYKS-PPPPYVYNSP 188
           Y SPPPPY+  SP      PP  H    PPPPP Y     P P  ++KS PPPPYVY SP
Sbjct: 27  YSSPPPPYHYSSP------PPPVH---SPPPPPVYKYKSPPPPPPIHKSPPPPPYVYKSP 77

Query: 189 PPPYYSPSPKVY-YKSPPPPS---------YYSPSPKVE-YKSPPPPSYS--PSPKTEY 326
           PPP     P VY YKSPPPP          Y SP P    YKSPPPP Y   P PK  Y
Sbjct: 78  PPP-----PPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPPVYKSPPPPKNPY 131

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 55/113 (48%), Positives = 58/113 (51%), Gaps = 21/113 (18%)
 Frame = +3

Query: 21  YYKSPPPPYY-SPSPKVYYKSPPHPHVCVCPPPPPCY---SPSPKVVYKSPPPP---YVY 179
           Y   PPP +Y SP P V+   PP  +    PPPPP      P P  VYKSPPPP   Y Y
Sbjct: 27  YSSPPPPYHYSSPPPPVHSPPPPPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKY 86

Query: 180 NSPPPP----------YYS-PSPKVYYKSPPPPSYYSPSPKVE---YKSPPPP 296
            SPPPP          Y S P P   YKSPPPP Y SP P      YKSPPPP
Sbjct: 87  KSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPPVYKSPPPPKNPYVYKSPPPP 139

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/117 (46%), Positives = 61/117 (52%), Gaps = 20/117 (17%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPKVYYKSPP--HPHVCVCPPPPP--------CYSPSPKVVY 152
           P   YKSPPPP   Y SP P VY   PP  +P+V   PPPPP         +   P V  
Sbjct: 99  PPYIYKSPPPPPPIYKSPPPPVYKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYK 158

Query: 153 KSPPPPYVYNSPPPPYYS--PSPK--VYYKSPPPPS--YYSPSPKVEYK-SPPPPSY 302
             PPPP+V+ SPPPP Y   P PK    YKSPPPP   + SP P   Y  S PPP +
Sbjct: 159 SPPPPPFVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPIHKSPPPPYHYYYSSPPPPH 215

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 50/115 (43%), Positives = 61/115 (53%), Gaps = 15/115 (13%)
 Frame = +3

Query: 3   RASPKVYYKSPPPP-----YYSPSPK------VYYKSPPHPHVCVCPPPPP-CYSPSPKV 146
           ++ P   YKSPPPP     Y SP P       +++     P+V   PPPPP  +   P  
Sbjct: 114 KSPPPPVYKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPP 173

Query: 147 VYKSPPP---PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           VYKSPPP   PYVY SPPPP     P + +KSPPPP +Y       Y SPPPP +
Sbjct: 174 VYKSPPPPKKPYVYKSPPPP-----PPI-HKSPPPPYHY------YYSSPPPPHH 216

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 28/55 (50%), Positives = 31/55 (56%), Gaps = 7/55 (12%)
 Frame = +3

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYS----PSPKVEYKSPPPPSY---SPSP 314
           Y Y+SPPPPY+  SP     SPPPP  Y     P P   +KSPPPP Y   SP P
Sbjct: 25  YKYSSPPPPYHYSSPPPPVHSPPPPPVYKYKSPPPPPPIHKSPPPPPYVYKSPPP 79

[93][TOP]
>UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B501E
          Length = 406

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 52/116 (44%), Positives = 54/116 (46%), Gaps = 11/116 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVY--KSPPPPYVYNS 185
           P   Y  PPPP   P P  Y   PP P     PPPPP YSP P   Y    PPPP  Y  
Sbjct: 263 PPPAYGPPPPPPPPPPPAAYAYGPPPPPPP--PPPPPAYSPPPPPAYGPPPPPPPPAYAP 320

Query: 186 PPPPYYSPS--------PKVYYKSPPPPSYYSPSPKVEY-KSPPPPSYSPSPKTEY 326
           PPPP Y P         P  Y   PPPP+Y  P P   Y   PPPP YSP+P   Y
Sbjct: 321 PPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVVY 376

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/96 (47%), Positives = 48/96 (50%), Gaps = 1/96 (1%)
 Frame = +3

Query: 33  PPPPYYSPSPK-VYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           PPPP YSP P   Y   PP P     PPPPP Y P        PPP Y    PPP Y  P
Sbjct: 294 PPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPP 353

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
            P   Y  PPPP  YSP+P V Y  P PP   P+PK
Sbjct: 354 PPPPAYAPPPPPPKYSPAPIVVYGPPAPPPPPPAPK 389

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 48/107 (44%), Positives = 49/107 (45%), Gaps = 6/107 (5%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVY------KSPPPPY 173
           P  Y   PPPP Y+P P   Y  PP P     PPPPP Y P P   Y        PPPP 
Sbjct: 94  PPAYAPPPPPPAYAPPPPPAYAPPPPPPP---PPPPPSYGPPPPPAYGPPPPPPPPPPPP 150

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            Y  PPPP Y P P      PPPP  Y P P   Y  PPPP   P P
Sbjct: 151 AYGPPPPPAYGPPPPP--PPPPPPPAYGPPPPPAYGPPPPPPPPPPP 195

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 46/104 (44%), Positives = 52/104 (50%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y  +PPPP Y+P P     +PP P     PPPPP Y+P P      PPPP  Y 
Sbjct: 75  KPAPPAY--APPPPVYAPPPPPPAYAPPPPPPAYAPPPPPAYAPPPPP--PPPPPPPSYG 130

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PPPP Y P P      PPPP  Y P P   Y  PPPP   P P
Sbjct: 131 PPPPPAYGPPPPP--PPPPPPPAYGPPPPPAYGPPPPPPPPPPP 172

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/98 (46%), Positives = 48/98 (48%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP YSP P      PP P     PPPPP Y P P      PP  Y Y  PPPP   P 
Sbjct: 239 PPPPAYSPPPP---PPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPP 295

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           P  Y  SPPPP  Y P P      PPPP+Y+P P   Y
Sbjct: 296 PPAY--SPPPPPAYGPPP-----PPPPPAYAPPPPPAY 326

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/100 (46%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVY------KSPPPPYVYNSPPP 194
           PPPP Y P P   Y  PP P     PPPPP Y P P   Y        PPPP  Y  PPP
Sbjct: 124 PPPPSYGPPPPPAYGPPPPPPP---PPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPP 180

Query: 195 PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P Y P P      PPPP  Y P P   Y  PPPP   P P
Sbjct: 181 PAYGPPPPP--PPPPPPPAYGPPPPPAYGPPPPPPPPPPP 218

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/100 (46%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVY------KSPPPPYVYNSPPP 194
           PPPP Y P P   Y  PP P     PPPPP Y P P   Y        PPPP  Y  PPP
Sbjct: 147 PPPPAYGPPPPPAYGPPPPPPP---PPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPP 203

Query: 195 PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P Y P P      PPPP  Y P P   Y  PPPP   P P
Sbjct: 204 PAYGPPPPP--PPPPPPPAYGPPPPPAYGPPPPPPPPPPP 241

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/94 (48%), Positives = 47/94 (50%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP Y P P   Y  PP P     PPPPP Y P P   Y  PPPP     PPPP YSP 
Sbjct: 193 PPPPAYGPPPPPAYGPPPPPPP---PPPPPAYGPPPPPAYGPPPPPPP--PPPPPAYSPP 247

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P      PPPP+ Y P P   Y  PPPP   P P
Sbjct: 248 PPP--PPPPPPAAYGPPPPPAYGPPPPPPPPPPP 279

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/103 (45%), Positives = 50/103 (48%), Gaps = 9/103 (8%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP Y P P   Y  PP P     PPPPP YSP P      PPPP  Y  PPPP Y P 
Sbjct: 216 PPPPAYGPPPPPAYGPPPPPPP---PPPPPAYSPPPPP--PPPPPPAAYGPPPPPAYGPP 270

Query: 213 PKVYYKSPPPPSYYS---------PSPKVEYKSPPPPSYSPSP 314
           P      PPPP+ Y+         P P   Y  PPPP+Y P P
Sbjct: 271 PPP--PPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPP 311

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 48/108 (44%), Positives = 49/108 (45%), Gaps = 7/108 (6%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y  PPPP Y P P      PP P     PPPPP Y P P      PPPP  Y  PP
Sbjct: 171 PPPAYGPPPPPAYGPPPP---PPPPPPPPAYGPPPPPAYGPPPPP--PPPPPPPAYGPPP 225

Query: 192 PPYYSPSPKVYYKSPPPPSYYS-------PSPKVEYKSPPPPSYSPSP 314
           PP Y P P      PPPP  YS       P P   Y  PPPP+Y P P
Sbjct: 226 PPAYGPPPPP--PPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPP 271

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/106 (43%), Positives = 51/106 (48%), Gaps = 11/106 (10%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVY--------KSPPPPYVYNS 185
           SPPPP   P P   Y  PP P     PPPPP   P P   Y          PPPP  Y+ 
Sbjct: 245 SPPPPPPPPPPPAAYGPPPPP--AYGPPPPPP-PPPPPAAYAYGPPPPPPPPPPPPAYSP 301

Query: 186 PPPPYYS---PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP Y    P P   Y  PPPP+Y  P+P      PPPP+Y+P P
Sbjct: 302 PPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPP--PPPPPPAYAPPP 345

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 43/104 (41%), Positives = 46/104 (44%), Gaps = 6/104 (5%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           P PP Y+P P VY   PP P     PPPPP Y+P P   Y  PPPP      PPP     
Sbjct: 76  PAPPAYAPPPPVYAPPPPPPAYAP-PPPPPAYAPPPPPAYAPPPPP------PPP----- 123

Query: 213 PKVYYKSPPPPSYYSPSPKV------EYKSPPPPSYSPSPKTEY 326
                  PPPPSY  P P            PPPP+Y P P   Y
Sbjct: 124 -------PPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAY 160

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 40/92 (43%), Positives = 46/92 (50%), Gaps = 1/92 (1%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSP-PHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPK 218
           P YSP   VY   P P P     PPPPP Y    ++V        V   P PP Y+P P 
Sbjct: 42  PAYSP---VYAVVPAPQP-----PPPPPAYDDCDEIVL-------VPGKPAPPAYAPPPP 86

Query: 219 VYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           VY   PPPP+Y  P P   Y  PPPP+Y+P P
Sbjct: 87  VYAPPPPPPAYAPPPPPPAYAPPPPPAYAPPP 118

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 31/63 (49%), Positives = 34/63 (53%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPP Y  P P   Y  PP P     PPPPP YSP+P VVY  P PP     PPPP  +P 
Sbjct: 337 PPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVVYGPPAPP-----PPPP--APK 389

Query: 213 PKV 221
            K+
Sbjct: 390 RKL 392

[94][TOP]
>UniRef100_Q9SPM1 Extensin-like protein n=1 Tax=Solanum lycopersicum
           RepID=Q9SPM1_SOLLC
          Length = 711

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/107 (50%), Positives = 62/107 (57%), Gaps = 4/107 (3%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           ASP     SPPPP +SP P V+  SPP P   V  PPPP +SP P V   SPPPP   +S
Sbjct: 514 ASPPPPVHSPPPPVHSPPPPVH--SPPPP---VHSPPPPVHSPPPPVA--SPPPP--VHS 564

Query: 186 PPPPYYSPSPKVYYKSP----PPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP +SP P V+   P    PPP  +SP P     SPPPP +SP P
Sbjct: 565 PPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPPPVASPPPPVHSPPP 611

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 54/103 (52%), Positives = 61/103 (59%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           ASP     SPPPP  SP P V+  SPP P   V  PPPP +SP P V   SPPPP   +S
Sbjct: 450 ASPPPPVHSPPPPVASPPPPVH--SPPPPP--VASPPPPVHSPPPPVA--SPPPP--VHS 501

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP +SP P V   + PPP  +SP P V   SPPPP +SP P
Sbjct: 502 PPPPVHSPPPPV---ASPPPPVHSPPPPVH--SPPPPVHSPPP 539

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/106 (48%), Positives = 57/106 (53%), Gaps = 3/106 (2%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP---PPYVYN 182
           P V+   PPPP  SP P V+  SPP P   V  PPPP +SP P V    PP   PP   +
Sbjct: 588 PPVHSPPPPPPVASPPPPVH--SPPPP---VASPPPPVHSPPPPVASPPPPVHSPPPPVH 642

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           SPPPP +SP P V   SPPP   +SP P V    PP P  SP P T
Sbjct: 643 SPPPPVHSPPPPV--ASPPPALVFSPPPPVHSPPPPAPVMSPPPPT 686

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/102 (51%), Positives = 59/102 (57%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP +SP P V+  SPP P   V  PPPP  SP P V   SPPPP    SP
Sbjct: 550 SPPPPVASPPPPVHSPPPPVH--SPPPP---VHSPPPPVASPPPPV--HSPPPPPPVASP 602

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP +SP P V   + PPP  +SP P V   SPPPP +SP P
Sbjct: 603 PPPVHSPPPPV---ASPPPPVHSPPPPV--ASPPPPVHSPPP 639

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/99 (52%), Positives = 59/99 (59%), Gaps = 4/99 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP +SP P V   SPP P   V  PPPP +SP P V   SPPPP   +SPPPP +SP
Sbjct: 480 SPPPPVHSPPPPV--ASPPPP---VHSPPPPVHSPPPPVA--SPPPPV--HSPPPPVHSP 530

Query: 210 SPKVYYKSP----PPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P V+   P    PPP  +SP P V   SPPPP +SP P
Sbjct: 531 PPPVHSPPPPVHSPPPPVHSPPPPV--ASPPPPVHSPPP 567

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/99 (51%), Positives = 59/99 (59%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           ASP     SPPPP  SP P V+  SPP P   V  PPPP +SP P V   SPPPP   +S
Sbjct: 600 ASPPPPVHSPPPPVASPPPPVH--SPPPP---VASPPPPVHSPPPPV--HSPPPP--VHS 650

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PPPP  SP P + + SPPPP  +SP P     SPPPP++
Sbjct: 651 PPPPVASPPPALVF-SPPPP-VHSPPPPAPVMSPPPPTF 687

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 51/98 (52%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP  SP P V+  SPP P V    PPPP +SP P V   SPPPP V++ PPPP  SP 
Sbjct: 430 PPPPKTSPPPPVH--SPPPPPVA--SPPPPVHSPPPPVA--SPPPP-VHSPPPPPVASPP 482

Query: 213 PKVYYKSP----PPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P V+   P    PPP  +SP P V   SPPPP  SP P
Sbjct: 483 PPVHSPPPPVASPPPPVHSPPPPVH--SPPPPVASPPP 518

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/99 (52%), Positives = 56/99 (56%), Gaps = 4/99 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP +SP P     SPP P   V  PPPP  SP P V   SPPPP V  SPPPP +SP
Sbjct: 436 SPPPPVHSPPPPPV-ASPPPP---VHSPPPPVASPPPPV--HSPPPPPV-ASPPPPVHSP 488

Query: 210 SPKVYYKSP----PPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P V    P    PPP  +SP P V   SPPPP +SP P
Sbjct: 489 PPPVASPPPPVHSPPPPVHSPPPPV--ASPPPPVHSPPP 525

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/101 (48%), Positives = 55/101 (54%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   +  PPP +  P P     SPP P   V  PPPP +SP P V   SPPPP    SPP
Sbjct: 538 PPPVHSPPPPVHSPPPP---VASPPPP---VHSPPPPVHSPPPPV--HSPPPPVA--SPP 587

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP +SP P     SPPPP  +SP P V   SPPPP +SP P
Sbjct: 588 PPVHSPPPPPPVASPPPP-VHSPPPPV--ASPPPPVHSPPP 625

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 45/95 (47%), Positives = 52/95 (54%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           +PP P    +PK    SPP P   + PPPP    P P  V+  PPPP    SPPPP +SP
Sbjct: 406 TPPKPSTPTTPKPN-PSPPPPKT-LPPPPPKTSPPPP--VHSPPPPPVA--SPPPPVHSP 459

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P V   SPPPP +  P P V   SPPPP +SP P
Sbjct: 460 PPPV--ASPPPPVHSPPPPPV--ASPPPPVHSPPP 490

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 44/98 (44%), Positives = 51/98 (52%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP +SP P V+  SPP P   V  PPPP  SP P +V+ SPPPP     P
Sbjct: 622 SPPPPVASPPPPVHSPPPPVH--SPPPP---VHSPPPPVASPPPALVF-SPPPPVHSPPP 675

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           P P  SP P  +     PP+  S      Y SPPPP +
Sbjct: 676 PAPVMSPPPPTFEDVALPPTLGS-----LYASPPPPIF 708

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/87 (45%), Positives = 46/87 (52%), Gaps = 5/87 (5%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           ASP     SPPPP +SP P V+  SPP P     PPP   +SP P V   SPPPP    S
Sbjct: 628 ASPPPPVHSPPPPVHSPPPPVH--SPPPP--VASPPPALVFSPPPPV--HSPPPPAPVMS 681

Query: 186 PPPPYYS-----PSPKVYYKSPPPPSY 251
           PPPP +      P+    Y SPPPP +
Sbjct: 682 PPPPTFEDVALPPTLGSLYASPPPPIF 708

[95][TOP]
>UniRef100_Q01944 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01944_SOLLC
          Length = 75

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 52/101 (51%), Positives = 53/101 (52%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP        PP P           SPPPPY Y+SPP
Sbjct: 6   PPYYYKSPPPP--SPPPPYYYKSPP--------PPSP-----------SPPPPYYYSSPP 44

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  SP P  YY SPPPP           KSPPPP Y  SP
Sbjct: 45  PPKPSPPPPYYYSSPPPPK----------KSPPPPYYYSSP 75

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/73 (57%), Positives = 42/73 (57%)
 Frame = +3

Query: 108 PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP 287
           P PPP Y  SP     SPPPPY Y SPPPP  SP P  YY SPPPP   SP P   Y SP
Sbjct: 3   PSPPPYYYKSPPP--PSPPPPYYYKSPPPPSPSPPPPYYYSSPPPPKP-SPPPPYYYSSP 59

Query: 288 PPPSYSPSPKTEY 326
           PPP  SP P   Y
Sbjct: 60  PPPKKSPPPPYYY 72

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 40/71 (56%), Positives = 40/71 (56%)
 Frame = +3

Query: 132 PSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
           PSP       PPPY Y SPPPP  SP P  YYKSPPPPS  SP P   Y SPPPP   PS
Sbjct: 1   PSPS------PPPYYYKSPPPP--SPPPPYYYKSPPPPSP-SPPPPYYYSSPPPP--KPS 49

Query: 312 PKTEY*ISRLP 344
           P   Y  S  P
Sbjct: 50  PPPPYYYSSPP 60

[96][TOP]
>UniRef100_C5Y7E8 Putative uncharacterized protein Sb05g025945 (Fragment) n=1
           Tax=Sorghum bicolor RepID=C5Y7E8_SORBI
          Length = 360

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 51/101 (50%), Positives = 52/101 (51%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P     SPPPP  SP P     SPP P V   PPP P  SP P V  KSPPPP   +SPP
Sbjct: 188 PPAPVSSPPPPVKSPPPPAPVSSPPPP-VKSPPPPAPLSSPPPPV--KSPPPPAPVSSPP 244

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  SP P     SPPPP    P P     SPPPP  SP P
Sbjct: 245 PPVKSPPPPAPVSSPPPPVKSPPPPPAPVSSPPPPEKSPPP 285

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/106 (49%), Positives = 55/106 (51%), Gaps = 2/106 (1%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           +SP    KSPPPP    SP    KSPP P   +  PPPP  SP P     SPPPP     
Sbjct: 193 SSPPPPVKSPPPPAPVSSPPPPVKSPPPP-APLSSPPPPVKSPPPPAPVSSPPPPVKSPP 251

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS--YSPSPK 317
           PP P  SP P V  KSPPPP     SP    KSPPPP+   SP PK
Sbjct: 252 PPAPVSSPPPPV--KSPPPPPAPVSSPPPPEKSPPPPAPVSSPPPK 295

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 49/94 (52%), Positives = 51/94 (54%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PP P  SP P+V  K PP P     PPP P  SP P V  KSPPPP   +SPPPP  SP 
Sbjct: 166 PPAPVSSPPPEV--KPPPAPKPL--PPPAPVSSPPPPV--KSPPPPAPVSSPPPPVKSPP 219

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P     SPPPP   SP P     SPPPP  SP P
Sbjct: 220 PPAPLSSPPPP-VKSPPPPAPVSSPPPPVKSPPP 252

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 50/103 (48%), Positives = 52/103 (50%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           +SP    K PP P   P P     S P P V   PPP P  SP P V  KSPPPP   +S
Sbjct: 171 SSPPPEVKPPPAPKPLPPPAPV--SSPPPPVKSPPPPAPVSSPPPPV--KSPPPPAPLSS 226

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP  SP P     SPPPP   SP P     SPPPP  SP P
Sbjct: 227 PPPPVKSPPPPAPVSSPPPP-VKSPPPPAPVSSPPPPVKSPPP 268

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 51/104 (49%), Positives = 54/104 (51%), Gaps = 1/104 (0%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           +SP    KSPPPP    SP    KSPP P   V  PPPP  SP P     SPPPP V + 
Sbjct: 209 SSPPPPVKSPPPPAPLSSPPPPVKSPP-PPAPVSSPPPPVKSPPPPAPVSSPPPP-VKSP 266

Query: 186 PPPPYYSPSPKVYYKSPPPPS-YYSPSPKVEYKSPPPPSYSPSP 314
           PPPP    SP    KSPPPP+   SP PK     PP P  SP P
Sbjct: 267 PPPPAPVSSPPPPEKSPPPPAPVSSPPPKPPSLPPPAPVSSPPP 310

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 46/103 (44%), Positives = 51/103 (49%), Gaps = 2/103 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P     SPPPP  SP P     SPP P     PPPP   S  P  V   PPPP   +SPP
Sbjct: 220 PPAPLSSPPPPVKSPPPPAPVSSPPPP--VKSPPPPAPVSSPPPPVKSPPPPPAPVSSPP 277

Query: 192 PPYYSPSPKVYYKSPP--PPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  SP P     SPP  PPS   P+P     S PPP+ +P+P
Sbjct: 278 PPEKSPPPPAPVSSPPPKPPSLPPPAP----VSSPPPAVTPAP 316

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 48/110 (43%), Positives = 51/110 (46%), Gaps = 6/110 (5%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP------P 164
           + SP     S PPP    SP     S P P     PPP P  SP P+V  K P      P
Sbjct: 130 KPSPPPAPVSSPPPVVKSSPPPAPVSLPPPAPKTLPPPAPVSSPPPEV--KPPPAPKPLP 187

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP   +SPPPP  SP P     SPPPP   SP P     SPPPP  SP P
Sbjct: 188 PPAPVSSPPPPVKSPPPPAPVSSPPPP-VKSPPPPAPLSSPPPPVKSPPP 236

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 45/101 (44%), Positives = 49/101 (48%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P     SPPPP  SP P     SPP P     PPPPP    SP    KSPPPP   +SPP
Sbjct: 236 PPAPVSSPPPPVKSPPPPAPVSSPPPP--VKSPPPPPAPVSSPPPPEKSPPPPAPVSSPP 293

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P   S  P     SPPP    +P PK E  +P PP+ S  P
Sbjct: 294 PKPPSLPPPAPVSSPPPAVTPAP-PKKEESTPAPPAESLPP 333

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/100 (43%), Positives = 49/100 (49%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           +SP    KSPPPP    SP    KSPP P   V  PPPP  SP P     SPPP      
Sbjct: 241 SSPPPPVKSPPPPAPVSSPPPPVKSPPPPPAPVSSPPPPEKSPPPPAPVSSPPPKPPSLP 300

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           PP P  SP P V   +P PP     +P    +S PPPS++
Sbjct: 301 PPAPVSSPPPAV---TPAPPKKEESTPAPPAESLPPPSFN 337

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 42/98 (42%), Positives = 47/98 (47%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPP   SP P      PP P     P PPP    SP  V K  PPP   +SPPP   S 
Sbjct: 2   SPPPVKSSPPPAPVSSPPPTPK----PSPPPAPVKSPPQVEKKTPPPAPVSSPPPAVKSS 57

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
            P +  KS  PP+  SP P+ E +S PPP    SP  E
Sbjct: 58  PPPLTPKSSGPPAQVSPPPEDEEESSPPPVVKSSPPPE 95

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 45/112 (40%), Positives = 51/112 (45%), Gaps = 8/112 (7%)
 Frame = +3

Query: 3   RASPKVYYKSPPP-PYYSPSPKVYYKSPP------HPHVCVCPPPPPCYSPSPK-VVYKS 158
           ++ P+V  K+PPP P  SP P V    PP       P   V PPP      SP  VV  S
Sbjct: 32  KSPPQVEKKTPPPAPVSSPPPAVKSSPPPLTPKSSGPPAQVSPPPEDEEESSPPPVVKSS 91

Query: 159 PPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP     SPPP   S  P V   +PPP    SP P  +   PP P  SP P
Sbjct: 92  PPPETPKLSPPPAPVSSPPPVVKSTPPPAPVSSPPPAPKPSPPPAPVSSPPP 143

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 48/115 (41%), Positives = 52/115 (45%), Gaps = 14/115 (12%)
 Frame = +3

Query: 12  PKVYYKSPPP-PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           P+    SPPP P  SP P V  KS P P     PPP P  SP P  V  S PPP V +SP
Sbjct: 94  PETPKLSPPPAPVSSPPPVV--KSTPPPAPVSSPPPAPKPSPPPAPV--SSPPPVVKSSP 149

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVE-------------YKSPPPPSYSPSP 314
           PP   S  P      PPP    SP P+V+               SPPPP  SP P
Sbjct: 150 PPAPVSLPPPAPKTLPPPAPVSSPPPEVKPPPAPKPLPPPAPVSSPPPPVKSPPP 204

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 45/101 (44%), Positives = 51/101 (50%), Gaps = 4/101 (3%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPP-PCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           S PP   SP P+   +S P P V   PPP  P  SP P  V  S PPP V ++PPP   S
Sbjct: 66  SGPPAQVSPPPEDEEESSPPPVVKSSPPPETPKLSPPPAPV--SSPPPVVKSTPPPAPVS 123

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS---PSPKT 320
             P     SPPP    SP P V+  SPPP   S   P+PKT
Sbjct: 124 SPPPAPKPSPPPAPVSSPPPVVK-SSPPPAPVSLPPPAPKT 163

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/108 (37%), Positives = 46/108 (42%), Gaps = 11/108 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P     SPPPP  SP P     S P P     PPP P  SP PK    S PPP   +SPP
Sbjct: 252 PPAPVSSPPPPVKSPPPPPAPVSSPPPPEKSPPPPAPVSSPPPKP--PSLPPPAPVSSPP 309

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKV-----------EYKSPPPPSY 302
           P      PK    +P PP+   P P             +Y SPPPP +
Sbjct: 310 PAVTPAPPKKEESTPAPPAESLPPPSFNDIILPPIMANKYASPPPPQF 357

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 41/113 (36%), Positives = 48/113 (42%), Gaps = 7/113 (6%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           + P      PP      SP    KS P P      PPP   S  P VV  +PPP  V + 
Sbjct: 66  SGPPAQVSPPPEDEEESSPPPVVKSSPPPETPKLSPPPAPVSSPPPVVKSTPPPAPVSSP 125

Query: 186 PPPPYYSP------SPKVYYKSPPPPSYYS-PSPKVEYKSPPPPSYSPSPKTE 323
           PP P  SP      SP    KS PPP+  S P P  +   PP P  SP P+ +
Sbjct: 126 PPAPKPSPPPAPVSSPPPVVKSSPPPAPVSLPPPAPKTLPPPAPVSSPPPEVK 178

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 42/107 (39%), Positives = 43/107 (40%), Gaps = 6/107 (5%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P V   SPPP     SP     S P P V   PPP P  SP P    K  PPP   +SPP
Sbjct: 85  PPVVKSSPPPETPKLSPPPAPVSSPPPVVKSTPPPAPVSSPPPAP--KPSPPPAPVSSPP 142

Query: 192 PPYYSPSPKVYYKSPPPPSYYSP------SPKVEYKSPPPPSYSPSP 314
           P   S  P      PPP     P      SP  E K PP P   P P
Sbjct: 143 PVVKSSPPPAPVSLPPPAPKTLPPPAPVSSPPPEVKPPPAPKPLPPP 189

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 46/123 (37%), Positives = 52/123 (42%), Gaps = 19/123 (15%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPK-VYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           ++SP     S PPP   PSP     KSPP       PPP P  SP P  V  SPPP    
Sbjct: 7   KSSPPPAPVSSPPPTPKPSPPPAPVKSPPQVEKKT-PPPAPVSSPPP-AVKSSPPPLTPK 64

Query: 180 NSPPPPYYSPSPK---------VYYKSPPPPS---------YYSPSPKVEYKSPPPPSYS 305
           +S PP   SP P+         V   SPPP +           SP P V+   PP P  S
Sbjct: 65  SSGPPAQVSPPPEDEEESSPPPVVKSSPPPETPKLSPPPAPVSSPPPVVKSTPPPAPVSS 124

Query: 306 PSP 314
           P P
Sbjct: 125 PPP 127

[97][TOP]
>UniRef100_UPI0001982EE5 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982EE5
          Length = 746

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/107 (51%), Positives = 61/107 (57%), Gaps = 5/107 (4%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP    +SPPPP YSPSP V+   PP  H     PPPP  SP P V   SPPPP V +SP
Sbjct: 608 SPPPPVQSPPPPLYSPSPPVHSPPPPPVH----SPPPPVRSPPPPV--SSPPPPPV-SSP 660

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEY-----KSPPPPSYSPSP 314
           PPP +SP P V   S PPP   SP P V +      SPPPP +SP P
Sbjct: 661 PPPVHSPPPPV---SSPPPPVSSPHPPVAFPPPPVSSPPPPVHSPPP 704

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/106 (50%), Positives = 59/106 (55%), Gaps = 3/106 (2%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP---PPYV 176
           +SP     S PPP  SP P V+   PP P V   PPP P  SP P V    PP   PP  
Sbjct: 554 SSPPPPVHSTPPPVRSPPPPVFSPPPPIP-VRSPPPPTPVRSPPPSVSSPPPPEHSPPPP 612

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             SPPPP YSPSP V+  SPPPP  +SP P V  +SPPPP  SP P
Sbjct: 613 VQSPPPPLYSPSPPVH--SPPPPPVHSPPPPV--RSPPPPVSSPPP 654

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 55/125 (44%), Positives = 61/125 (48%), Gaps = 25/125 (20%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPP--------------------PPCYSPSPKV 146
           +SPPPP +SP P +  +SPP P     PPP                    PP YSPSP V
Sbjct: 568 RSPPPPVFSPPPPIPVRSPPPPTPVRSPPPSVSSPPPPEHSPPPPVQSPPPPLYSPSPPV 627

Query: 147 VYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVE-----YKSPPPPSYSPS 311
              SPPPP V+ SPPPP  SP P V   SPPPP   SP P V        SPPPP  SP 
Sbjct: 628 --HSPPPPPVH-SPPPPVRSPPPPV--SSPPPPPVSSPPPPVHSPPPPVSSPPPPVSSPH 682

Query: 312 PKTEY 326
           P   +
Sbjct: 683 PPVAF 687

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 47/108 (43%), Positives = 55/108 (50%), Gaps = 7/108 (6%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP---PPPPCYSPSPKVVYKSPPPPYVYN 182
           P  +  +PP P   PSP      PP  H    P   PPPP +SP P +  +SPPPP    
Sbjct: 534 PPPHKATPPTPTPKPSPAPISSPPPPVHSTPPPVRSPPPPVFSPPPPIPVRSPPPPTPVR 593

Query: 183 SPPPPYYSPSPKVYYKSP----PPPSYYSPSPKVEYKSPPPPSYSPSP 314
           SPPP   SP P  +   P    PPP  YSPSP V +  PPPP +SP P
Sbjct: 594 SPPPSVSSPPPPEHSPPPPVQSPPPPLYSPSPPV-HSPPPPPVHSPPP 640

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/113 (41%), Positives = 57/113 (50%), Gaps = 15/113 (13%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPP-------PCYSPSPKVVYKSPPPPYVYNSP 188
           +PP P  +P+P    K  PHP     PPPP       P   PSP  +  SPPPP   +S 
Sbjct: 507 APPTPTPTPTPTPKPKPSPHPPKTSSPPPPHKATPPTPTPKPSPAPI-SSPPPPV--HST 563

Query: 189 PPPYYSPSPKVY-------YKSPPPPS-YYSPSPKVEYKSPPPPSYSPSPKTE 323
           PPP  SP P V+        +SPPPP+   SP P V   SPPPP +SP P  +
Sbjct: 564 PPPVRSPPPPVFSPPPPIPVRSPPPPTPVRSPPPSV--SSPPPPEHSPPPPVQ 614

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 44/113 (38%), Positives = 55/113 (48%), Gaps = 10/113 (8%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP---PPPPCYSPSPKVVYKSPPPPYV 176
           A PK    +PP P   PSP     S P P     P   PP P  +P+P    K  P P  
Sbjct: 473 APPK---STPPTPKPRPSPPKSVPSTPKPQPSPSPVSAPPTPTPTPTPTPKPKPSPHPPK 529

Query: 177 YNSPPPPYY----SPSPK---VYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            +SPPPP+     +P+PK       SPPPP + +P P    +SPPPP +SP P
Sbjct: 530 TSSPPPPHKATPPTPTPKPSPAPISSPPPPVHSTPPP---VRSPPPPVFSPPP 579

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 40/87 (45%), Positives = 46/87 (52%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           R+ P      PPPP  SP P V+  SPP P   V  PPPP  SP P V +  PPPP   +
Sbjct: 643 RSPPPPVSSPPPPPVSSPPPPVH--SPPPP---VSSPPPPVSSPHPPVAF--PPPPV--S 693

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPS 263
           SPPPP +SP        PPPP +  PS
Sbjct: 694 SPPPPVHSP--------PPPPVFSPPS 712

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 39/113 (34%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +3

Query: 12  PKVYYKSP-PPPYYSPSPKVYYKSPPHPHVCVCPP-----PPPCYSPSPKVVYKSPPPPY 173
           P+   +SP PPP  +P      K  PHP     PP     PP    P+PK     P PP 
Sbjct: 434 PRPPVRSPTPPPASTPRSPPTPKPQPHPSPSPSPPKPQPAPPKSTPPTPK---PRPSPPK 490

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP----PPPSYSPSPKT 320
              S P P  SPSP     +P P    +P PK     P    PPP +  +P T
Sbjct: 491 SVPSTPKPQPSPSPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPPPPHKATPPT 543

[98][TOP]
>UniRef100_Q40502 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40502_TOBAC
          Length = 280

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 64/125 (51%), Positives = 69/125 (55%), Gaps = 15/125 (12%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPP--PCYSPSPKVVYKSPPPPY-VYNS 185
           YKSPPPP   Y SP P      PPH  +   PPPP  P Y P   V YKSPPPP  VY S
Sbjct: 120 YKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYPPHTPV-YKSPPPPTPVYKS 178

Query: 186 PPPP---YYSPSPKVYYKSPPPPS--YYSPSPKVEYKSPPPPS---YSPSP-KTEY*ISR 338
           PPPP   +Y P   VY KSPPPP   YY P   V YKSPPPP+    SP P K  Y    
Sbjct: 179 PPPPKKPHYPPHTPVY-KSPPPPKKPYYPPHTPV-YKSPPPPTPVYKSPPPSKKPYYPPH 236

Query: 339 LPLYE 353
            P+Y+
Sbjct: 237 TPVYK 241

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 61/114 (53%), Positives = 62/114 (54%), Gaps = 13/114 (11%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPPPC-YSPSPKVVYKSPPPPY-VYNSP 188
           YKSPPPP   Y SP P      PPH  V   PPPP   Y P    VYKSPPPP  VY SP
Sbjct: 166 YKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSP 225

Query: 189 PP---PYYSPSPKVYYKSPPPPS--YYSPSPKVE-YKSPPP--PSYSPSPKTEY 326
           PP   PYY P   V YKSPPPP+  Y SP P    YKSPPP  P    SP   Y
Sbjct: 226 PPSKKPYYPPHTPV-YKSPPPPTPVYKSPPPPTPVYKSPPPHHPYVYASPPPPY 278

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 60/123 (48%), Positives = 62/123 (50%), Gaps = 28/123 (22%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPKVYYKSPPHPHVCVCPPPPPCYS--PSPKVVYKSPPPPY- 173
           P   YKSPPPP   YY P P VY KSPP P      P  P Y   P P  VYKSPPPP  
Sbjct: 80  PVPVYKSPPPPKKPYYPPHPPVY-KSPPPPKKPYSLPHTPVYKSPPPPTPVYKSPPPPKK 138

Query: 174 --------VYNSPPP---PYYSPSPKVY---------YKSPPPPS--YYSPSPKVEYKSP 287
                   +Y SPPP   PYY P   VY         YKSPPPP   +Y P   V YKSP
Sbjct: 139 PHYPPHTPIYKSPPPPNKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPV-YKSP 197

Query: 288 PPP 296
           PPP
Sbjct: 198 PPP 200

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 61/133 (45%), Positives = 67/133 (50%), Gaps = 17/133 (12%)
 Frame = +3

Query: 6   ASPKVYYKSPPPP-----YYSPSPKVY-YKSPPHPHVCVCPPPPPC-YSPSPKV-----V 149
           +S    Y SPPPP     Y SP P V+ Y SPPH  V   PPPP   Y PSP       V
Sbjct: 24  SSANYQYSSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPV 83

Query: 150 YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPS----YSPSP 314
           YKSPPPP        PYY P P VY KSPPPP   YS      YKSPPPP+      P P
Sbjct: 84  YKSPPPP------KKPYYPPHPPVY-KSPPPPKKPYSLPHTPVYKSPPPPTPVYKSPPPP 136

Query: 315 KTEY*ISRLPLYE 353
           K  +     P+Y+
Sbjct: 137 KKPHYPPHTPIYK 149

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 64/142 (45%), Positives = 67/142 (47%), Gaps = 39/142 (27%)
 Frame = +3

Query: 12  PKVYYKSPPPP-----------YYSPSP--KVYYKSPPHPHVCVCPPPPPCYSPSPKVVY 152
           P   YKSPPPP           Y SP P  K YY  PPH  V   PPP       P  VY
Sbjct: 126 PTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYY--PPHTPVYKSPPP-------PTPVY 176

Query: 153 KSPPPPY---------VYNSPPP---PYYSPSPKVYYKSPPPPS--YYSPSPKVE----- 275
           KSPPPP          VY SPPP   PYY P   V YKSPPPP+  Y SP P  +     
Sbjct: 177 KSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPV-YKSPPPPTPVYKSPPPSKKPYYPP 235

Query: 276 ----YKSPPPPS---YSPSPKT 320
               YKSPPPP+    SP P T
Sbjct: 236 HTPVYKSPPPPTPVYKSPPPPT 257

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 54/114 (47%), Positives = 55/114 (48%), Gaps = 19/114 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPP-----------YYSPSP--KVYYKSPPHPHVCVCPPPP-PCY-SPSPKV 146
           P   YKSPPPP           Y SP P  K YY  PPH  V   PPPP P Y SP P  
Sbjct: 172 PTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYY--PPHTPVYKSPPPPTPVYKSPPPSK 229

Query: 147 VYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPS--YYSPSP--KVEYKSPPPP 296
               PP   VY SPPP      P   YKSPPPP+  Y SP P     Y SPPPP
Sbjct: 230 KPYYPPHTPVYKSPPP------PTPVYKSPPPPTPVYKSPPPHHPYVYASPPPP 277

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 38/78 (48%), Positives = 39/78 (50%), Gaps = 14/78 (17%)
 Frame = +3

Query: 12  PKVYYKSPPP---PYY--------SPSPKV-YYKSPPHPHVCVCPPPPPCYSPSPKVVYK 155
           P   YKSPPP   PYY        SP P    YKSPP       PP P         VYK
Sbjct: 218 PTPVYKSPPPSKKPYYPPHTPVYKSPPPPTPVYKSPP-------PPTP---------VYK 261

Query: 156 SPPP--PYVYNSPPPPYY 203
           SPPP  PYVY SPPPPY+
Sbjct: 262 SPPPHHPYVYASPPPPYH 279

[99][TOP]
>UniRef100_B9H7Q5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H7Q5_POPTR
          Length = 173

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 58/115 (50%), Positives = 62/115 (53%), Gaps = 20/115 (17%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPK---VYYKSPPHPHVCVCPPPPPC-----YSPSPKVVYKSPPPP--- 170
           Y SPPPP  SP P     +YKSPP P     PPPPP        P P  V+KSPPPP   
Sbjct: 31  YSSPPPPKKSPPPPPPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPPPVHKSPPPPKKP 90

Query: 171 YVYNSPPPP-YYSPSPKVY---YKSPPPP----SYYSPSPKVE-YKSPPPPSYSP 308
           Y Y SPPPP  +SP P  +   YKSPPPP     Y SP P    YKSPPPP   P
Sbjct: 91  YKYKSPPPPPVHSPPPPSHPYKYKSPPPPPPVYKYKSPPPPPPVYKSPPPPPKKP 145

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 41/79 (51%), Positives = 46/79 (58%), Gaps = 11/79 (13%)
 Frame = +3

Query: 111 PPPPCYSPSPKVVYKSPPPPYVYNSPPPP--YYSPSPKVY---YKSPPPPS--YYSPSP- 266
           PPPP  SP P      PPPPY Y SPPPP   +SP P  +   YKSPPPP   + SP P 
Sbjct: 34  PPPPKKSPPP------PPPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPPPVHKSPPPP 87

Query: 267 --KVEYKSPPPPS-YSPSP 314
               +YKSPPPP  +SP P
Sbjct: 88  KKPYKYKSPPPPPVHSPPP 106

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/99 (41%), Positives = 47/99 (47%), Gaps = 1/99 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS-PPPPYVYNSP 188
           P  Y   PPPP +SP P      P HP+    PPPPP     P   YKS PPPP VY SP
Sbjct: 90  PYKYKSPPPPPVHSPPP------PSHPYKYKSPPPPP-----PVYKYKSPPPPPPVYKSP 138

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           PPP     PK  Y +    S  S    ++ +   P SYS
Sbjct: 139 PPP-----PKKPYNT-QVSSTTSSQEAIQIQVSSPTSYS 171

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 37/96 (38%), Positives = 43/96 (44%), Gaps = 14/96 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPP-----YYSPSPKVYYKSPP--HPHVCVCPPPPPCY-----SPSPKVVYK 155
           P   +KSPPPP     Y SP P   +  PP  HP+    PPPPP        P P  VYK
Sbjct: 77  PPPVHKSPPPPKKPYKYKSPPPPPVHSPPPPSHPYKYKSPPPPPPVYKYKSPPPPPPVYK 136

Query: 156 SPPPP--YVYNSPPPPYYSPSPKVYYKSPPPPSYYS 257
           SPPPP    YN+      S    +  +   P SY S
Sbjct: 137 SPPPPPKKPYNTQVSSTTSSQEAIQIQVSSPTSYSS 172

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 32/66 (48%), Positives = 34/66 (51%), Gaps = 7/66 (10%)
 Frame = +3

Query: 150 YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSP---KVEYKSPPPP----SYSP 308
           Y SPPPP    SPPPP   P P  Y   PPPP  +SP P     +YKSPPPP       P
Sbjct: 31  YSSPPPPK--KSPPPP---PPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPPPVHKSPP 85

Query: 309 SPKTEY 326
            PK  Y
Sbjct: 86  PPKKPY 91

[100][TOP]
>UniRef100_Q8LK15 Extensin n=1 Tax=Brassica napus RepID=Q8LK15_BRANA
          Length = 259

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/109 (48%), Positives = 57/109 (52%), Gaps = 18/109 (16%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPP-HPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSPP 191
           YKSPPPP    +P VY+  PP   H     PPPP    S   VY SPPPP   YVY SPP
Sbjct: 148 YKSPPPPVKHYTPPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVYHSPPPPKKHYVYKSPP 207

Query: 192 PPYYSPSPKVYYKSPPPPS----YYSPSPKVE----------YKSPPPP 296
           PP    SP++ Y SPPPP     Y SP P V           YKSPPPP
Sbjct: 208 PPVKHYSPRLVYHSPPPPKKKYVYKSPPPPVRHYFPPHHLYLYKSPPPP 256

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 58/134 (43%), Positives = 66/134 (49%), Gaps = 32/134 (23%)
 Frame = +3

Query: 21  YYKSPPPP-----YYSPSPKV--YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP--- 170
           + +SPPPP     Y SP P V  Y   PP+ +     PPPP    SP  VY SPPPP   
Sbjct: 86  WLRSPPPPRKDYVYKSPPPPVKQYSSPPPNKYYVYQSPPPPVKHYSPPSVYHSPPPPKNQ 145

Query: 171 YVYNSPPPPYYSPSPKVY-----------YKSPPPP--------SYYSPSPKVE---YKS 284
           YVY SPPPP    +P VY           YKSPPPP         Y+SP P  +   YKS
Sbjct: 146 YVYKSPPPPVKHYTPPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVYHSPPPPKKHYVYKS 205

Query: 285 PPPPSYSPSPKTEY 326
           PPPP    SP+  Y
Sbjct: 206 PPPPVKHYSPRLVY 219

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 58/130 (44%), Positives = 63/130 (48%), Gaps = 29/130 (22%)
 Frame = +3

Query: 24  YKSPPPPYYSPS-PKVYYK-SPPHPHVCVCPPPPPC--YSP----SP-----KVVYKSPP 164
           YKSPPPP    S P+VY+   PP  H     PPPP   YSP    SP       VYKSPP
Sbjct: 44  YKSPPPPVMHYSLPQVYHSPPPPKKHTVNKSPPPPVKQYSPPWLRSPPPPRKDYVYKSPP 103

Query: 165 PP------------YVYNSPPPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPP 296
           PP            YVY SPPPP    SP   Y SPPPP     Y SP P V++ +PP  
Sbjct: 104 PPVKQYSSPPPNKYYVYQSPPPPVKHYSPPSVYHSPPPPKNQYVYKSPPPPVKHYTPPVY 163

Query: 297 SYSPSPKTEY 326
              P PK  Y
Sbjct: 164 HSGPPPKKHY 173

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 45/85 (52%), Positives = 49/85 (57%), Gaps = 8/85 (9%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHP--HVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSP 188
           YKSPPPP    S    Y SPP P  H     PPPP    SP++VY SPPPP   YVY SP
Sbjct: 175 YKSPPPPVMHYSLPQVYHSPPPPKKHYVYKSPPPPVKHYSPRLVYHSPPPPKKKYVYKSP 234

Query: 189 PPP---YYSPSPKVYYKSPPPPSYY 254
           PPP   Y+ P     YKSPPPP +Y
Sbjct: 235 PPPVRHYFPPHHLYLYKSPPPPYHY 259

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 56/139 (40%), Positives = 68/139 (48%), Gaps = 32/139 (23%)
 Frame = +3

Query: 24  YKSPPPP---YYSPSPKVYY--KSPPHPHVCVCPP-----PPPCYSPSPKVVYKSPPPP- 170
           YKSPPPP   Y SP P  YY  +SPP P     PP     PPP   P  + VYKSPPPP 
Sbjct: 99  YKSPPPPVKQYSSPPPNKYYVYQSPPPPVKHYSPPSVYHSPPP---PKNQYVYKSPPPPV 155

Query: 171 -----------------YVYNSPPPPYYSPS-PKVYYKSPPPPSYY---SPSPKVEYKSP 287
                            Y+Y SPPPP    S P+VY+  PPP  +Y   SP P V++ SP
Sbjct: 156 KHYTPPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVYHSPPPPKKHYVYKSPPPPVKHYSP 215

Query: 288 PPPSYSPSPKTEY*ISRLP 344
               +SP P  +  + + P
Sbjct: 216 RLVYHSPPPPKKKYVYKSP 234

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 51/121 (42%), Positives = 58/121 (47%), Gaps = 14/121 (11%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHP--HVCVCPPPPPCYSPSPKVVYKSPPPP--- 170
           AS  V   SP    Y  +   +Y SPP P  H     PPPP    S   VY SPPPP   
Sbjct: 10  ASLLVLTISPLTSVYQSTANYFYSSPPPPVKHYEYKSPPPPVMHYSLPQVYHSPPPPKKH 69

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPS----YYSPSPKV-EYKSPPPPSY----SPSPKTE 323
            V  SPPPP    SP  + +SPPPP     Y SP P V +Y SPPP  Y    SP P  +
Sbjct: 70  TVNKSPPPPVKQYSPP-WLRSPPPPRKDYVYKSPPPPVKQYSSPPPNKYYVYQSPPPPVK 128

Query: 324 Y 326
           +
Sbjct: 129 H 129

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 42/110 (38%), Positives = 50/110 (45%), Gaps = 27/110 (24%)
 Frame = +3

Query: 96  VCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSPPPP---------YYSPSPKVYY---K 230
           V    P    Y  +    Y SPPPP   Y Y SPPPP         Y+SP P   +   K
Sbjct: 14  VLTISPLTSVYQSTANYFYSSPPPPVKHYEYKSPPPPVMHYSLPQVYHSPPPPKKHTVNK 73

Query: 231 SPPPP-SYYS-------PSPKVE--YKSPPPP--SYSPSPKTEY*ISRLP 344
           SPPPP   YS       P P+ +  YKSPPPP   YS  P  +Y + + P
Sbjct: 74  SPPPPVKQYSPPWLRSPPPPRKDYVYKSPPPPVKQYSSPPPNKYYVYQSP 123

[101][TOP]
>UniRef100_B9IKD0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IKD0_POPTR
          Length = 190

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 56/135 (41%), Positives = 66/135 (48%), Gaps = 41/135 (30%)
 Frame = +3

Query: 24  YKSPPPPYYS-----PSPKVYYKSPPHPH-VCVCPPPPPCYS----------------PS 137
           YKSPPPP+++     P P   YKSPP PH  C   PPPP Y+                PS
Sbjct: 38  YKSPPPPFHNKHKSPPPPPHKYKSPPPPHHKCKYSPPPPVYTYRSPPPPTPMHHKSPPPS 97

Query: 138 PKVVYKSPPPPYVYNSPPPP----------YYSPSPKVYYK--SPPPPSYY-------SP 260
           P +    PPPPY Y SPPPP          Y SP P   YK  SPPPP ++       SP
Sbjct: 98  PHMFKSPPPPPYRYISPPPPPPHPPCHAYKYLSPPPPPSYKYASPPPPKHHHHHKHKWSP 157

Query: 261 SPKVEYKSPPPPSYS 305
            P + Y SPPPP ++
Sbjct: 158 YPFITYMSPPPPHHN 172

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 50/112 (44%), Positives = 59/112 (52%), Gaps = 17/112 (15%)
 Frame = +3

Query: 12  PKVY-YKSPPPPYYS------PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           P VY Y+SPPPP         PSP ++   PP P+  + PPPPP + P     Y SPPPP
Sbjct: 75  PPVYTYRSPPPPTPMHHKSPPPSPHMFKSPPPPPYRYISPPPPPPHPPCHAYKYLSPPPP 134

Query: 171 --YVYNSPPPP--------YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
             Y Y SPPPP         +SP P + Y SPPPP +  P     Y SPPPP
Sbjct: 135 PSYKYASPPPPKHHHHHKHKWSPYPFITYMSPPPPHHNYPD--YHYSSPPPP 184

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 38/81 (46%), Positives = 45/81 (55%), Gaps = 24/81 (29%)
 Frame = +3

Query: 144 VVYKSPPPPY------------VYNSPPPPY----YSPSPKVY-YKSPPPPS---YYSPS 263
           + YKSPPPP+             Y SPPPP+    YSP P VY Y+SPPPP+   + SP 
Sbjct: 36  LTYKSPPPPFHNKHKSPPPPPHKYKSPPPPHHKCKYSPPPPVYTYRSPPPPTPMHHKSPP 95

Query: 264 PKVE-YKSPPPPSY---SPSP 314
           P    +KSPPPP Y   SP P
Sbjct: 96  PSPHMFKSPPPPPYRYISPPP 116

[102][TOP]
>UniRef100_O24099 MtN12 protein (Fragment) n=1 Tax=Medicago truncatula
           RepID=O24099_MEDTR
          Length = 113

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 56/119 (47%), Positives = 60/119 (50%), Gaps = 10/119 (8%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY------VYNS 185
           Y SPPPP +   PK  Y S         PPPP    P PK VY SPPPP       VY+S
Sbjct: 2   YHSPPPPVHHTYPKPVYHS---------PPPPVHTYPHPKPVYHSPPPPVHTYPKPVYHS 52

Query: 186 PPPPY--YSPSPKVYYKSPPPPSYYSPS--PKVEYKSPPPPSYSPSPKTEY*ISRLPLY 350
           PPPP   Y P PK  Y SPPPP +  P   P   Y SPPPP +SP P   Y  S  P Y
Sbjct: 53  PPPPVHTYVPHPKPVYHSPPPPVHTYPPHVPHPVYHSPPPPVHSPPPPHYYYKSPPPPY 111

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 55/109 (50%), Positives = 62/109 (56%), Gaps = 11/109 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPPHP-HVCVCP----PPPPC--YSPSPKVVYKSPPP 167
           PK  Y SPPPP ++ P PK  Y SPP P H    P    PPPP   Y P PK VY SPPP
Sbjct: 14  PKPVYHSPPPPVHTYPHPKPVYHSPPPPVHTYPKPVYHSPPPPVHTYVPHPKPVYHSPPP 73

Query: 168 P---YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           P   Y  + P P Y+SP P V+  SPPPP YY       YKSPPPP ++
Sbjct: 74  PVHTYPPHVPHPVYHSPPPPVH--SPPPPHYY-------YKSPPPPYHN 113

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/70 (51%), Positives = 41/70 (58%), Gaps = 10/70 (14%)
 Frame = +3

Query: 147 VYKSPPPPY-------VYNSPPPPYYS-PSPKVYYKSPPPPSYYSPSPKVEYKSPPPP-- 296
           VY SPPPP        VY+SPPPP ++ P PK  Y SPPPP +  P P   Y SPPPP  
Sbjct: 1   VYHSPPPPVHHTYPKPVYHSPPPPVHTYPHPKPVYHSPPPPVHTYPKP--VYHSPPPPVH 58

Query: 297 SYSPSPKTEY 326
           +Y P PK  Y
Sbjct: 59  TYVPHPKPVY 68

[103][TOP]
>UniRef100_Q41805 Extensin-like protein n=1 Tax=Zea mays RepID=Q41805_MAIZE
          Length = 1188

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/101 (51%), Positives = 53/101 (52%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P     SPPPP  SP P     SPP P V   PPP P  SP P V  KSPPPP   +SPP
Sbjct: 1014 PPAPVSSPPPPVKSPPPPAPVSSPPPP-VKSPPPPAPVSSPPPPV--KSPPPPAPISSPP 1070

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP  SP P     SPPPP   SP P     SPPPP  SP P
Sbjct: 1071 PPVKSPPPPAPVSSPPPP-VKSPPPPAPVSSPPPPIKSPPP 1110

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/105 (49%), Positives = 56/105 (53%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           ASP    KSPPPP    SP    KSPP P     PPPP   + SP  + KSPPPP   +S
Sbjct: 589 ASPPPPVKSPPPPAPVASPPPPVKSPPPPTPVASPPPPAPVASSPPPM-KSPPPPTPVSS 647

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           PPPP  SP P    KS PPP  Y P+P    KS PPP  S  P T
Sbjct: 648 PPPPEKSPPPPPPAKSTPPPEEY-PTPPTSVKSSPPPEKSLPPPT 691

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/101 (49%), Positives = 51/101 (50%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P     SPPP   S  P     SPP P V   PPP P  SP P V  KSPPPP   +SPP
Sbjct: 981  PPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPV--KSPPPPAPVSSPP 1038

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP  SP P     SPPPP   SP P     SPPPP  SP P
Sbjct: 1039 PPVKSPPPPAPVSSPPPP-VKSPPPPAPISSPPPPVKSPPP 1078

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/111 (47%), Positives = 55/111 (49%), Gaps = 8/111 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSP-PHPHVCVCPPPPPCYSP-------SPKVVYKSPPP 167
           P+    SPPPP  + SP     SP P P V V  PPPP  SP       SP    KSPPP
Sbjct: 509 PQAPVGSPPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPP 568

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           P    SPPPP  SP P     SPPPP   SP P     SPPPP  SP P T
Sbjct: 569 PAPVASPPPPVKSPPPPTLVASPPPP-VKSPPPPAPVASPPPPVKSPPPPT 618

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 52/102 (50%), Positives = 53/102 (51%), Gaps = 1/102 (0%)
 Frame = +3

Query: 12   PKVYYKSPPPPYY-SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
            P     SPPPP   SP P     SPP P V   PPP P  SP P V  KSPPPP   +SP
Sbjct: 997  PPAPMSSPPPPEVKSPPPPAPVSSPPPP-VKSPPPPAPVSSPPPPV--KSPPPPAPVSSP 1053

Query: 189  PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PPP  SP P     SPPPP   SP P     SPPPP  SP P
Sbjct: 1054 PPPVKSPPPPAPISSPPPP-VKSPPPPAPVSSPPPPVKSPPP 1094

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 49/103 (47%), Positives = 50/103 (48%), Gaps = 8/103 (7%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P     SPP P   V  PPPP    SP    KSPPPP    SPPPP  SP
Sbjct: 558 SPPPPEKSPPPPAPVASPPPP---VKSPPPPTLVASPPPPVKSPPPPAPVASPPPPVKSP 614

Query: 210 SPKVYYKSPPPPS--------YYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPP+          SP P     SPPPP  SP P
Sbjct: 615 PPPTPVASPPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPP 657

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 49/99 (49%), Positives = 50/99 (50%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P     SPPPP  SP P     SPP P V   PPP P  SP P V  KSPPPP   +SPP
Sbjct: 1030 PPAPVSSPPPPVKSPPPPAPVSSPPPP-VKSPPPPAPISSPPPPV--KSPPPPAPVSSPP 1086

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            PP  SP P     SPPPP   SP P     SPPP    P
Sbjct: 1087 PPVKSPPPPAPVSSPPPP-IKSPPPPAPVSSPPPAPVKP 1124

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 51/106 (48%), Positives = 54/106 (50%), Gaps = 1/106 (0%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P     SPPPP  SP P     SPP P V   PPP P  SP P V  KSPPPP    SPP
Sbjct: 568 PPAPVASPPPPVKSPPPPTLVASPPPP-VKSPPPPAPVASPPPPV--KSPPPPTPVASPP 624

Query: 192 PPYYSPSPKVYYKSPPPPS-YYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PP    S     KSPPPP+   SP P  +   PPPP+ S  P  EY
Sbjct: 625 PPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEY 670

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 49/102 (48%), Positives = 52/102 (50%), Gaps = 1/102 (0%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P     SPPPP  SP P     SPP P V   PPP P  SP P V  KSPPPP   +SPP
Sbjct: 1046 PPAPVSSPPPPVKSPPPPAPISSPPPP-VKSPPPPAPVSSPPPPV--KSPPPPAPVSSPP 1102

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPS-PKVEYKSPPPPSYSPSP 314
            PP  SP P     SPPP     PS P     S PPP  +P+P
Sbjct: 1103 PPIKSPPPPAPVSSPPPAPVKPPSLPPPAPVSSPPPVVTPAP 1144

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/110 (44%), Positives = 52/110 (47%), Gaps = 7/110 (6%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVV-------YKSPP 164
            +SP    KS PPP     P    KS P P     PPP P  SP P  +        KSPP
Sbjct: 954  SSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPP 1013

Query: 165  PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP   +SPPPP  SP P     SPPPP   SP P     SPPPP  SP P
Sbjct: 1014 PPAPVSSPPPPVKSPPPPAPVSSPPPP-VKSPPPPAPVSSPPPPVKSPPP 1062

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/103 (49%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +3

Query: 12  PKVYYKSPPP-PYYSPSPKVYYKSPPHPHVCVCPPPP-PCYSPSPKVVYKSPPPPYVYNS 185
           P +   SPP  P  SP P V   SPP P     PPPP    SP P V  KSPPPP    S
Sbjct: 501 PSLVKLSPPQAPVGSPPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPV--KSPPPPAPVGS 558

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP  SP P     SPPPP   SP P     SPPPP  SP P
Sbjct: 559 PPPPEKSPPPPAPVASPPPP-VKSPPPPTLVASPPPPVKSPPP 600

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 51/105 (48%), Positives = 53/105 (50%), Gaps = 10/105 (9%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP-------SPKVVYKSPPPPYVYNSP 188
           SPPPP    SP    KSPP P   V  PPPP  SP       SP    KSPPPP +  SP
Sbjct: 533 SPPPPVSVVSPPPPVKSPPPP-APVGSPPPPEKSPPPPAPVASPPPPVKSPPPPTLVASP 591

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP---SYSPSP 314
           PPP  SP P     SPPPP   SP P     SPPPP   + SP P
Sbjct: 592 PPPVKSPPPPAPVASPPPP-VKSPPPPTPVASPPPPAPVASSPPP 635

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 47/109 (43%), Positives = 50/109 (45%), Gaps = 6/109 (5%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVV------YKSPPP 167
            +SP +  KS PPP    SP    KS P P     PP  P  SP P  V       KS PP
Sbjct: 922  SSPPMTPKSSPPPVVVSSPPPTVKSSPPPAPVSSPPATPKSSPPPAPVNLPPPEVKSSPP 981

Query: 168  PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P   +SPPP   S  P     SPPPP   SP P     SPPPP  SP P
Sbjct: 982  PTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPP 1030

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/107 (43%), Positives = 50/107 (46%), Gaps = 3/107 (2%)
 Frame = +3

Query: 9   SPKVYYKSP---PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           SP     SP   PP   +P P +   SPP   V   PPP    SP   +   SPPPP   
Sbjct: 481 SPPATSPSPQVQPPAASTPPPSLVKLSPPQAPVGSPPPPVKTTSPPAPIGSPSPPPPVSV 540

Query: 180 NSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            SPPPP  SP P     SPPPP   SP P     SPPPP  SP P T
Sbjct: 541 VSPPPPVKSPPPPAPVGSPPPPE-KSPPPPAPVASPPPPVKSPPPPT 586

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 47/104 (45%), Positives = 50/104 (48%), Gaps = 3/104 (2%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P     SPPPP  SP P     SPP P V   PPP P  SP P +  KSPPPP   +SPP
Sbjct: 1062 PPAPISSPPPPVKSPPPPAPVSSPPPP-VKSPPPPAPVSSPPPPI--KSPPPPAPVSSPP 1118

Query: 192  P-PYYSPS--PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P P   PS  P     SPPP    +P  K E   PPP    P P
Sbjct: 1119 PAPVKPPSLPPPAPVSSPPPVVTPAPPKKEEQSLPPPAESQPPP 1162

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 44/102 (43%), Positives = 48/102 (47%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
            SP    KS PPP     P    KS P P +   PP  P  SP P VV  S PPP V +SP
Sbjct: 891  SPPSEPKSSPPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVV--SSPPPTVKSSP 948

Query: 189  PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP   S  P     SPPP     P P+V+   PP P  SP P
Sbjct: 949  PPAPVSSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPP 990

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 46/120 (38%), Positives = 52/120 (43%), Gaps = 21/120 (17%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP-------- 161
            +SP    KSPPPP    SP    KSPP P   V  PPPP  SP P     SP        
Sbjct: 1067 SSPPPPVKSPPPPAPVSSPPPPVKSPP-PPAPVSSPPPPIKSPPPPAPVSSPPPAPVKPP 1125

Query: 162  --PPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKV-----------EYKSPPPPSY 302
              PPP   +SPPP      PK   +S PPP+   P P             +Y SPPPP +
Sbjct: 1126 SLPPPAPVSSPPPVVTPAPPKKEEQSLPPPAESQPPPSFNDIILPPIMANKYASPPPPQF 1185

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/107 (41%), Positives = 47/107 (43%), Gaps = 10/107 (9%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPP--------HPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           +  P   Y  P+P V  KSPP         P     PPP       P+    SPPPP   
Sbjct: 463 HSPPADDYVPPTPPVPGKSPPATSPSPQVQPPAASTPPPSLVKLSPPQAPVGSPPPPVKT 522

Query: 180 NSPPPPYYSPS--PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SPP P  SPS  P V   SPPPP   SP P     SPPPP  SP P
Sbjct: 523 TSPPAPIGSPSPPPPVSVVSPPPP-VKSPPPPAPVGSPPPPEKSPPP 568

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 42/99 (42%), Positives = 48/99 (48%), Gaps = 2/99 (2%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            SPP    SP   V   +PP P   + PP  P  SP P  V  S PPP V +SPPP   S 
Sbjct: 866  SPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPV--SLPPPIVKSSPPPAMVSS 923

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP--SPKT 320
             P     SPPP    SP P V+   PP P  SP  +PK+
Sbjct: 924  PPMTPKSSPPPVVVSSPPPTVKSSPPPAPVSSPPATPKS 962

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/98 (46%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPK--VVYKSPPPPYVYNSPPPPYY 203
           +PPP     SP       P P V    PP P  SPSP   V   SPPPP    SPPPP  
Sbjct: 498 TPPPSLVKLSPPQAPVGSPPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPV--KSPPPPAP 555

Query: 204 SPSPKVYYKSPPPPS-YYSPSPKVEYKSPPPPSYSPSP 314
             SP    KSPPPP+   SP P V  KSPPPP+   SP
Sbjct: 556 VGSPPPPEKSPPPPAPVASPPPPV--KSPPPPTLVASP 591

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 42/98 (42%), Positives = 45/98 (45%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           KSPPPP    SP    KSPP P      PPP  Y P+P    KS PPP    S PPP   
Sbjct: 637 KSPPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEY-PTPPTSVKSSPPP--EKSLPPPTLI 693

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           PSP    K  PP +   P    E  SPP    S  P+T
Sbjct: 694 PSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQT 731

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 46/116 (39%), Positives = 52/116 (44%), Gaps = 13/116 (11%)
 Frame = +3

Query: 6    ASPKVYYKSPPP-PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP------SPKVVYKSPP 164
            +SP     SPPP P  SP P    KS P P     PPP P  SP      SP  V K+ P
Sbjct: 759  SSPPSVKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTSP 818

Query: 165  PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP------SPKVEYKSPPPPSYSPSP 314
            PP   +SPP    S  P V   SPPP    SP      SP +  K   PP++  SP
Sbjct: 819  PPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPLTPKPASPPAHVSSP 874

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 43/108 (39%), Positives = 48/108 (44%), Gaps = 7/108 (6%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPH-------PHVCVCPPPPPCYSPSPKVVYKSPPPP 170
            P+    SPPP   S  P     SPP        P V   PPP P  SP P    KS PPP
Sbjct: 729  PQTPKSSPPPAPVSSPPPTPVSSPPALAPVSSPPSVKSSPPPAPLSSPPPAPQVKSSPPP 788

Query: 171  YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
               +SPPP   +P      KS PP +  S  P+VE  SPPP   S  P
Sbjct: 789  VQVSSPPP---AP------KSSPPLAPVSSPPQVEKTSPPPAPLSSPP 827

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 42/110 (38%), Positives = 48/110 (43%), Gaps = 6/110 (5%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP------SPKVVYKSPPPPY 173
            P V   SPPP   S  P     SPP       PPP P  SP      SP  V  S PPP 
Sbjct: 787  PPVQVSSPPPAPKSSPPLAPVSSPPQVEK-TSPPPAPLSSPPLAPKSSPPHVVVSSPPPV 845

Query: 174  VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
            V +SPPP   S  P     + PP    SP   V+  +PP P+   SP +E
Sbjct: 846  VKSSPPPAPVSSPPLTPKPASPPAHVSSPPEVVKPSTPPAPTTVISPPSE 895

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 44/117 (37%), Positives = 49/117 (41%), Gaps = 14/117 (11%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPH-------PHVCVCPPPPPCYSP-------SPKVV 149
            P+V   SPPP   S  P     SPPH       P V   PPP P  SP       SP   
Sbjct: 811  PQVEKTSPPPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPLTPKPASPPAH 870

Query: 150  YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
              SPP     ++PP P    SP    KS PPP+  S  P +   SPPP   S  P T
Sbjct: 871  VSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPVSLPPPIVKSSPPPAMVSSPPMT 927

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 42/103 (40%), Positives = 44/103 (42%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P V    PP P  SP P    KS P P     PPP P    SP +   S PP     SPP
Sbjct: 762  PSVKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPPAP--KSSPPLAPVSSPPQVEKTSPP 819

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            P   S SP +  KS PP    S  P V   SPPP   S  P T
Sbjct: 820  PAPLS-SPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPLT 861

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 49/139 (35%), Positives = 55/139 (39%), Gaps = 41/139 (29%)
 Frame = +3

Query: 27   KSPPPPYYSPSPKVYYKSPPHPHVCVCPP-----PPPCYSP------------------- 134
            KS PPP   P+P    KS P P   + PP     PPP   P                   
Sbjct: 662  KSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPPPQEKPTPPSTPSKPPSSPEKPSPP 721

Query: 135  -----SPKVVYKSPPPPYVYNSPPP-PYYSP-------SPKVYYKSPPPPSYYSPSPKVE 275
                 SP    KS PPP   +SPPP P  SP       SP     SPPP    SP P  +
Sbjct: 722  KEPVSSPPQTPKSSPPPAPVSSPPPTPVSSPPALAPVSSPPSVKSSPPPAPLSSPPPAPQ 781

Query: 276  YKSPPPP----SYSPSPKT 320
             KS PPP    S  P+PK+
Sbjct: 782  VKSSPPPVQVSSPPPAPKS 800

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 44/112 (39%), Positives = 46/112 (41%), Gaps = 8/112 (7%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-------PP 170
            P    K P  P     PK    SPP       PPP P  SP P  V  SPP       PP
Sbjct: 705  PSTPSKPPSSPEKPSPPKEPVSSPPQTPKS-SPPPAPVSSPPPTPV-SSPPALAPVSSPP 762

Query: 171  YVYNSPPP-PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
             V +SPPP P  SP P    KS PPP   S  P     SPP    S  P+ E
Sbjct: 763  SVKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPPAPKSSPPLAPVSSPPQVE 814

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 45/118 (38%), Positives = 48/118 (40%), Gaps = 15/118 (12%)
 Frame = +3

Query: 12   PKVYYKSPPP-PYYSP-------SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP 167
            P V   SPPP P  SP       SP  +  SPP   V    PP P    SP    KS PP
Sbjct: 843  PPVVKSSPPPAPVSSPPLTPKPASPPAHVSSPPEV-VKPSTPPAPTTVISPPSEPKSSPP 901

Query: 168  PYVYNSP-------PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            P   + P       PPP    SP +  KS PPP   S  P     SPPP   S  P T
Sbjct: 902  PTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPPPAPVSSPPAT 959

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 42/114 (36%), Positives = 45/114 (39%), Gaps = 13/114 (11%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVY-------YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
            P     SPPP   S  P +         KS P P     PPP P    SP  V  S PPP
Sbjct: 737  PPAPVSSPPPTPVSSPPALAPVSSPPSVKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPP 796

Query: 171  YVYNSPPPPYYSPSPKVYYKSPPPPSYYSP------SPKVEYKSPPPPSYSPSP 314
               +SPP    S  P+V   SPPP    SP      SP     S PPP    SP
Sbjct: 797  APKSSPPLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSP 850

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 41/105 (39%), Positives = 48/105 (45%), Gaps = 7/105 (6%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
            +SP    K+ PPP    SP +  KS P PHV V  PPP        V   SPPP  V + 
Sbjct: 808  SSPPQVEKTSPPPAPLSSPPLAPKSSP-PHVVVSSPPPV-------VK-SSPPPAPVSSP 858

Query: 186  P-------PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
            P       PP + S  P+V   S PP      SP  E KS PPP+
Sbjct: 859  PLTPKPASPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPT 903

[104][TOP]
>UniRef100_Q94ES5 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES5_PEA
          Length = 144

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 52/110 (47%), Positives = 58/110 (52%), Gaps = 19/110 (17%)
 Frame = +3

Query: 24  YKSPPPPYYS-PSPKVYYKSPP------HPHVCVCPPPPPCYS-PSPKVVYKSPPP---- 167
           Y SPPPP ++ P P   Y SPP       P+    PPPPP ++ P P  VY SPPP    
Sbjct: 32  YSSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTP 91

Query: 168 ---PYVYNSPPPP----YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
              PY Y SPPPP    Y    P   Y SPPPP+Y  P P   YKSPPPP
Sbjct: 92  HKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAYSPPPPAYYYKSPPPP 141

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 40/92 (43%), Positives = 48/92 (52%), Gaps = 11/92 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPP-------HPHVCVCPPPPPCYSPSPKV---VYKS 158
           P  Y   PPPP ++ P P   Y SPP        P+    PPPPP ++  P V   VY S
Sbjct: 61  PYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHS 120

Query: 159 PPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYY 254
           PPPP  Y+ PPP Y       YYKSPPPP ++
Sbjct: 121 PPPP-AYSPPPPAY-------YYKSPPPPYHH 144

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 29/63 (46%), Positives = 33/63 (52%)
 Frame = +3

Query: 126 YSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           YS  P  V+  P P  VY+SPPPP     P  Y   PPPP +  P P   Y SPPPP   
Sbjct: 32  YSSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPP--- 88

Query: 306 PSP 314
           P+P
Sbjct: 89  PTP 91

[105][TOP]
>UniRef100_A2Y786 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2Y786_ORYSI
          Length = 493

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/121 (45%), Positives = 60/121 (49%), Gaps = 17/121 (14%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP------ 164
           ++ P  Y+ SPPPP  SP P VY  SPP P     PPPPP YSP P V    PP      
Sbjct: 73  KSPPPPYHDSPPPPRASPPPPVY--SPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPP 130

Query: 165 -----------PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
                      PP   +SPPPP  SP P V   S PPP   SP P V   SPPPP +SP 
Sbjct: 131 PVSSPPPPVPSPPPPVSSPPPPVSSPPPPV---SSPPPPVSSPPPPV--SSPPPPVHSPP 185

Query: 312 P 314
           P
Sbjct: 186 P 186

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/103 (46%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP  SP P V   SPP P   V  PPPP  SP P V   SPPPP   +SP
Sbjct: 127 SPPPPVSSPPPPVPSPPPPV--SSPPPP---VSSPPPPVSSPPPPV--SSPPPPV--SSP 177

Query: 189 PPPYYSPSPKVYYKSPPPPS--YYSPSPKVEYKSPPPPSYSPS 311
           PPP +SP P V   SPPPP+      +    Y +   P+Y PS
Sbjct: 178 PPPVHSPPPPV--SSPPPPASDVVYCTNTTRYPTCTSPAYCPS 218

[106][TOP]
>UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019841A9
          Length = 525

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/111 (45%), Positives = 57/111 (51%), Gaps = 13/111 (11%)
 Frame = +3

Query: 9   SPKVYYKSPP------PPYYSPSPKVYYKSPPH--PHVCVCPPPPPCYSPSPKVVYKSPP 164
           SP V+   PP      PP +SP P V    PP   P     PPPPP YSP P     SPP
Sbjct: 414 SPPVFPSPPPTPVYSPPPVFSPPPPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPPVYSPP 473

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPS--YYSPSPK---VEYKSPPPPSY 302
           PP     PPPP  SP P + Y+SPPPP+  Y  P P    V Y SPPPP +
Sbjct: 474 PPPPPPPPPPPVXSPPPPIIYESPPPPTPVYEGPLPPIFGVSYASPPPPPF 524

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 51/108 (47%), Positives = 54/108 (50%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           R SP V     PPP   PSP V+   PP P       PPP +SP P V+  SPPPP    
Sbjct: 399 RCSPFVPSLPTPPP---PSPPVFPSPPPTPVYS----PPPVFSPPPPVL-SSPPPP---- 446

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           SPPPP  SP P   Y  PPPP  YSP P      PPPP  SP P   Y
Sbjct: 447 SPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPPPVXSPPPPIIY 494

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 42/81 (51%), Positives = 46/81 (56%), Gaps = 6/81 (7%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP---Y 200
           SPPPP  SP P   Y  PP P V   PPPPP   P P V   SPPPP +Y SPPPP   Y
Sbjct: 447 SPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPPPVX--SPPPPIIYESPPPPTPVY 504

Query: 201 YSPSPKVY---YKSPPPPSYY 254
             P P ++   Y SPPPP +Y
Sbjct: 505 EGPLPPIFGVSYASPPPPPFY 525

[107][TOP]
>UniRef100_Q9S9A4 Extensin (Fragment) n=1 Tax=Vicia faba RepID=Q9S9A4_VICFA
          Length = 116

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/110 (46%), Positives = 56/110 (50%), Gaps = 19/110 (17%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPP-------HPHVCVCPPPPPCYS-PSPKVVYKSPPP---- 167
           Y SPPP +  P P  +Y SPP        P+    PPPPP ++ P P  VY SPPP    
Sbjct: 4   YSSPPPVHTYPHPHPFYHSPPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTP 63

Query: 168 ---PYVYNSPPPP----YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
              PY Y SPPPP    Y    P   Y SPPPP Y  P P   YKSPPPP
Sbjct: 64  HKKPYKYPSPPPPPVHTYPPHVPHPVYHSPPPPVYSPPPPHYYYKSPPPP 113

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 43/92 (46%), Positives = 51/92 (55%), Gaps = 11/92 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPP-------HPHVCVCPPPPPCYSPSPKV---VYKS 158
           P  Y   PPPP ++ P P   Y SPP        P+    PPPPP ++  P V   VY S
Sbjct: 33  PYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPVHTYPPHVPHPVYHS 92

Query: 159 PPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYY 254
           PPPP VY SPPPP+Y      YYKSPPPP ++
Sbjct: 93  PPPP-VY-SPPPPHY------YYKSPPPPYHH 116

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/114 (41%), Positives = 50/114 (43%), Gaps = 28/114 (24%)
 Frame = +3

Query: 93  HVCVCPPPPPCYSPSPKVVYKSPPP-------PYVYNSPPPP-----------YYSPSP- 215
           H     PPP    P P   Y SPPP       PY Y SPPPP           Y+SP P 
Sbjct: 1   HYSYSSPPPVHTYPHPHPFYHSPPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPP 60

Query: 216 -----KVY-YKSPPPPSYYSPSPKVE---YKSPPPPSYSPSPKTEY*ISRLPLY 350
                K Y Y SPPPP  ++  P V    Y SPPPP YSP P   Y  S  P Y
Sbjct: 61  PTPHKKPYKYPSPPPPPVHTYPPHVPHPVYHSPPPPVYSPPPPHYYYKSPPPPY 114

[108][TOP]
>UniRef100_Q94ES3 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES3_PEA
          Length = 137

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 61/131 (46%), Positives = 67/131 (51%), Gaps = 18/131 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPPHPHV----CVCPPPPPCYS-PSPKVVYKSPPPPY 173
           P  Y   PPPP ++ P P   Y SPP PH        PPPPP ++ P P  VY SPPPP 
Sbjct: 6   PYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPV 65

Query: 174 --------VYNSPPPPYYSPSPKVY-YKSPPPP--SYYSPS-PKVEYKSPPPPSYSPSPK 317
                   VY+SPPPP  +P  K Y Y SPPPP    Y P  P   Y SPPPP YSP P 
Sbjct: 66  HTYPHPHPVYHSPPPPP-TPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVYSPPPP 124

Query: 318 TEY*ISRLPLY 350
             Y  S  P Y
Sbjct: 125 AYYYKSPPPPY 135

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/115 (40%), Positives = 53/115 (46%), Gaps = 34/115 (29%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-----YSPSPKVYYKSPPHPHVCVCPPPPPCYS-PSPKVVYKSPPPPY 173
           P   Y SPPPP+     YS  P     + PHPH     PPPP ++ P P  VY SPPPP 
Sbjct: 23  PHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPP 82

Query: 174 ---------------------------VYNSPPPPYYSPSPKV-YYKSPPPPSYY 254
                                      VY+SPPPP YSP P   YYKSPPPP ++
Sbjct: 83  TPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVYSPPPPAYYYKSPPPPYHH 137

[109][TOP]
>UniRef100_B9RIB5 Extensin, proline-rich protein, putative n=1 Tax=Ricinus communis
           RepID=B9RIB5_RICCO
          Length = 144

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/92 (55%), Positives = 53/92 (57%), Gaps = 8/92 (8%)
 Frame = +3

Query: 69  YYKSPPH-PHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 245
           YY SPP  P+  + PPPP     SP     SPPPPY Y SPPPP  SP P  YYKSPPPP
Sbjct: 29  YYSSPPPLPYKYMSPPPP-----SP-----SPPPPYYYQSPPPPSPSPPPPYYYKSPPPP 78

Query: 246 S-------YYSPSPKVEYKSPPPPSYSPSPKT 320
           S         SP P   YKSPPPPS SP P T
Sbjct: 79  SPSPPPPPSPSPPPPYYYKSPPPPSLSPHPLT 110

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 41/76 (53%), Positives = 42/76 (55%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YY+SPPPP  SP P  YYKSPP P     P PPP   PSP     SPPPPY Y SPP
Sbjct: 52  PPYYYQSPPPPSPSPPPPYYYKSPPPP----SPSPPP--PPSP-----SPPPPYYYKSPP 100

Query: 192 PPYYSPSPKVYYKSPP 239
           PP  SP P       P
Sbjct: 101 PPSLSPHPLTTINDTP 116

[110][TOP]
>UniRef100_Q42366 Hydroxyproline-rich Glycoprotein (HRGP) n=1 Tax=Zea mays
           RepID=Q42366_MAIZE
          Length = 328

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/112 (43%), Positives = 57/112 (50%), Gaps = 9/112 (8%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPK     P PP Y+PSPK     PP P      P PP Y+PSPK     P PP    SP
Sbjct: 164 SPKPPTPKPTPPTYTPSPKPPATKPPTPK-----PTPPTYTPSPKPPTPKPTPPTYTPSP 218

Query: 189 PPPYYSPSPKVYYKSPPPPSY---------YSPSPKVEYKSPPPPSYSPSPK 317
            PP   P+P  Y  SP PP++         Y+PSPK     P PP+Y+PSPK
Sbjct: 219 KPPTPKPTPPTYTPSPKPPTHPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPK 270

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/109 (44%), Positives = 56/109 (51%), Gaps = 6/109 (5%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP------PPPPCYSPSPKVVYKSPPPP 170
           +PK     P PP Y+PSPK     P  P     P      P PP Y+PSPK     PP P
Sbjct: 132 TPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTP 191

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
                P PP Y+PSPK     P PP+ Y+PSPK     P PP+Y+PSPK
Sbjct: 192 ----KPTPPTYTPSPKPPTPKPTPPT-YTPSPKPPTPKPTPPTYTPSPK 235

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 46/105 (43%), Positives = 56/105 (53%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y  SP PP   P+P  Y  SP  P      P PP Y+PSPK      PP +   
Sbjct: 192 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPP---TPKPTPPTYTPSPK------PPTHPTP 242

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
            P PP Y+PSPK     P PP+ Y+PSPK     P PP+Y+PSPK
Sbjct: 243 KPTPPTYTPSPKPPTPKPTPPT-YTPSPKPPTPKPTPPTYTPSPK 286

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 46/105 (43%), Positives = 56/105 (53%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y  SP PP   P+P  Y  SP  P      P PP Y+PSPK     PP P    
Sbjct: 208 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTHPTPKPTPPTYTPSPK-----PPTP---- 258

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
            P PP Y+PSPK     P PP+ Y+PSPK     P PP+Y+P+PK
Sbjct: 259 KPTPPTYTPSPKPPTPKPTPPT-YTPSPKPPTPKPTPPTYTPTPK 302

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/107 (42%), Positives = 54/107 (50%), Gaps = 11/107 (10%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           +P PP Y+P+PK     PP P      P PP Y+PSPK     P PP    SP PP   P
Sbjct: 123 TPTPPTYTPTPK-----PPTPK-----PTPPTYTPSPKPPTPKPTPPTYTPSPKPPTPKP 172

Query: 210 SPKVYYKSPPPPS-----------YYSPSPKVEYKSPPPPSYSPSPK 317
           +P  Y  SP PP+            Y+PSPK     P PP+Y+PSPK
Sbjct: 173 TPPTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPK 219

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/117 (39%), Positives = 58/117 (49%), Gaps = 12/117 (10%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSP-PHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           + +P  Y  +P PP   P+P  Y  +P PH       P PP Y+P+PK     P PP   
Sbjct: 89  KPTPPTYTPTPTPP--KPTPPTYTPAPTPHKPTPKPTPTPPTYTPTPKPPTPKPTPPTYT 146

Query: 180 NSPPPPYYSPSPKVYYKSPPPPS------YYSPSPKVEYKSPP-----PPSYSPSPK 317
            SP PP   P+P  Y  SP PP+       Y+PSPK     PP     PP+Y+PSPK
Sbjct: 147 PSPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYTPSPK 203

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 48/119 (40%), Positives = 57/119 (47%), Gaps = 14/119 (11%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-----P 167
           + +P  Y  SP PP   P+P  Y  SP  P      P PP Y+PSPK     PP     P
Sbjct: 139 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPP---TPKPTPPTYTPSPKPPATKPPTPKPTP 195

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPS------YYSPSPKV---EYKSPPPPSYSPSPK 317
           P    SP PP   P+P  Y  SP PP+       Y+PSPK        P PP+Y+PSPK
Sbjct: 196 PTYTPSPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTHPTPKPTPPTYTPSPK 254

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/99 (42%), Positives = 54/99 (54%), Gaps = 4/99 (4%)
 Frame = +3

Query: 33  PPPPYYSPSPK----VYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           P PP Y+PSPK     Y  +P  P      P PP Y+P+P     +P P     +P PP 
Sbjct: 79  PTPPTYTPSPKPTPPTYTPTPTPPK-----PTPPTYTPAPTPHKPTPKP-----TPTPPT 128

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           Y+P+PK     P PP+ Y+PSPK     P PP+Y+PSPK
Sbjct: 129 YTPTPKPPTPKPTPPT-YTPSPKPPTPKPTPPTYTPSPK 166

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 41/107 (38%), Positives = 52/107 (48%), Gaps = 7/107 (6%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYY---SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
           + +P  Y  SP PP +    P+P  Y  SP  P      P PP Y+PSPK     P PP 
Sbjct: 224 KPTPPTYTPSPKPPTHPTPKPTPPTYTPSPKPP---TPKPTPPTYTPSPKPPTPKPTPPT 280

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSY 302
              SP PP   P+P  Y  +P PP+     Y+P+P V +   PPP Y
Sbjct: 281 YTPSPKPPTPKPTPPTYTPTPKPPATKPPTYTPTPPVSHTPSPPPPY 327

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/89 (39%), Positives = 43/89 (48%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y  SP PP   P+P  Y  SP  P      P PP Y+PSPK     P PP    
Sbjct: 243 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPP---TPKPTPPTYTPSPKPPTPKPTPPTYTP 299

Query: 183 SPPPPY-----YSPSPKVYYKSPPPPSYY 254
           +P PP      Y+P+P V +   PPP YY
Sbjct: 300 TPKPPATKPPTYTPTPPVSHTPSPPPPYY 328

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/104 (37%), Positives = 49/104 (47%), Gaps = 10/104 (9%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP 215
           PP  + P P+     PP  H     P PP Y+PSPK     P PP    +P PP   P+P
Sbjct: 62  PPKEHGPKPE----KPPKEH----KPTPPTYTPSPK-----PTPPTYTPTPTPP--KPTP 106

Query: 216 KVYYKSP----------PPPSYYSPSPKVEYKSPPPPSYSPSPK 317
             Y  +P          P P  Y+P+PK     P PP+Y+PSPK
Sbjct: 107 PTYTPAPTPHKPTPKPTPTPPTYTPTPKPPTPKPTPPTYTPSPK 150

[111][TOP]
>UniRef100_Q41983 Extensin precusor (Fragment) n=1 Tax=Arabidopsis thaliana
           RepID=Q41983_ARATH
          Length = 99

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/103 (51%), Positives = 60/103 (58%), Gaps = 6/103 (5%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHP---HVCVCPPPPPCYSPSPKVVYKSPPPP--- 170
           +P   YKSP PP    +P   YKSPP P   +V   PPP     P+P  VYKSPPPP   
Sbjct: 8   APTYVYKSPXPP----TPTYVYKSPPPPTPTYVYKSPPP-----PTPTYVYKSPPPPTPT 58

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
           YVY SPPP    P+PK  YKSPPP     P+P   YKSPPPP+
Sbjct: 59  YVYKSPPP----PTPKYVYKSPPP-----PTPTYVYKSPPPPT 92

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/89 (50%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHP---HVCVCPPPPPCYSPSPKVVYKSPPPP--- 170
           +P   YKSPPPP    +P   YKSPP P   +V   PPPP     +P  VYKSPPPP   
Sbjct: 20  TPTYVYKSPPPP----TPTYVYKSPPPPTPTYVYKSPPPP-----TPTYVYKSPPPPTPK 70

Query: 171 YVYNSPPPPYYSPSPKVYYKSP--PPPSY 251
           YVY SPPPP    +P   YKSP  P P Y
Sbjct: 71  YVYKSPPPP----TPTYVYKSPPPPTPKY 95

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 41/86 (47%), Positives = 45/86 (52%), Gaps = 11/86 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPP-----YYSP---SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP 164
           +P   YKSPPPP     Y SP   +P   YKSPP               P+PK VYKSPP
Sbjct: 32  TPTYVYKSPPPPTPTYVYKSPPPPTPTYVYKSPP--------------PPTPKYVYKSPP 77

Query: 165 PP---YVYNSPPPPYYSPSPKVYYKS 233
           PP   YVY SPPP    P+PK  YKS
Sbjct: 78  PPTPTYVYKSPPP----PTPKYVYKS 99

[112][TOP]
>UniRef100_Q41719 Hydroxyproline-rich glycoprotein n=1 Tax=Zea diploperennis
           RepID=Q41719_ZEADI
          Length = 350

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/109 (44%), Positives = 56/109 (51%), Gaps = 6/109 (5%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPK     P PP Y+PSPK     PP P      P PP Y+PSPK     P PP    SP
Sbjct: 200 SPKPPTPKPTPPTYTPSPKPPATKPPTPK-----PTPPTYTPSPKPPTPKPTPPTYTPSP 254

Query: 189 PPPYYSPSPKVYYKSPPPPS------YYSPSPKVEYKSPPPPSYSPSPK 317
            PP   P+P  Y  SP PP+       Y+PSPK     P PP+Y+PSPK
Sbjct: 255 KPPATKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPK 303

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/110 (46%), Positives = 58/110 (52%), Gaps = 7/110 (6%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPK     P PP Y+PSPK     PP P      P PP Y+PSPK     P PP    SP
Sbjct: 136 SPKPPTPKPTPPTYAPSPKPPATKPPTPK-----PTPPTYTPSPKPPTPKPTPPTYTPSP 190

Query: 189 PP--PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP-----PPSYSPSPK 317
            P  P Y+PSPK     P PP+Y +PSPK     PP     PP+Y+PSPK
Sbjct: 191 KPTPPTYTPSPKPPTPKPTPPTY-TPSPKPPATKPPTPKPTPPTYTPSPK 239

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 44/105 (41%), Positives = 54/105 (51%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y  SP PP   P+P  Y  SP  P      P PP Y+PSPK     P PP    
Sbjct: 228 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPP---ATKPTPPTYTPSPKPPTPKPTPPTYTP 284

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           SP PP   P+P  Y  SP PP+   P+PK     P PP+Y+P+PK
Sbjct: 285 SPKPPTPKPTPPTYTPSPKPPATKPPTPK-----PTPPTYTPTPK 324

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/124 (39%), Positives = 58/124 (46%), Gaps = 19/124 (15%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSP--------PHPHVCVCPPPPPCYSPSPKVVYKS 158
           + +P  Y  SP PP   P+P  Y  SP        P P      P PP Y+PSPK     
Sbjct: 164 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATK 223

Query: 159 PP-----PPYVYNSPPPPYYSPSPKVYYKSPPPPS------YYSPSPKVEYKSPPPPSYS 305
           PP     PP    SP PP   P+P  Y  SP PP+       Y+PSPK     P PP+Y+
Sbjct: 224 PPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPTPPTYTPSPKPPTPKPTPPTYT 283

Query: 306 PSPK 317
           PSPK
Sbjct: 284 PSPK 287

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 47/106 (44%), Positives = 55/106 (51%), Gaps = 10/106 (9%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           +P PP Y+PSPK     PP P      P PP Y+PSPK     PP P     P PP Y+P
Sbjct: 127 TPTPPTYTPSPK-----PPTPK-----PTPPTYAPSPKPPATKPPTP----KPTPPTYTP 172

Query: 210 SPKVYYKSPPPPSY----------YSPSPKVEYKSPPPPSYSPSPK 317
           SPK     P PP+Y          Y+PSPK     P PP+Y+PSPK
Sbjct: 173 SPKPPTPKPTPPTYTPSPKPTPPTYTPSPKPPTPKPTPPTYTPSPK 218

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 49/113 (43%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSP-PH-PHVCVCPPP-PPCYSPSPKVVYKSPPPPY 173
           + +P  Y  +P PP   P+P  Y  +P PH P     P P PP Y+PSPK     PP P 
Sbjct: 89  KPTPPTYTPTPTPPTPKPTPPTYTPAPTPHKPTPTPKPTPTPPTYTPSPK-----PPTP- 142

Query: 174 VYNSPPPPYYSPSPKVYYKSPP-----PPSYYSPSPKVEYKSPPPPSYSPSPK 317
               P PP Y+PSPK     PP     PP+ Y+PSPK     P PP+Y+PSPK
Sbjct: 143 ---KPTPPTYAPSPKPPATKPPTPKPTPPT-YTPSPKPPTPKPTPPTYTPSPK 191

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/100 (40%), Positives = 49/100 (49%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y  SP PP   P+P  Y  SP  P      P PP Y+PSPK     PP P    
Sbjct: 260 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPP---TPKPTPPTYTPSPKPPATKPPTP---- 312

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
            P PP Y+P+PK     PP    Y+P+P V +   PPP Y
Sbjct: 313 KPTPPTYTPTPKPPATKPPT---YTPTPPVSHTPSPPPPY 349

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 44/104 (42%), Positives = 55/104 (52%), Gaps = 9/104 (8%)
 Frame = +3

Query: 33  PPPPYYSPSPK----VYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           P PP Y+PSPK     Y  +P  P      P PP Y+P+P     +P P     +P PP 
Sbjct: 79  PTPPTYTPSPKPTPPTYTPTPTPP---TPKPTPPTYTPAPTPHKPTPTPK---PTPTPPT 132

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPP-----PPSYSPSPK 317
           Y+PSPK     P PP+Y +PSPK     PP     PP+Y+PSPK
Sbjct: 133 YTPSPKPPTPKPTPPTY-APSPKPPATKPPTPKPTPPTYTPSPK 175

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/106 (37%), Positives = 49/106 (46%), Gaps = 12/106 (11%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP 215
           PP  + P P+     PP  H     P PP Y+PSPK     P PP    +P PP   P+P
Sbjct: 62  PPKEHGPKPE----KPPKEH----KPTPPTYTPSPK-----PTPPTYTPTPTPPTPKPTP 108

Query: 216 KVYYKSP------------PPPSYYSPSPKVEYKSPPPPSYSPSPK 317
             Y  +P            P P  Y+PSPK     P PP+Y+PSPK
Sbjct: 109 PTYTPAPTPHKPTPTPKPTPTPPTYTPSPKPPTPKPTPPTYAPSPK 154

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 33/98 (33%), Positives = 43/98 (43%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           Y  +P P   +P+PK        P     P  PP     PK     P  P   + P PP 
Sbjct: 28  YGYTPTPTPATPTPKPEKPPTKGPK----PEKPPKEHKPPKEHGPKPEKPPKEHKPTPPT 83

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           Y+PSPK      P P  Y+P+P      P PP+Y+P+P
Sbjct: 84  YTPSPK------PTPPTYTPTPTPPTPKPTPPTYTPAP 115

[113][TOP]
>UniRef100_B9N4U0 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9N4U0_POPTR
          Length = 499

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/101 (53%), Positives = 64/101 (63%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P V    PPPP +SP P V  +SPP P   V  PPPP +SP P V  +SPPPP   +SPP
Sbjct: 399 PPVQSPPPPPPVHSPPPPV--QSPPPP---VHSPPPPVHSPPPPV--QSPPPP--VHSPP 449

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP +SP P V+  SPPPP  +SP P V+  SPPPP +SP P
Sbjct: 450 PPVHSPPPPVH--SPPPP-VHSPPPPVQ--SPPPPVHSPPP 485

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/102 (51%), Positives = 61/102 (59%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP    +SPPPP +SP P V+  SPP P   V  PPPP +SP P V   SPPPP   +SP
Sbjct: 412 SPPPPVQSPPPPVHSPPPPVH--SPPPP---VQSPPPPVHSPPPPV--HSPPPPV--HSP 462

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP +SP P V  +SPPPP  +SP P V     PPP  SP P
Sbjct: 463 PPPVHSPPPPV--QSPPPP-VHSPPPPVH---SPPPVQSPPP 498

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/100 (48%), Positives = 55/100 (55%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           + SPPPP  SP P     SPP P   V  PPPP +SP P V   SPPPP    SPPPP +
Sbjct: 394 FHSPPPPVQSPPPPPPVHSPPPP---VQSPPPPVHSPPPPV--HSPPPPV--QSPPPPVH 446

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           SP P V+  SPPPP +          SPPPP +SP P  +
Sbjct: 447 SPPPPVH--SPPPPVH----------SPPPPVHSPPPPVQ 474

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/98 (46%), Positives = 56/98 (57%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           ++ P   +  PPP +  P P    +SPP P   V  PPPP +SP P V   SPPPP   +
Sbjct: 418 QSPPPPVHSPPPPVHSPPPP---VQSPPPP---VHSPPPPVHSPPPPV--HSPPPP--VH 467

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
           SPPPP  SP P V+  SPPPP  +SP P    +SPPPP
Sbjct: 468 SPPPPVQSPPPPVH--SPPPP-VHSPPP---VQSPPPP 499

[114][TOP]
>UniRef100_P14918 Extensin n=1 Tax=Zea mays RepID=EXTN_MAIZE
          Length = 267

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/112 (43%), Positives = 57/112 (50%), Gaps = 9/112 (8%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPK     P PP Y+PSPK     PP P      P PP Y+PSPK     P PP    SP
Sbjct: 98  SPKPPTPKPTPPTYTPSPKPPATKPPTPK-----PTPPTYTPSPKPPTPKPTPPTYTPSP 152

Query: 189 PPPYYSPSPKVYYKSPPPPSY---------YSPSPKVEYKSPPPPSYSPSPK 317
            PP   P+P  Y  SP PP++         Y+PSPK     P PP+Y+PSPK
Sbjct: 153 KPPTPKPTPPTYTPSPKPPTHPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPK 204

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/105 (41%), Positives = 54/105 (51%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y  SP PP   P+P  Y  SP  P      P PP Y+PSPK     P PP    
Sbjct: 142 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTHPTPKPTPPTYTPSPKPPTPKPTPPTYTP 201

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           SP PP   P+P  Y  SP PP+   P+PK     P PP+Y+P+PK
Sbjct: 202 SPKPPTPKPTPPTYTPSPKPPATKPPTPK-----PTPPTYTPTPK 241

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/115 (43%), Positives = 57/115 (49%), Gaps = 12/115 (10%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPK     P PP Y+PSPK     PP P      P PP Y+PSPK     P PP    SP
Sbjct: 61  SPKPPTPKPTPPTYTPSPKPPATKPPTPK-----PTPPTYTPSPKPPTPKPTPPTYTPSP 115

Query: 189 PPPY------------YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
            PP             Y+PSPK     P PP+ Y+PSPK     P PP+Y+PSPK
Sbjct: 116 KPPATKPPTPKPTPPTYTPSPKPPTPKPTPPT-YTPSPKPPTPKPTPPTYTPSPK 169

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 46/105 (43%), Positives = 56/105 (53%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y  SP PP   P+P  Y  SP  P      P PP Y+PSPK      PP +   
Sbjct: 126 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPP---TPKPTPPTYTPSPK------PPTHPTP 176

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
            P PP Y+PSPK     P PP+ Y+PSPK     P PP+Y+PSPK
Sbjct: 177 KPTPPTYTPSPKPPTPKPTPPT-YTPSPKPPTPKPTPPTYTPSPK 220

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/107 (45%), Positives = 55/107 (51%), Gaps = 4/107 (3%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPK     P PP Y+PSPK     PP P      P PP Y+PSPK     PP P     P
Sbjct: 24  SPKPPTPKPTPPTYTPSPKPPASKPPTP-----KPTPPTYTPSPK-----PPTP----KP 69

Query: 189 PPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSYSPSPK 317
            PP Y+PSPK     PP P      Y+PSPK     P PP+Y+PSPK
Sbjct: 70  TPPTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPK 116

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/113 (45%), Positives = 58/113 (51%), Gaps = 10/113 (8%)
 Frame = +3

Query: 9   SPKVYYKSPP-----PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
           SPK     PP     PP Y+PSPK     PP P      P PP Y+PSPK     PP P 
Sbjct: 40  SPKPPASKPPTPKPTPPTYTPSPK-----PPTP-----KPTPPTYTPSPKPPATKPPTP- 88

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP-----PPSYSPSPK 317
               P PP Y+PSPK     P PP+ Y+PSPK     PP     PP+Y+PSPK
Sbjct: 89  ---KPTPPTYTPSPKPPTPKPTPPT-YTPSPKPPATKPPTPKPTPPTYTPSPK 137

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 46/98 (46%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +3

Query: 39  PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPK 218
           PP Y+PSPK     PP P      P PP Y+PSPK     PP P     P PP Y+PSPK
Sbjct: 18  PPTYTPSPK-----PPTPK-----PTPPTYTPSPKPPASKPPTP----KPTPPTYTPSPK 63

Query: 219 VYYKSPPPPSYYSPSPKVEYKSPP-----PPSYSPSPK 317
                P PP+ Y+PSPK     PP     PP+Y+PSPK
Sbjct: 64  PPTPKPTPPT-YTPSPKPPATKPPTPKPTPPTYTPSPK 100

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/100 (40%), Positives = 49/100 (49%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y  SP PP   P+P  Y  SP  P      P PP Y+PSPK     PP P    
Sbjct: 177 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPP---TPKPTPPTYTPSPKPPATKPPTP---- 229

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
            P PP Y+P+PK     PP    Y+P+P V +   PPP Y
Sbjct: 230 KPTPPTYTPTPKPPATKPPT---YTPTPPVSHTPSPPPPY 266

[115][TOP]
>UniRef100_O04216 Extensin (Fragment) n=1 Tax=Bromheadia finlaysoniana
           RepID=O04216_BROFI
          Length = 71

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/88 (54%), Positives = 48/88 (54%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP  SP P  YYKSPP        PP P           SPPPPY Y SPPPP  SP 
Sbjct: 1   PPPPSPSPPPPYYYKSPP--------PPSP-----------SPPPPYYYKSPPPPSPSPP 41

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
           P  YYKSPPPP   SP P   Y SPPPP
Sbjct: 42  PPYYYKSPPPPP-PSPPPTYIYSSPPPP 68

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/71 (61%), Positives = 44/71 (61%)
 Frame = +3

Query: 114 PPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
           PPP   PSP     SPPPPY Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPP
Sbjct: 1   PPP---PSP-----SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPP 51

Query: 294 PSYSPSPKTEY 326
           P  SP P   Y
Sbjct: 52  PPPSPPPTYIY 62

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 37/62 (59%), Positives = 39/62 (62%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  YYKSPPPP  SP P  YYKSPP P     PPPP  Y  SP     SPPP Y+Y+SPP
Sbjct: 10  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPS--PPPPYYYK-SPPPPPPSPPPTYIYSSPP 66

Query: 192 PP 197
           PP
Sbjct: 67  PP 68

[116][TOP]
>UniRef100_Q94ES8 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES8_PEA
          Length = 195

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 59/136 (43%), Positives = 68/136 (50%), Gaps = 35/136 (25%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPK---VYYKSPP--------HPHVCVCPPPPPCYS-PSPKVVYKSPPP 167
           Y SPPPP +SP P     +Y SPP        HPH     PPPP ++ P P  VY SPPP
Sbjct: 32  YSSPPPPVHSPPPPKDPYHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPP 91

Query: 168 P------YVYNSPPPP-----------YYSPSP---KVY-YKSPPPPSYYS-PSPKVEYK 281
           P      Y Y SPPPP           Y+SP P   K Y Y SPPPP  ++ P P   Y 
Sbjct: 92  PTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYH 151

Query: 282 SPPPPSYS-PSPKTEY 326
           SPPPP ++ P P   Y
Sbjct: 152 SPPPPVHTYPHPHPVY 167

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/117 (45%), Positives = 62/117 (52%), Gaps = 16/117 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPPHP--------HVCVCPPPPPCYS-PSPKVVYKSP 161
           P   Y SPPPP ++ P P   Y SPP P        +    PPPPP ++ P P  VY SP
Sbjct: 65  PHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPS--PPPPPVHTYPHPHPVYHSP 122

Query: 162 PP----PYVYNSPPPP--YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP    PY Y+SPPPP  +  P P   Y SPPPP +  P P   Y SPPPP   P+P
Sbjct: 123 PPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPP---PTP 176

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 51/111 (45%), Positives = 56/111 (50%), Gaps = 16/111 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCVCPPPPPCY-SPSPK----VVYKSPPPP- 170
           P   Y SPPPP  +P  K Y Y SPP P V   P P P Y SP P       Y SPPPP 
Sbjct: 82  PHPVYHSPPPP--TPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPP 139

Query: 171 --------YVYNSPPPPYYS-PSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
                    VY+SPPPP ++ P P   Y SPPPP      P  +Y SPPPP
Sbjct: 140 VHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPPTPHKKP-YKYPSPPPP 189

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 39/92 (42%), Positives = 45/92 (48%), Gaps = 9/92 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-----YSPSPKVYYKSPPHPHVCVCPPPPPCYS-PSPKVVYKSPPPPY 173
           P   Y SPPPP+     YS  P     + PHPH     PPPP ++ P P  VY SPPPP 
Sbjct: 115 PHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPP- 173

Query: 174 VYNSPPP---PYYSPSPKVYYKSPPPPSYYSP 260
               P P   PY  PSP      PPPP++  P
Sbjct: 174 ----PTPHKKPYKYPSP------PPPPAHTYP 195

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 27/57 (47%), Positives = 34/57 (59%), Gaps = 5/57 (8%)
 Frame = +3

Query: 171 YVYNSPPPPYYSPSP---KVYYKSPPPPSYYS-PSPKVEYKSPPPPSYS-PSPKTEY 326
           Y Y+SPPPP +SP P     +Y SPPPP  ++ P P   Y SPPPP ++ P P   Y
Sbjct: 30  YSYSSPPPPVHSPPPPKDPYHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVY 86

[117][TOP]
>UniRef100_UPI0001A7B0C1 protein binding / structural constituent of cell wall n=1
            Tax=Arabidopsis thaliana RepID=UPI0001A7B0C1
          Length = 857

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 57/134 (42%), Positives = 67/134 (50%), Gaps = 37/134 (27%)
 Frame = +3

Query: 12   PKVYYKS----PPPPYYS---PSPKVYYKSPPHPHVCVCPPPP----PC--YSPSPK--V 146
            P  YY S    PPPP+YS   P+P  +Y SPP P   +  PPP    PC  YSP P   V
Sbjct: 723  PAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTV 782

Query: 147  VYKSPPPP-------------YVYNSPPPP---YYSPSPK--VYYKSPPPPSYYS----P 260
             Y  PPPP             Y YNSPPPP   +YSP P   +++  PPPP  Y     P
Sbjct: 783  HYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPP 842

Query: 261  SPKVEYKSPPPPSY 302
             P + Y SPPPP +
Sbjct: 843  IPGISYASPPPPPF 856

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 53/124 (42%), Positives = 65/124 (52%), Gaps = 23/124 (18%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYY------KSPPHPHVCVCPPPPPC-YSPSPKVVYKSPPP- 167
            P+ Y   PPPP   P P+ YY        PP   +   PPP P  Y PSP      PPP 
Sbjct: 667  PQTYSPFPPPP--PPPPQTYYPPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQFASPPPPA 724

Query: 168  PYVYNS---PPPPYYS---PSPKVYYKSPPPP--SYYSPSPK-----VEYKSPPPPS--Y 302
            PY Y+S   PPPP+YS   P+P  +Y SPPPP    +SP P+     +EY  PPPP+  Y
Sbjct: 725  PYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHY 784

Query: 303  SPSP 314
            +P P
Sbjct: 785  NPPP 788

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/115 (42%), Positives = 57/115 (49%), Gaps = 19/115 (16%)
 Frame = +3

Query: 30  SPPPPY--YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP-- 197
           SPPPP   Y P P     SPP P     PPPPP +SPSP +    PPPP  Y+  PPP  
Sbjct: 626 SPPPPSTGYPPPPPFTGYSPPSPP----PPPPPTFSPSPSI---PPPPPQTYSPFPPPPP 678

Query: 198 -----YYSPSPK--------VYYKSPPPPSYYSPSPKVEYKSPPPPS--YSPSPK 317
                YY P P         +Y   PP P  Y PSP  ++ SPPPP+  Y  SP+
Sbjct: 679 PPPQTYYPPQPSPSQPPQSPIYGTPPPSPIPYLPSPP-QFASPPPPAPYYYSSPQ 732

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/118 (39%), Positives = 60/118 (50%), Gaps = 22/118 (18%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPP----CYSPSPKV-------VYKSPPPPYVY 179
            PPPP +SPSP +    PP  +    PPPPP     Y P P         +Y +PPP  + 
Sbjct: 651  PPPPTFSPSPSIP-PPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPPQSPIYGTPPPSPIP 709

Query: 180  NSPPPPYYS--PSPKVYYKS---PPPPSYYS---PSPKVEYKSPPPPS---YSPSPKT 320
              P PP ++  P P  YY S   PPPP +YS   P+P   Y SPPPP    +SP P++
Sbjct: 710  YLPSPPQFASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQS 767

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 50/123 (40%), Positives = 55/123 (44%), Gaps = 21/123 (17%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS---PSPKVVYKSPPPPYVY 179
            SP  Y  SPP     P P  YY S P P      PPPP YS   P+P   Y SPPPP   
Sbjct: 706  SPIPYLPSPPQFASPPPPAPYYYSSPQP------PPPPHYSLPPPTPTYHYISPPPPPTP 759

Query: 180  NSPPPPYYSPSPKVYYKSPPPPS-YYSPSPKVE--------------YKSPPPP---SYS 305
               PPP   P P + Y  PPPP+ +Y+P P                 Y SPPPP    YS
Sbjct: 760  IHSPPPQSHP-PCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYS 818

Query: 306  PSP 314
            P P
Sbjct: 819  PPP 821

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 38/87 (43%), Positives = 45/87 (51%), Gaps = 6/87 (6%)
 Frame = +3

Query: 12   PKVYYKSPPPP---YYSPSPK---VYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
            P V+Y  PPPP   +YSP P     YY SPP P      PPPP     P + +  PPPP 
Sbjct: 780  PTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPP-----PVIHHSQPPPPP 834

Query: 174  VYNSPPPPYYSPSPKVYYKSPPPPSYY 254
            +Y  P PP     P + Y SPPPP +Y
Sbjct: 835  IYEGPLPPI----PGISYASPPPPPFY 857

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 47/125 (37%), Positives = 55/125 (44%), Gaps = 19/125 (15%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPP-------------PPPCYSPSPKVVYKSPPPPY 173
           P PP+  PSP     SPP P V   PP             P P YSP P      PPPP+
Sbjct: 582 PSPPFTGPSPPSS-PSPPLPPVIPSPPIVGPTPSSPPPSTPTPVYSPPPPSTGYPPPPPF 640

Query: 174 VYNSPP------PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*IS 335
              SPP      PP +SPSP +    PPPP  YSP P      PPP +Y P   +     
Sbjct: 641 TGYSPPSPPPPPPPTFSPSPSI---PPPPPQTYSPFPPPP--PPPPQTYYPPQPSPSQPP 695

Query: 336 RLPLY 350
           + P+Y
Sbjct: 696 QSPIY 700

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 47/115 (40%), Positives = 54/115 (46%), Gaps = 13/115 (11%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSP-KVYYKSPPHPHVCVCPP---PPPCYSPSPKVVYKSPPPPYV 176
           +P     SPP P   P+P      SPP   +   PP   P P  SPSP +    P PP V
Sbjct: 553 TPSSPIPSPPTPSTPPTPISPGQNSPP---IIPSPPFTGPSPPSSPSPPLPPVIPSPPIV 609

Query: 177 ---YNSPPP----PYYSPSPKVYYKSPPPP--SYYSPSPKVEYKSPPPPSYSPSP 314
               +SPPP    P YSP P      PPPP   Y  PSP      PPPP++SPSP
Sbjct: 610 GPTPSSPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSP----PPPPPPTFSPSP 660

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/114 (36%), Positives = 47/114 (41%), Gaps = 12/114 (10%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP----PPYV 176
           SP     SP  P  SP+      SPP       P   P  SP+      SPP     P  
Sbjct: 457 SPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSP 516

Query: 177 YNSPPPPYYSPSPKVYYKSPP--------PPSYYSPSPKVEYKSPPPPSYSPSP 314
             SPP P  SPSP +   SPP        PPS  SP+P     SPP PS  P+P
Sbjct: 517 GGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTP 570

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 42/110 (38%), Positives = 47/110 (42%), Gaps = 15/110 (13%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPP-------HPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPP P  SPSP +   SPP        P      P PP  +PSP     SP  P    SP
Sbjct: 422 SPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSP 481

Query: 189 PPPYYSPSPKVYYKSPP--------PPSYYSPSPKVEYKSPPPPSYSPSP 314
           P    +P+P     S P        PPS  SP+      SPP PS SPSP
Sbjct: 482 PSSPTTPTPGGSPPSSPTTPTPGGSPPS--SPTTPSPGGSPPSPSISPSP 529

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 37/102 (36%), Positives = 42/102 (41%), Gaps = 7/102 (6%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP---PPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           SPP    +P+P     SPP       P   PP P  SPSP +   SPP        PP  
Sbjct: 493 SPPSSPTTPTPG---GSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSP 549

Query: 201 YSPSPKVYYKSPP----PPSYYSPSPKVEYKSPPPPSYSPSP 314
            SP+P     SPP    PP+  SP        P PP   PSP
Sbjct: 550 SSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSP 591

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 41/119 (34%), Positives = 50/119 (42%), Gaps = 12/119 (10%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPP P  SPSP +   SPP        PP P  SP+P     SP P     SPP P   P
Sbjct: 519 SPPSPSISPSPPITVPSPPSTPTSPGSPPSPS-SPTPS----SPIP-----SPPTPSTPP 568

Query: 210 S------------PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPLY 350
           +            P   +  P PPS  SPSP +    P PP   P+P +    +  P+Y
Sbjct: 569 TPISPGQNSPPIIPSPPFTGPSPPS--SPSPPLPPVIPSPPIVGPTPSSPPPSTPTPVY 625

[118][TOP]
>UniRef100_Q9SN46 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9SN46_ARATH
          Length = 839

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 57/134 (42%), Positives = 67/134 (50%), Gaps = 37/134 (27%)
 Frame = +3

Query: 12   PKVYYKS----PPPPYYS---PSPKVYYKSPPHPHVCVCPPPP----PC--YSPSPK--V 146
            P  YY S    PPPP+YS   P+P  +Y SPP P   +  PPP    PC  YSP P   V
Sbjct: 705  PAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTV 764

Query: 147  VYKSPPPP-------------YVYNSPPPP---YYSPSPK--VYYKSPPPPSYYS----P 260
             Y  PPPP             Y YNSPPPP   +YSP P   +++  PPPP  Y     P
Sbjct: 765  HYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPP 824

Query: 261  SPKVEYKSPPPPSY 302
             P + Y SPPPP +
Sbjct: 825  IPGISYASPPPPPF 838

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/118 (39%), Positives = 60/118 (50%), Gaps = 24/118 (20%)
 Frame = +3

Query: 33   PPPPYY----SPSPKVYYKSPP----HPHVCVCPPPPPCYSPSPK-----VVYKSPPPPY 173
            PP PYY     P P  +Y  PP    + ++   PPP P +SP P+     + Y  PPPP 
Sbjct: 704  PPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPT 763

Query: 174  VYNSPPPP----YYSPSPK---VYYKSPPPPS--YYSPSPK--VEYKSPPPPSYSPSP 314
            V+ +PPPP    +YSP P     YY SPPPP   +YSP P   + +  PPPP     P
Sbjct: 764  VHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGP 821

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 38/87 (43%), Positives = 45/87 (51%), Gaps = 6/87 (6%)
 Frame = +3

Query: 12  PKVYYKSPPPP---YYSPSPK---VYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
           P V+Y  PPPP   +YSP P     YY SPP P      PPPP     P + +  PPPP 
Sbjct: 762 PTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPP-----PVIHHSQPPPPP 816

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYY 254
           +Y  P PP     P + Y SPPPP +Y
Sbjct: 817 IYEGPLPPI----PGISYASPPPPPFY 839

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 48/116 (41%), Positives = 57/116 (49%), Gaps = 24/116 (20%)
 Frame = +3

Query: 39   PPYYSPSPKVYYKSPPHP----HVCVCPPPPPCYS---PSPKVVYKSPPPPYV-YNSPPP 194
            P Y +   ++   SPP P    +    PPPPP YS   P+P   Y SPPPP    +SPPP
Sbjct: 688  PLYLTCRHRLNLASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPP 747

Query: 195  PYY--------SPSPKVYYKSPPPPS--YYSPSPK---VEYKSPPPP---SYSPSP 314
              +         P P V+Y  PPPPS  +YSP P      Y SPPPP    YSP P
Sbjct: 748  QSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPP 803

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 43/109 (39%), Positives = 48/109 (44%), Gaps = 12/109 (11%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV--------YNS 185
           SPP P  SPSP +   SPP        PP P  SP+P     SPP P           NS
Sbjct: 519 SPPSPSISPSPPITVPSPPSTPTSPGSPPSPS-SPTPSSPIPSPPTPSTPPTPISPGQNS 577

Query: 186 PP----PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           PP    PP+  PSP      P PP   SP       S PPPS +P+P T
Sbjct: 578 PPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPS-TPTPGT 625

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/114 (36%), Positives = 47/114 (41%), Gaps = 12/114 (10%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP----PPYV 176
           SP     SP  P  SP+      SPP       P   P  SP+      SPP     P  
Sbjct: 457 SPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSP 516

Query: 177 YNSPPPPYYSPSPKVYYKSPP--------PPSYYSPSPKVEYKSPPPPSYSPSP 314
             SPP P  SPSP +   SPP        PPS  SP+P     SPP PS  P+P
Sbjct: 517 GGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTP 570

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 42/110 (38%), Positives = 47/110 (42%), Gaps = 15/110 (13%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPP-------HPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPP P  SPSP +   SPP        P      P PP  +PSP     SP  P    SP
Sbjct: 422 SPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSP 481

Query: 189 PPPYYSPSPKVYYKSPP--------PPSYYSPSPKVEYKSPPPPSYSPSP 314
           P    +P+P     S P        PPS  SP+      SPP PS SPSP
Sbjct: 482 PSSPTTPTPGGSPPSSPTTPTPGGSPPS--SPTTPSPGGSPPSPSISPSP 529

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 37/102 (36%), Positives = 42/102 (41%), Gaps = 7/102 (6%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP---PPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           SPP    +P+P     SPP       P   PP P  SPSP +   SPP        PP  
Sbjct: 493 SPPSSPTTPTPG---GSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSP 549

Query: 201 YSPSPKVYYKSPP----PPSYYSPSPKVEYKSPPPPSYSPSP 314
            SP+P     SPP    PP+  SP        P PP   PSP
Sbjct: 550 SSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSP 591

[119][TOP]
>UniRef100_B9FLI1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FLI1_ORYSJ
          Length = 518

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 54/121 (44%), Positives = 60/121 (49%), Gaps = 17/121 (14%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP------ 164
           ++ P  ++ SPPPP  SP P VY  SPP P     PPPPP YSP P V    PP      
Sbjct: 98  KSPPPPHHDSPPPPRASPPPPVY--SPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPP 155

Query: 165 -----------PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
                      PP   +SPPPP  SP P V   S PPP   SP P V   SPPPP +SP 
Sbjct: 156 PVSSPPPPVPSPPPPVSSPPPPVSSPPPPV---SSPPPPVSSPPPPV--SSPPPPVHSPP 210

Query: 312 P 314
           P
Sbjct: 211 P 211

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/103 (46%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP  SP P V   SPP P   V  PPPP  SP P V   SPPPP   +SP
Sbjct: 152 SPPPPVSSPPPPVPSPPPPV--SSPPPP---VSSPPPPVSSPPPPV--SSPPPPV--SSP 202

Query: 189 PPPYYSPSPKVYYKSPPPPS--YYSPSPKVEYKSPPPPSYSPS 311
           PPP +SP P V   SPPPP+      +    Y +   P+Y PS
Sbjct: 203 PPPVHSPPPPV--SSPPPPASDVVYCTNTTRYPTCTSPAYCPS 243

[120][TOP]
>UniRef100_A3KD20 Leucine-rich repeat/extensin n=1 Tax=Nicotiana plumbaginifolia
           RepID=A3KD20_NICPL
          Length = 725

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/110 (47%), Positives = 55/110 (50%), Gaps = 8/110 (7%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHP-----HVCVCPPPPPCYSPSPKVVYKSPPPP- 170
           SP   Y  P  P +   P      PP P     H    P PPP Y+PSP      PPPP 
Sbjct: 594 SPPAGYTPPQEPSHPAPPTPPCNEPPTPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPP 653

Query: 171 -YVYNSPPPPYYSPSPKV-YYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            Y Y+SPPPP  SP P   YY SPPPPS   PSP     SPPPPS SP P
Sbjct: 654 TYTYSSPPPPSPSPPPPTYYYSSPPPPSPPPPSP-----SPPPPSPSPPP 698

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 51/104 (49%), Positives = 57/104 (54%), Gaps = 7/104 (6%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHP---HVCVCPPPPPCYSPSPKVVYKSPPPPYV 176
           ++P    K  PPP Y+PSP  Y +SPP P   +    PPPP    P P   Y SPPPP  
Sbjct: 624 STPHWQPKPSPPPTYNPSPS-YTQSPPPPPPTYTYSSPPPPSPSPPPPTYYYSSPPPP-- 680

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPSY-YSPSPK---VEYKSPPPP 296
             SPPPP  SPSP     SPPPPSY + P P    V Y SPPPP
Sbjct: 681 --SPPPP--SPSPPPPSPSPPPPSYEHVPLPPVVGVSYASPPPP 720

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 52/141 (36%), Positives = 61/141 (43%), Gaps = 25/141 (17%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHP--------HVCVCPPPPPCYSPSPKVVYKSP 161
           +SP   ++SPPPP +  SP   + SPP P        H    PPPPP Y   P    +SP
Sbjct: 456 SSPSHKHRSPPPPTHKISPVTRHASPPPPPPSPVYYHHPSPSPPPPPVYYAPPTYKPQSP 515

Query: 162 PPP----------YVYNSPPPP---YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PPP          Y   SPPPP   +Y P        PPPP  +   P     SPPPP Y
Sbjct: 516 PPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPHSPPPPVY 575

Query: 303 ----SPSPKTEY*ISRLPLYE 353
               SP P T       P+YE
Sbjct: 576 VTPSSPPPPT-------PVYE 589

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 47/107 (43%), Positives = 57/107 (53%), Gaps = 12/107 (11%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPSPKVVYKSPPPPYV---- 176
           P    +SPPPP    S   + +SPP P     P PPPP YS SP   ++SPPPP      
Sbjct: 415 PVAPIESPPPPSSKSSGSHFKRSPPPPQSTPPPSPPPPVYSSSPSHKHRSPPPPTHKISP 474

Query: 177 ---YNSPPPPYYSPSPKVYY----KSPPPPSYYSPSPKVEYKSPPPP 296
              + SPPPP   PSP  Y+      PPPP YY+P P  + +SPPPP
Sbjct: 475 VTRHASPPPP--PPSPVYYHHPSPSPPPPPVYYAP-PTYKPQSPPPP 518

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 43/104 (41%), Positives = 52/104 (50%), Gaps = 2/104 (1%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           R  P    K PP     P+PK    +P  P   +  PPPP    S     +SPPPP    
Sbjct: 388 RPKPTPKPKRPPVQNKPPAPKP--STPSRPVAPIESPPPPSSKSSGSHFKRSPPPPQSTP 445

Query: 183 --SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
             SPPPP YS SP   ++SPPPP+ +  SP   + SPPPP  SP
Sbjct: 446 PPSPPPPVYSSSPSHKHRSPPPPT-HKISPVTRHASPPPPPPSP 488

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 46/116 (39%), Positives = 56/116 (48%), Gaps = 13/116 (11%)
 Frame = +3

Query: 12  PKVYYKSP------PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
           P VYY  P      PPP   P P V+Y+ P +      PPPP  Y P        PPPP 
Sbjct: 501 PPVYYAPPTYKPQSPPP---PPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPPPP 557

Query: 174 VYNSPPP-PYYSPSPKVYY--KSPPPPS----YYSPSPKVEYKSPPPPSYSPSPKT 320
           V+  PP    +SP P VY    SPPPP+    + +PSP   Y  P  PS+ P+P T
Sbjct: 558 VHYEPPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPPAGYTPPQEPSH-PAPPT 612

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 43/123 (34%), Positives = 56/123 (45%), Gaps = 22/123 (17%)
 Frame = +3

Query: 12  PKVYYKSPP--PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           P V+Y+ P   P    P P V+Y+ P +      PPPP  Y P     +  PPP YV  S
Sbjct: 520 PPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPHSPPPPVYVTPS 579

Query: 186 PPPP----YY--SPSPKVYYKSPPPPSYYSP--------------SPKVEYKSPPPPSYS 305
            PPP    Y   +PSP   Y  P  PS+ +P              +P  + K  PPP+Y+
Sbjct: 580 SPPPPTPVYEHPTPSPPAGYTPPQEPSHPAPPTPPCNEPPTPPPSTPHWQPKPSPPPTYN 639

Query: 306 PSP 314
           PSP
Sbjct: 640 PSP 642

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 42/103 (40%), Positives = 53/103 (51%), Gaps = 8/103 (7%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPS-PKVVYKSPPPP-------YVYNSPPPP 197
           P   P+PK     P  P V   PP P   +PS P    +SPPPP       +   SPPPP
Sbjct: 387 PRPKPTPK-----PKRPPVQNKPPAPKPSTPSRPVAPIESPPPPSSKSSGSHFKRSPPPP 441

Query: 198 YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
             +P P     SPPPP  YS SP  +++SPPPP++  SP T +
Sbjct: 442 QSTPPP-----SPPPP-VYSSSPSHKHRSPPPPTHKISPVTRH 478

[121][TOP]
>UniRef100_A9SB04 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SB04_PHYPA
          Length = 328

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 56/105 (53%), Positives = 58/105 (55%), Gaps = 10/105 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY-SPSPKVYYKSPPHPHVCVCPPPP-----PCY---SPSPKVVYKSPP 164
           P +Y  SPPPP   SP P VY KSPP P     PPPP     P Y   SP    VYKSPP
Sbjct: 193 PPLYKSSPPPPVLKSPLPPVY-KSPPPPAYKSSPPPPLNKSSPPYVKSSPPLSPVYKSPP 251

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEY-KSPPPP 296
           PPYV +SPPPP Y        KSPPPPSY   SP     KS PPP
Sbjct: 252 PPYVKSSPPPPVY--------KSPPPPSYEKKSPPTPVPKSSPPP 288

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 55/108 (50%), Positives = 56/108 (51%), Gaps = 10/108 (9%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           KSPPPP  S S      SPP P     PPPP   SP P V YKSPPPP   +SPPPP   
Sbjct: 179 KSPPPPPPSTS------SPPPPLYKSSPPPPVLKSPLPPV-YKSPPPPAYKSSPPPPLNK 231

Query: 207 PSPKVY---------YKSPPPPSYYSPSPKVEYKSPPPPSY-SPSPKT 320
            SP            YKSPPPP   S  P   YKSPPPPSY   SP T
Sbjct: 232 SSPPYVKSSPPLSPVYKSPPPPYVKSSPPPPVYKSPPPPSYEKKSPPT 279

[122][TOP]
>UniRef100_A3KD22 Leucine-rich repeat/extensin 1 n=1 Tax=Nicotiana tabacum
           RepID=A3KD22_TOBAC
          Length = 723

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/124 (41%), Positives = 55/124 (44%), Gaps = 23/124 (18%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHP---------------------HVCVCPPPPPCY 128
           P   Y+ P PP  +PSP   Y  P  P                     H    P PPP Y
Sbjct: 582 PPPVYEHPKPPTPTPSPPAGYTPPQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPPTY 641

Query: 129 SPSPKVVYKSPPPP--YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           +PSP      PPPP  Y Y+SPPPP  SP P  YY S PPP    PSP     SPPPPSY
Sbjct: 642 NPSPSYTQSPPPPPPTYTYSSPPPPSSSPPPPTYYYSSPPPP--PPSPPPPSPSPPPPSY 699

Query: 303 SPSP 314
              P
Sbjct: 700 EHVP 703

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 51/131 (38%), Positives = 63/131 (48%), Gaps = 23/131 (17%)
 Frame = +3

Query: 3   RASPKVYYKSPPPP------YYSPSPK----VYYKSPPHPHVCVCPPPPPCYSPSPKVVY 152
           + SP   +  PPPP      Y+ PSP     VYY  P +      PPPPP +   P    
Sbjct: 473 KISPVTRHAPPPPPPPSPVYYHHPSPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPPTYTP 532

Query: 153 KSPPPP---------YVYNSPPPP--YYSPSPKVYYKSPPPPSYYSPS--PKVEYKSPPP 293
           +SPPPP         Y   SPPPP  +Y P P    +SPPPP Y +PS  P   Y+ P P
Sbjct: 533 QSPPPPPPVHYEPPPYTPQSPPPPPVHYEP-PTYTPQSPPPPVYVTPSSPPPPVYEHPKP 591

Query: 294 PSYSPSPKTEY 326
           P+ +PSP   Y
Sbjct: 592 PTPTPSPPAGY 602

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 51/103 (49%), Positives = 58/103 (56%), Gaps = 6/103 (5%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS-PSPKVVYKSPPPP-YVY 179
           ++P    K  PPP Y+PSP  Y +SP        PPPPP Y+  SP     SPPPP Y Y
Sbjct: 627 STPHWQPKPSPPPTYNPSPS-YTQSP--------PPPPPTYTYSSPPPPSSSPPPPTYYY 677

Query: 180 NSPPPPYYSPSPKVYYKSPPPPSY-YSPSPK---VEYKSPPPP 296
           +SPPPP   PSP     SPPPPSY + P P    V Y SPPPP
Sbjct: 678 SSPPPP--PPSPPPPSPSPPPPSYEHVPLPPIVGVSYASPPPP 718

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 49/106 (46%), Positives = 58/106 (54%), Gaps = 11/106 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP---PPPPCYSPSPKVVYKSPPPPYVYN 182
           P V  +SPPPP    S   + +SPP P     P   PPPP YS SP   ++SPPPP    
Sbjct: 415 PIVPIESPPPPSSKSSGSHFKRSPPPPQSTPPPSPPPPPPVYSSSPSHQHRSPPPPTHKI 474

Query: 183 SP-----PPPYYSPSPKVY-YKSPPPPS--YYSPSPKVEYKSPPPP 296
           SP     PPP   PSP  Y + SPPPP   YY+P P  + +SPPPP
Sbjct: 475 SPVTRHAPPPPPPPSPVYYHHPSPPPPQPVYYAP-PTYKPQSPPPP 519

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/125 (37%), Positives = 61/125 (48%), Gaps = 24/125 (19%)
 Frame = +3

Query: 12  PKVYYKSPP--PPYYSPSPKVYYKSPPHPHVCVCPPP----PPCYSPS--PKVVYKSP-- 161
           P V+Y+ P   P    P P V+Y+ PP+      PPP    PP Y+P   P  VY +P  
Sbjct: 521 PPVHYEPPTYTPQSPPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYTPQSPPPPVYVTPSS 580

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP--------------SPKVEYKSPPPPS 299
           PPP VY  P PP  +PSP   Y  P  PS+ +P              +P  + K  PPP+
Sbjct: 581 PPPPVYEHPKPPTPTPSPPAGYTPPQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPPT 640

Query: 300 YSPSP 314
           Y+PSP
Sbjct: 641 YNPSP 645

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 43/112 (38%), Positives = 53/112 (47%), Gaps = 9/112 (8%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHP-------HVCVCPPPPPCYSPSPKVVYKSPP 164
           +SP   ++SPPPP +  SP   +  PP P       H    PPP P Y   P    +SPP
Sbjct: 458 SSPSHQHRSPPPPTHKISPVTRHAPPPPPPPSPVYYHHPSPPPPQPVYYAPPTYKPQSPP 517

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPS--YYSPSPKVEYKSPPPPSYSPSP 314
           PP     PPP +Y P P    +SPPPP   +Y P P      PPPP +   P
Sbjct: 518 PP-----PPPVHYEP-PTYTPQSPPPPPPVHYEPPPYTPQSPPPPPVHYEPP 563

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 43/110 (39%), Positives = 55/110 (50%), Gaps = 8/110 (7%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPS-PKVVYKSPPPP-------YV 176
           + +S   P   P PK   K P  P V   PP P    P+ P V  +SPPPP       + 
Sbjct: 376 FSRSAISPVVKPRPKPTPK-PKRPPVQNKPPAPKPSPPTKPIVPIESPPPPSSKSSGSHF 434

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
             SPPPP  +P P      PPPP  YS SP  +++SPPPP++  SP T +
Sbjct: 435 KRSPPPPQSTPPPS----PPPPPPVYSSSPSHQHRSPPPPTHKISPVTRH 480

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 50/127 (39%), Positives = 62/127 (48%), Gaps = 21/127 (16%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKV-----YY-KSPPHPHVCVCPPPPPCYSPSPKVVYKSPP 164
           ++S   + +SPPPP  +P P        Y  SP H H     PPPP +  SP   +  PP
Sbjct: 428 KSSGSHFKRSPPPPQSTPPPSPPPPPPVYSSSPSHQH---RSPPPPTHKISPVTRHAPPP 484

Query: 165 PP------YVYNSPPPP---YYSPSPKVYYKSPPPPS---YYSPSPKVEYKSPPPP---S 299
           PP      Y + SPPPP   YY+P P    +SPPPP    +Y P P    +SPPPP    
Sbjct: 485 PPPPSPVYYHHPSPPPPQPVYYAP-PTYKPQSPPPPPPPVHYEP-PTYTPQSPPPPPPVH 542

Query: 300 YSPSPKT 320
           Y P P T
Sbjct: 543 YEPPPYT 549

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 44/107 (41%), Positives = 52/107 (48%), Gaps = 5/107 (4%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPP-HPHVCVCPPPPPCYSPSPKVVYKSPPPPY-- 173
           R  P    K PP     P+PK    SPP  P V +  PPPP    S     +SPPPP   
Sbjct: 388 RPKPTPKPKRPPVQNKPPAPK---PSPPTKPIVPIESPPPPSSKSSGSHFKRSPPPPQST 444

Query: 174 --VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
                 PPPP YS SP   ++SPPPP+ +  SP   +  PPPP  SP
Sbjct: 445 PPPSPPPPPPVYSSSPSHQHRSPPPPT-HKISPVTRHAPPPPPPPSP 490

[123][TOP]
>UniRef100_Q09084 Extensin (Class II) n=1 Tax=Solanum lycopersicum RepID=Q09084_SOLLC
          Length = 322

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 56/134 (41%), Positives = 68/134 (50%), Gaps = 17/134 (12%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP----- 167
           +  PK   + PPPP +  S     +SPP P     PPP P Y  SP   ++SPPP     
Sbjct: 23  KPKPKPKPRGPPPPTWKSSGSHNKRSPPPPKSTPLPPPAP-YKKSPTYQHRSPPPPTHKI 81

Query: 168 -PYVYNSPPPPY--------YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS--- 311
            P  ++SPPPP          SP P VYY SPPPP Y+ P P  + KSPPPP  +PS   
Sbjct: 82  SPVTHHSPPPPSPVYDHPSPSSPPPPVYY-SPPPPVYHEPPPTYKPKSPPPPP-TPSYEH 139

Query: 312 PKTEY*ISRLPLYE 353
           PKT   +   P YE
Sbjct: 140 PKTPSPLPPTPSYE 153

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 51/113 (45%), Positives = 57/113 (50%), Gaps = 23/113 (20%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYY-KSPPHPHV----CVCPPPPPCYS-----PSPKVVYKSPPPP-- 170
           +SPPPP   P+P   + K+P HP      C  PPPPP  S     PSP   Y SPPPP  
Sbjct: 208 QSPPPP---PTPSYEHPKTPSHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPPSP 264

Query: 171 ------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSP-----KVEYKSPPPP 296
                 Y Y+SPPPP  SP P  Y   PPPP +Y   P      V Y SPPPP
Sbjct: 265 SPPPPTYYYSSPPPPSPSPPPPTYSSPPPPPPFYENIPLPPVIGVSYASPPPP 317

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 51/122 (41%), Positives = 61/122 (50%), Gaps = 16/122 (13%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPP----HPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           + SP   ++SPPPP +  SP  ++  PP    + H     PPPP Y   P  VY  PPP 
Sbjct: 64  KKSPTYQHRSPPPPTHKISPVTHHSPPPPSPVYDHPSPSSPPPPVYYSPPPPVYHEPPPT 123

Query: 171 YVYNSPPPPYYSPS---PKVYYKSPPPPSYYSPS--PKVEY---KSPPPPSY----SPSP 314
           Y   SPPPP  +PS   PK     PP PSY  P   P  E+    SPP PSY    +PSP
Sbjct: 124 YKPKSPPPP-PTPSYEHPKTPSPLPPTPSYEHPKTPPSHEHPKTPSPPTPSYEHPKTPSP 182

Query: 315 KT 320
            T
Sbjct: 183 PT 184

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/107 (44%), Positives = 51/107 (47%), Gaps = 10/107 (9%)
 Frame = +3

Query: 30  SPPPPYY----SPSPKVYYKSPPHPHVCVCPPPP-PCYSPSPKVVYKSPPPPYVYNSPPP 194
           SPP P Y    +PSP     S  HP     PPPP P Y       + +PP P     PPP
Sbjct: 181 SPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPPPTPSYEHPKTPSHPTPPTPPCNEPPPP 240

Query: 195 PYYS-----PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           P  S     PSP   Y SPPPPS   P P   Y SPPPPS SP P T
Sbjct: 241 PPNSHWEPKPSPPYTYSSPPPPSPSPPPPTYYYSSPPPPSPSPPPPT 287

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 47/129 (36%), Positives = 56/129 (43%), Gaps = 24/129 (18%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS---------PSPKVVYKSPP 164
           P VYY  PPP Y+ P P    KSPP       PPP P Y          P+P   +   P
Sbjct: 106 PPVYYSPPPPVYHEPPPTYKPKSPP-------PPPTPSYEHPKTPSPLPPTPSYEHPKTP 158

Query: 165 PPYVYN---SPPPPYY---------SPS---PKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
           P + +    SPP P Y         +PS   PK     PP PSY  P P    +SPPPP 
Sbjct: 159 PSHEHPKTPSPPTPSYEHPKTPSPPTPSYEHPKTPSPPPPTPSYEHPQP----QSPPPP- 213

Query: 300 YSPSPKTEY 326
             P+P  E+
Sbjct: 214 --PTPSYEH 220

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 36/81 (44%), Positives = 38/81 (46%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + SP   Y SPPPP  SP P  YY S P         PPP  SP P      PPPP  Y 
Sbjct: 249 KPSPPYTYSSPPPPSPSPPPPTYYYSSP---------PPPSPSPPPPTYSSPPPPPPFYE 299

Query: 183 SPPPPYYSPSPKVYYKSPPPP 245
           + P P   P   V Y SPPPP
Sbjct: 300 NIPLP---PVIGVSYASPPPP 317

[124][TOP]
>UniRef100_UPI0001A7B3CA lipid binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B3CA
          Length = 275

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 47/104 (45%), Positives = 49/104 (47%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           +PK     PPPPY    P  Y   PP     V PPPPP   P P    K PPPPYV   P
Sbjct: 60  TPKPPTVKPPPPYIPCPPPPYTPKPP----TVKPPPPPYVKPPPPPTVKPPPPPYVKPPP 115

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           PP    P P   Y  PPP  Y  P P V  K PPPP  +P P T
Sbjct: 116 PPTVKPPPPPTPYTPPPPTPYTPPPPTV--KPPPPPVVTPPPPT 157

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/115 (41%), Positives = 53/115 (46%), Gaps = 11/115 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  Y   PPPPY    P V  K PP P+V   PPPPP   P P    K PPPP V   PP
Sbjct: 69  PPPYIPCPPPPYTPKPPTV--KPPPPPYVK--PPPPPTVKPPPPPYVKPPPPPTVKPPPP 124

Query: 192 PPYYSPSPKVYYKSPPP-----------PSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           P  Y+P P   Y  PPP           P   +P+P+     PPP  Y P PK E
Sbjct: 125 PTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPE 179

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/106 (43%), Positives = 49/106 (46%), Gaps = 8/106 (7%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPH-PHVCVCPPPPPC-------YSPSPKVVYKSPPPPYVYN 182
           K P  P   P P    K P H P      PPPP        Y+P P  V K PPPPYV  
Sbjct: 40  KPPKHPAKPPKPPTV-KPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTV-KPPPPPYV-K 96

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            PPPP   P P  Y K PPPP+   P P   Y  PPP  Y+P P T
Sbjct: 97  PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPT 142

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 46/109 (42%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSP---SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           PK   K P PP   P   +PK     PP P++  CPPPP  Y+P P  V           
Sbjct: 42  PKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYI-PCPPPP--YTPKPPTV----------K 88

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS-YSPSPKTEY 326
            PPPPY  P P    K PPPP Y  P P    K PPPP+ Y+P P T Y
Sbjct: 89  PPPPPYVKPPPPPTVK-PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPY 136

[125][TOP]
>UniRef100_UPI0001A7B0BB lipid binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B0BB
          Length = 370

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 47/104 (45%), Positives = 49/104 (47%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           +PK     PPPPY    P  Y   PP     V PPPPP   P P    K PPPPYV   P
Sbjct: 60  TPKPPTVKPPPPYIPCPPPPYTPKPP----TVKPPPPPYVKPPPPPTVKPPPPPYVKPPP 115

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           PP    P P   Y  PPP  Y  P P V  K PPPP  +P P T
Sbjct: 116 PPTVKPPPPPTPYTPPPPTPYTPPPPTV--KPPPPPVVTPPPPT 157

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/115 (41%), Positives = 53/115 (46%), Gaps = 11/115 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  Y   PPPPY    P V  K PP P+V   PPPPP   P P    K PPPP V   PP
Sbjct: 69  PPPYIPCPPPPYTPKPPTV--KPPPPPYVK--PPPPPTVKPPPPPYVKPPPPPTVKPPPP 124

Query: 192 PPYYSPSPKVYYKSPPP-----------PSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           P  Y+P P   Y  PPP           P   +P+P+     PPP  Y P PK E
Sbjct: 125 PTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPE 179

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/106 (43%), Positives = 49/106 (46%), Gaps = 8/106 (7%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPH-PHVCVCPPPPPC-------YSPSPKVVYKSPPPPYVYN 182
           K P  P   P P    K P H P      PPPP        Y+P P  V K PPPPYV  
Sbjct: 40  KPPKHPAKPPKPPTV-KPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTV-KPPPPPYV-K 96

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            PPPP   P P  Y K PPPP+   P P   Y  PPP  Y+P P T
Sbjct: 97  PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPT 142

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 46/109 (42%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSP---SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           PK   K P PP   P   +PK     PP P++  CPPPP  Y+P P  V           
Sbjct: 42  PKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYI-PCPPPP--YTPKPPTV----------K 88

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS-YSPSPKTEY 326
            PPPPY  P P    K PPPP Y  P P    K PPPP+ Y+P P T Y
Sbjct: 89  PPPPPYVKPPPPPTVK-PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPY 136

[126][TOP]
>UniRef100_O23370 Cell wall protein like n=1 Tax=Arabidopsis thaliana
           RepID=O23370_ARATH
          Length = 428

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 47/104 (45%), Positives = 49/104 (47%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           +PK     PPPPY    P  Y   PP     V PPPPP   P P    K PPPPYV   P
Sbjct: 60  TPKPPTVKPPPPYIPCPPPPYTPKPP----TVKPPPPPYVKPPPPPTVKPPPPPYVKPPP 115

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           PP    P P   Y  PPP  Y  P P V  K PPPP  +P P T
Sbjct: 116 PPTVKPPPPPTPYTPPPPTPYTPPPPTV--KPPPPPVVTPPPPT 157

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/115 (41%), Positives = 53/115 (46%), Gaps = 11/115 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  Y   PPPPY    P V  K PP P+V   PPPPP   P P    K PPPP V   PP
Sbjct: 69  PPPYIPCPPPPYTPKPPTV--KPPPPPYVK--PPPPPTVKPPPPPYVKPPPPPTVKPPPP 124

Query: 192 PPYYSPSPKVYYKSPPP-----------PSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           P  Y+P P   Y  PPP           P   +P+P+     PPP  Y P PK E
Sbjct: 125 PTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPE 179

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/106 (43%), Positives = 49/106 (46%), Gaps = 8/106 (7%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPH-PHVCVCPPPPPC-------YSPSPKVVYKSPPPPYVYN 182
           K P  P   P P    K P H P      PPPP        Y+P P  V K PPPPYV  
Sbjct: 40  KPPKHPAKPPKPPTV-KPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTV-KPPPPPYV-K 96

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            PPPP   P P  Y K PPPP+   P P   Y  PPP  Y+P P T
Sbjct: 97  PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPT 142

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 46/109 (42%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSP---SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           PK   K P PP   P   +PK     PP P++  CPPPP  Y+P P  V           
Sbjct: 42  PKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYI-PCPPPP--YTPKPPTV----------K 88

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS-YSPSPKTEY 326
            PPPPY  P P    K PPPP Y  P P    K PPPP+ Y+P P T Y
Sbjct: 89  PPPPPYVKPPPPPTVK-PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPY 136

[127][TOP]
>UniRef100_C6T6W7 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max
           RepID=C6T6W7_SOYBN
          Length = 69

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 47/94 (50%), Positives = 50/94 (53%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           YYKSPPPP   P P  +Y SPP        PP P           SPPPPY Y SPPPP 
Sbjct: 1   YYKSPPPPTSYPPPPYHYVSPP--------PPSP-----------SPPPPYHYTSPPPPS 41

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
            +P+PK  YKSPPPP Y        Y SPPPP Y
Sbjct: 42  PAPAPKYIYKSPPPPVYI-------YASPPPPIY 68

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/67 (53%), Positives = 40/67 (59%)
 Frame = +3

Query: 150 YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY* 329
           YKSPPPP  Y  PPPPY+       Y SPPPPS  SP P   Y SPPPPS +P+PK  Y 
Sbjct: 2   YKSPPPPTSY--PPPPYH-------YVSPPPPSP-SPPPPYHYTSPPPPSPAPAPKYIYK 51

Query: 330 ISRLPLY 350
               P+Y
Sbjct: 52  SPPPPVY 58

[128][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 50/96 (52%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY-SPSPKVVYKSPPPPYVYNSPPPPYYS 206
            SPPPP  SP P     SPP P     PPPP    SP P     SPPPP +  SPPPP  S
Sbjct: 1753 SPPPP--SPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTS 1810

Query: 207  PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PSP      PPPP+  SP P     SPPPPS SPSP
Sbjct: 1811 PSP------PPPPASPSPPPPSASPSPPPPSSSPSP 1840

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 52/98 (53%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPSPKV--VYKSPPPPYVYNSPPPPY 200
            SPPPP  SPSP     SP  P     P PPPP  SPSP       SPPPP    SPPPP 
Sbjct: 1767 SPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPS 1826

Query: 201  YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             SPSP      PPP S  SP P     SPPPPS SPSP
Sbjct: 1827 ASPSP------PPPSSSPSPPPPSSSPSPPPPSLSPSP 1858

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 55/108 (50%), Positives = 57/108 (52%), Gaps = 13/108 (12%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPS--PKVVYKSPPPPYVYNSPPPPY 200
           SPPPP  SPSP     SP  P   + P PPPP  SPS  P  V  SPPPP +  SPPPP 
Sbjct: 225 SPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPS 284

Query: 201 YSPSPKVYYKSP-----PPPSYYSPSPKVE-----YKSPPPPSYSPSP 314
            SPSP     SP     PPP   SPSP          SPPPPS SPSP
Sbjct: 285 LSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSP 332

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 54/102 (52%), Positives = 56/102 (54%), Gaps = 7/102 (6%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPSPKVVYKSPPPPYVYNSPPP---P 197
           SPPPP  SPSP     SP  P   + P PPPP  SPSP     SPPPP    SPPP   P
Sbjct: 261 SPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPP---PSPPPPSTSPSPPPRPPP 317

Query: 198 YYSPSPKV--YYKSPPPPSYY-SPSPKVEYKSPPPPSYSPSP 314
             SPSP       SPPPPS   SP P     SPPPPS+SPSP
Sbjct: 318 SASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSP 359

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 52/100 (52%), Positives = 55/100 (55%), Gaps = 7/100 (7%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPP--PPCYSPSPKV--VYKSPPPPYVYNSPPPP 197
           SPPPP  SPSP     SPP P     PPP  PP  SPSP    +  SPPPP +  SPPPP
Sbjct: 288 SPPPPSLSPSPP---PSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPP 344

Query: 198 YYSPSPKV--YYKSPPPPSYY-SPSPKVEYKSPPPPSYSP 308
             SPSP    +  SPPPPS   SP P     SPPPPS  P
Sbjct: 345 SLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPP 384

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 50/96 (52%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP  SPSP     SP  P   + P PPPP  SPSP     SP PP    SPPPP  S
Sbjct: 252 SPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPP---PSPPPPSTS 308

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PSP      PPP +  SP P     SPPPPS SPSP
Sbjct: 309 PSPP---PRPPPSASPSPPPPSLSPSPPPPSLSPSP 341

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/101 (51%), Positives = 53/101 (52%), Gaps = 6/101 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP---PYVYNSPPPPY 200
           SPPPP  SPSP     SP  P   + P PPP  SP P     SPPP   P    SPPPP 
Sbjct: 270 SPPPPSLSPSPPPPSLSPSPPPPSLSPSPPP--SPPPPSTSPSPPPRPPPSASPSPPPPS 327

Query: 201 YSPS--PKVYYKSPPPPSYY-SPSPKVEYKSPPPPSYSPSP 314
            SPS  P     SPPPPS   SP P     SPPPPS SPSP
Sbjct: 328 LSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSP 368

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 53/100 (53%), Positives = 53/100 (53%), Gaps = 5/100 (5%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV--VYKSPPPPYVYNSPPPPYY 203
            SPPPP   PSP     SPP P      PPPP  SPSP       SPPPP    SPPPP  
Sbjct: 1740 SPPPPSPPPSPP---PSPPPPS-----PPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSA 1791

Query: 204  SPSPKV--YYKSPPPPSYY-SPSPKVEYKSPPPPSYSPSP 314
            SPSP       SPPPPS   SP P     SPPPPS SPSP
Sbjct: 1792 SPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSP 1831

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/93 (49%), Positives = 48/93 (51%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP 215
            PPP   P P     SPP P     PPP P  SP P     SPPPP +  SPPPP  SPSP
Sbjct: 1718 PPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSP 1777

Query: 216  KVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                  PPP +  SP P     SPPPPS SPSP
Sbjct: 1778 ------PPPSASPSPPPPSASPSPPPPSLSPSP 1804

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/98 (50%), Positives = 50/98 (51%), Gaps = 3/98 (3%)
 Frame = +3

Query: 30   SPPPPYYSPSPKV--YYKSPPHPHVCVCPPPPPCY-SPSPKVVYKSPPPPYVYNSPPPPY 200
            SPPPP  SPSP       SPP P     PPPPP   SP P     SPPPP    SPPPP 
Sbjct: 1785 SPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPS 1844

Query: 201  YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             SPSP      PPP    SP P     SPPPPS  P+P
Sbjct: 1845 SSPSP------PPPSLSPSPPPSPPPSSPPPPS-PPTP 1875

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 48/94 (51%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPPP-PPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPP   PSP     SPP P     PPP PP  SP P  +  SPPPP    SPPPP  SPS
Sbjct: 1728 PPPPSPPSPPP--PSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPS 1785

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P      PPP +  SP P     SPPPPS SPSP
Sbjct: 1786 P------PPPSASPSPPPPSLSPSPPPPSTSPSP 1813

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 53/106 (50%), Positives = 55/106 (51%), Gaps = 11/106 (10%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP--------PPPPCYSPS--PKVVYKSPPPPYVY 179
           S PPP  SPSP       P P +   P        PPPP  SPS  P  +  SPPPP V 
Sbjct: 216 SLPPPSASPSP-------PPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVS 268

Query: 180 NSPPPPYYSPSPKVYYKSP-PPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SPPPP  SPSP     SP PPP   SPSP     SPPPPS SPSP
Sbjct: 269 PSPPPPSLSPSPPPPSLSPSPPPPSLSPSPP---PSPPPPSTSPSP 311

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 50/99 (50%), Positives = 52/99 (52%), Gaps = 4/99 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY-SPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPP P   PSP     S P P     PPPP    SP P  +  SPPPP +  SPPPP  S
Sbjct: 204 SPPYPPSLPSPP----SLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLS 259

Query: 207 PS--PKVYYKSPPPPSYY-SPSPKVEYKSPPPPSYSPSP 314
           PS  P     SPPPPS   SP P     SPPPPS SPSP
Sbjct: 260 PSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSP 298

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 45/96 (46%), Positives = 48/96 (50%), Gaps = 1/96 (1%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP  SPSP     SP  P   + P PPPP +SPSP     SP PP     P PP  S
Sbjct: 322 SPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPS 381

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P P +    PPPPS   P P      PPPPS  P P
Sbjct: 382 PPPPL----PPPPS--PPPPLPPPPIPPPPSPPPPP 411

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/95 (46%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPP  SPSP     SP  P   + P PPPP  SPSP     SP PP    SP PP  +P 
Sbjct: 315 PPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPP 374

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPP-PPSYSPSP 314
           P     SPPPP    PSP      PP PP  SP P
Sbjct: 375 PSPPPPSPPPPLPPPPSPPPPLPPPPIPPPPSPPP 409

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 49/99 (49%), Positives = 52/99 (52%), Gaps = 3/99 (3%)
 Frame = +3

Query: 27   KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP--PPY 200
            +SPPPP   P P +    PP+P     P PPP   PSP     SPPPP    SPP  PP 
Sbjct: 1706 QSPPPPL--PPPPL--PPPPNPPP---PLPPPPSPPSPPP--PSPPPPSPPPSPPPSPPP 1756

Query: 201  YSPSPKVYYKSPPPPSYY-SPSPKVEYKSPPPPSYSPSP 314
             SP P     SPPPPS   SP P     SPPPPS SPSP
Sbjct: 1757 PSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSP 1795

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/103 (42%), Positives = 47/103 (45%), Gaps = 1/103 (0%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP  SP P     SPP       P PPP   P P      PPPP    SP
Sbjct: 677 SPSPPPPSPPPPSPSPPPSPPPPSPP-------PSPPPPSPPPPLPPPPLPPPPLPPPSP 729

Query: 189 PP-PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP P  SP P     +PPPP+   P+P       PPPS  PSP
Sbjct: 730 PPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSP 772

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 45/96 (46%), Positives = 45/96 (46%), Gaps = 1/96 (1%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
            SPPPP  SPSP     SP  P     P PPPP  SP       SPPPP    SPPPP  S
Sbjct: 1803 SPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSP-------SPPPPSSSPSPPPPSLS 1855

Query: 207  PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PSP      PP P   SP P     SPP P   P P
Sbjct: 1856 PSP------PPSPPPSSPPP----PSPPTPPAPPRP 1881

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 48/103 (46%), Positives = 50/103 (48%), Gaps = 8/103 (7%)
 Frame = +3

Query: 30   SPPPPYY-SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP---- 194
            SPPPP   SPS     +SPP P     PPPP    P P      PPPP   + PPP    
Sbjct: 1690 SPPPPNAPSPSSMPPSQSPPPP----LPPPP--LPPPPNPPPPLPPPPSPPSPPPPSPPP 1743

Query: 195  --PYYSPSPKVYYKSPPPPSYY-SPSPKVEYKSPPPPSYSPSP 314
              P  SP P     SPPPPS   SP P     SPPPPS SPSP
Sbjct: 1744 PSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSP 1786

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 45/96 (46%), Positives = 46/96 (47%), Gaps = 3/96 (3%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP-PPPPCYSPSPKVVY--KSPPPPYVYNSPPPPY 200
           SPPPP  SPSP     SP  P     P PPPP  SPSP       SPPPP    SPPPP 
Sbjct: 331 SPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPP----SPPPP- 385

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
             P P      PPPP    PSP      PPPP  +P
Sbjct: 386 LPPPPSPPPPLPPPPIPPPPSP----PPPPPPPLAP 417

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 45/108 (41%), Positives = 51/108 (47%), Gaps = 12/108 (11%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPP-PPCYSPSPKVVYKSPPPPYVYNSPPP----- 194
            PP P  SP P +    PP P   + PPP PP  SP P      PPPP    SPPP     
Sbjct: 1594 PPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPS 1653

Query: 195  ----PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP--PPPSYSPSPKT 320
                P  SPSP     +PPPPS   PSP +    P  PPP  +PSP +
Sbjct: 1654 PPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSS 1701

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 43/94 (45%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHP-HVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPP   P P     SPP P      PPPP   SPS     +SPPPP      PPP   P 
Sbjct: 1666 PPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPL-----PPPPLPPP 1720

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P      PPPPS  SP P     SPPPPS  PSP
Sbjct: 1721 PNPPPPLPPPPSPPSPPP----PSPPPPSPPPSP 1750

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 45/102 (44%), Positives = 48/102 (47%), Gaps = 9/102 (8%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN------SPPPP 197
            PPP   P P     +PP P     PPPP   SPS     +SPPPP          +PPPP
Sbjct: 1671 PPPPSPPLPSPPLPAPPPPS----PPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPP 1726

Query: 198  YYSPS--PKVYYKSPPPPSYY-SPSPKVEYKSPPPPSYSPSP 314
               P   P     SPPPPS   SP P     SPPPPS SPSP
Sbjct: 1727 LPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSP 1768

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/95 (42%), Positives = 42/95 (44%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            SPPPP   P P      PP P     PPP P  SP P     +PPPP    +PPPP   P
Sbjct: 834  SPPPPL-PPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPP----APPPPAPPP 888

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SP      P PP    P P     SPPPP   P P
Sbjct: 889  SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 923

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 42/94 (44%), Positives = 43/94 (45%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP   PSP      PP P     P PPP   P P     +PPPP    SPPPP   P 
Sbjct: 960  PPPPSPPPSP------PPSPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLPP 1009

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPP    P P      PPPPS  PSP
Sbjct: 1010 PP----SPPPP--LPPPPLPPPPLPPPPSPPPSP 1037

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/95 (42%), Positives = 42/95 (44%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            SPPPP   P P      PP P     PPP P  SP P     +PPPP    +PPPP   P
Sbjct: 1012 SPPPPL-PPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPP----APPPPAPPP 1066

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SP      P PP    P P     SPPPP   P P
Sbjct: 1067 SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 1101

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 43/95 (45%), Positives = 43/95 (45%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            SPPPP   P        PP P     P PPP   PSP      PPPP    SPPPP   P
Sbjct: 1565 SPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPP----SPPPPL--P 1618

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P V    PPPP   SP P      PPPPS  PSP
Sbjct: 1619 PPPV----PPPP---SPPPLPPPPLPPPPSPPPSP 1646

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 41/95 (43%), Positives = 43/95 (45%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            SPPP    P+P      PP P     P PPP   P P     +PPPP    SPPPP   P
Sbjct: 775  SPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLP 830

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P     SPPPP    P P      PPPPS  PSP
Sbjct: 831  PPP----SPPPP--LPPPPLPPPPLPPPPSPPPSP 859

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 41/95 (43%), Positives = 43/95 (45%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            SPPP    P+P      PP P     P PPP   P P     +PPPP    SPPPP   P
Sbjct: 1044 SPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLP 1099

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P     SPPPP    P P      PPPPS  PSP
Sbjct: 1100 PPP----SPPPP--LPPPPLPPPPLPPPPSPPPSP 1128

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 45/105 (42%), Positives = 45/105 (42%), Gaps = 3/105 (2%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
            SP     SPPPP  SP P      PP P     PP PP   P P V     PPP    SP
Sbjct: 1533 SPSPPPPSPPPPSPSPPPS---PPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSP 1589

Query: 189  ---PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
               PPP   PSP      PPPPS   P P      PPPPS  P P
Sbjct: 1590 PPSPPPSPPPSPPPPLPLPPPPS--PPPPLPPPPVPPPPSPPPLP 1632

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/93 (44%), Positives = 45/93 (48%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            SPPPP   P P      PP P     PPP P  SP P     +PPPP    +PPPP   P
Sbjct: 1103 SPPPPL-PPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPP----APPPPAPPP 1157

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            SP     SPPPP+   P P     +PPPPS  P
Sbjct: 1158 SPP---PSPPPPT--PPPPAPPPPNPPPPSPPP 1185

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/102 (43%), Positives = 47/102 (46%), Gaps = 7/102 (6%)
 Frame = +3

Query: 30   SPPPPYYSP-SPKVYYKSPPHPHVCVCPPP-PPCYSPSPKVVYKSPPPPYVYNSPPP--- 194
            SPPPP   P SP      PP P   V PPP PP   P P      PPPP    SPPP   
Sbjct: 1182 SPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPP 1241

Query: 195  --PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
              P  SP P     +PPPP   +P P     SPPPP+  P P
Sbjct: 1242 PSPPPSPPPSPPPPTPPPP---APPPPTPPPSPPPPTPPPPP 1280

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/94 (38%), Positives = 42/94 (44%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP   PSP      PP P     PP PP  +P P     +PPP    + PP P  SP 
Sbjct: 720 PPPPLPPPSPPP--SPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPP 777

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P     +PPPP+   P+P       PPP   P P
Sbjct: 778 PSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPP 811

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 39/95 (41%), Positives = 43/95 (45%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           +PPPP   P+P      PP P     P PPP   PSP     +PPPP    +PPPP   P
Sbjct: 750 APPPPAPPPAP------PPSPPPSPPPSPPPSPPPSPPP--PTPPPP----APPPPTPPP 797

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           SP      P PP    P P     SPPPP   P P
Sbjct: 798 SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 832

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 39/93 (41%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP   P P      PP P     P PPP   PSP       PPP     P PP  SP 
Sbjct: 1623 PPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPP 1682

Query: 213  -PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
             P     SPPPP+  SPS     +SPPPP   P
Sbjct: 1683 LPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPP 1715

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 41/97 (42%), Positives = 43/97 (44%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   PSP      PP P   + PPP P  SP P       PPP    SPPPP   P
Sbjct: 695 SPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPS------PPPSPPPSPPPP-TPP 747

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            P     +PPP    SP P      PP P  SP P T
Sbjct: 748 PPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPT 784

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/92 (42%), Positives = 43/92 (46%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP   PSP      PP P     PP PP   P P     +PPPP    SPPP    P+
Sbjct: 850  PPPPSPPPSP------PPSP-----PPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPT 898

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     +PPPP+   PSP      PPPPS  P
Sbjct: 899  PPP--PAPPPPNPPPPSPPPPLPLPPPPSPPP 928

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/92 (42%), Positives = 43/92 (46%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP   PSP      PP P     PP PP   P P     +PPPP    SPPP    P+
Sbjct: 1028 PPPPSPPPSP------PPSP-----PPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPT 1076

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     +PPPP+   PSP      PPPPS  P
Sbjct: 1077 PPP--PAPPPPNPPPPSPPPPLPLPPPPSPPP 1106

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 39/92 (42%), Positives = 43/92 (46%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PP P  SP P      PP P     PP PP  +P P     SPPP     SPPPP  +P 
Sbjct: 757 PPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPP-----SPPPP--TPP 809

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           P     +PPPP+   PSP      PPPPS  P
Sbjct: 810 P----PAPPPPNPPPPSPPPPLPLPPPPSPPP 837

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 44/100 (44%), Positives = 46/100 (46%), Gaps = 5/100 (5%)
 Frame = +3

Query: 30   SPPPPYY---SPSPKVYYKSPPHPHVCVCPPP-PPCYSPSPKVVYKSPPPPYVYNSPPP- 194
            SPPPP      PSP      PP P   V PPP PP   P P      PPPP    SPPP 
Sbjct: 913  SPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPS 972

Query: 195  PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P  SP P     +PPPP+   P P     SPPPP   P P
Sbjct: 973  PPPSPPPSPPPPTPPPPA--PPPPNPPPPSPPPPLPLPPP 1010

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 41/94 (43%), Positives = 42/94 (44%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP   PSP      PP P     P PPP   P       SPPPP     PP P  SPS
Sbjct: 2124 PPPPTPPPSPPPL-PPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPS 2182

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P      PPPP   SP P    +SP PPS  P P
Sbjct: 2183 PLPPPPIPPPP---SPPPHPPPQSPLPPSPPPPP 2213

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 40/95 (42%), Positives = 42/95 (44%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            SPPP    P+P      PP P     P PPP   P P     +PPPP    SPPPP   P
Sbjct: 866  SPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLP 921

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P     SPPPP    P P      PPPPS  P P
Sbjct: 922  PP----PSPPPP--LPPPPLPPPPVPPPPSPPPLP 950

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 40/96 (41%), Positives = 42/96 (43%), Gaps = 2/96 (2%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP   PSP      PP P     PP PP  +P P     SPPP     +PPPP   P 
Sbjct: 1119 PPPPSPPPSPPP--SPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPP-APPP 1175

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSP--PPPSYSPSP 314
            P     SPPPP    PSP      P  PPP   P P
Sbjct: 1176 PNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPP 1211

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 41/97 (42%), Positives = 42/97 (43%), Gaps = 2/97 (2%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            +PPPP   PSP      PP P     PPP P   P P     SPPPP      PPP   P
Sbjct: 1149 APPPPAPPPSP------PPSPPPPTPPPPAP---PPPNPPPPSPPPPLPPPPSPPPPLPP 1199

Query: 210  SPKVYYKSPPPPSY--YSPSPKVEYKSPPPPSYSPSP 314
             P      PPPPS     P P      PPPPS  PSP
Sbjct: 1200 PPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSP 1236

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 39/100 (39%), Positives = 42/100 (42%), Gaps = 5/100 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPP-----PPPCYSPSPKVVYKSPPPPYVYNSPPP 194
           SPPP    PSP      PP P   + PP     PPP   PSP      PP P     PP 
Sbjct: 700 SPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPA 759

Query: 195 PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P  SP P      PP P    P P     +PPPP+  PSP
Sbjct: 760 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSP 799

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/94 (43%), Positives = 43/94 (45%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PP P  SP P     +PP P     PPPP    PSP      PPPP    SPPPP   P 
Sbjct: 792  PPTPPPSPPPSPPPPTPPPP----APPPPNPPPPSPPPPLPLPPPP----SPPPPL--PP 841

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P +    PPPP    PSP       PPPS  PSP
Sbjct: 842  PPL----PPPPLPPPPSPPPSPPPSPPPSPPPSP 871

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/102 (39%), Positives = 43/102 (42%), Gaps = 7/102 (6%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-------PPYVYNSP 188
            +PPPP   PSP      P  P     PP PP  SP P +    PP       PP +   P
Sbjct: 880  APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP 939

Query: 189  PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             PP  SP P      PPPP    PSP       PPPS  PSP
Sbjct: 940  VPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 981

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/94 (43%), Positives = 43/94 (45%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PP P  SP P     +PP P     PPPP    PSP      PPPP    SPPPP   P 
Sbjct: 970  PPSPPPSPPPSPPPPTPPPP----APPPPNPPPPSPPPPLPLPPPP----SPPPPL--PP 1019

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P +    PPPP    PSP       PPPS  PSP
Sbjct: 1020 PPL----PPPPLPPPPSPPPSPPPSPPPSPPPSP 1049

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/94 (43%), Positives = 43/94 (45%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PP P  SP P     +PP P     PPPP    PSP      PPPP    SPPPP   P 
Sbjct: 1061 PPAPPPSPPPSPPPPTPPPP----APPPPNPPPPSPPPPLPLPPPP----SPPPPL--PP 1110

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P +    PPPP    PSP       PPPS  PSP
Sbjct: 1111 PPL----PPPPLPPPPSPPPSPPPSPPPSPPPSP 1140

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/96 (42%), Positives = 44/96 (45%), Gaps = 1/96 (1%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPP-PPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
            SPPP    P+P      PP+P     PPP PP  SP P +     PPP V   P PP   
Sbjct: 1158 SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLP 1217

Query: 207  PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P P      PPPPS   PSP       PPPS  PSP
Sbjct: 1218 PPPLPPPPLPPPPSP-PPSPPPSPPPSPPPSPPPSP 1252

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 39/95 (41%), Positives = 42/95 (44%), Gaps = 2/95 (2%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPP-PPPCYSPSPKVVYKSPPPPYVYNSPPP-PYYSP 209
            PPP   P P     SPP P     PP PPP   P P      PPPP    SPPP P  SP
Sbjct: 808  PPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 867

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P     +PPPP+   P+P       PPP   P P
Sbjct: 868  PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPP 902

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 42/102 (41%), Positives = 46/102 (45%), Gaps = 7/102 (6%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPPYVYNSPP 191
            +PPPP  SP P +    PP P   + PPP      PP  SP P      PPPP     PP
Sbjct: 908  NPPPP--SPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPL----PP 961

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP-PPSYSPSP 314
            PP   PSP       PPPS   P+P      PP PP  SP P
Sbjct: 962  PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPP 1003

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 39/95 (41%), Positives = 42/95 (44%), Gaps = 2/95 (2%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPP-PPPCYSPSPKVVYKSPPPPYVYNSPPP-PYYSP 209
            PPP   P P     SPP P     PP PPP   P P      PPPP    SPPP P  SP
Sbjct: 986  PPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 1045

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P     +PPPP+   P+P       PPP   P P
Sbjct: 1046 PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPP 1080

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 39/95 (41%), Positives = 42/95 (44%), Gaps = 2/95 (2%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPP-PPPCYSPSPKVVYKSPPPPYVYNSPPP-PYYSP 209
            PPP   P P     SPP P     PP PPP   P P      PPPP    SPPP P  SP
Sbjct: 1077 PPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 1136

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P     +PPPP+   P+P       PPP   P P
Sbjct: 1137 PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPP 1171

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/94 (43%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP 215
            PPP   PSP     SPP P      PPPP   PSP     SPPPP      PPP   P P
Sbjct: 1128 PPPSPPPSPP---PSPPPPTPPPPAPPPPAPPPSPP---PSPPPPTPPPPAPPPPNPPPP 1181

Query: 216  KVYYKSPPPPSYYSPSPKVEYKSPP-PPSYSPSP 314
                  PPPPS   P P      PP PP  SP P
Sbjct: 1182 SPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPP 1215

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 39/93 (41%), Positives = 40/93 (43%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP 215
            PPP   PSP      PP P     PPP P  SP P     +PPPP      PPP   P P
Sbjct: 1132 PPPSPPPSPPPPTPPPPAP-----PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPP 1186

Query: 216  KVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                 SPPPP    P P      PPPPS  P P
Sbjct: 1187 LPPPPSPPPP--LPPPPLPPPPVPPPPSPPPLP 1217

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 40/99 (40%), Positives = 44/99 (44%), Gaps = 4/99 (4%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPP----PPCYSPSPKVVYKSPPPPYVYNSPPPP 197
            SPPP    P+P      PP+P     PPP    PP   P P      PPPP     PPPP
Sbjct: 798  SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPL----PPPP 853

Query: 198  YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
               PSP       PPPS   P P     +PPPP+  PSP
Sbjct: 854  SPPPSPPPSPPPSPPPS--PPPPTPPPPAPPPPAPPPSP 890

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 40/99 (40%), Positives = 44/99 (44%), Gaps = 4/99 (4%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPP----PPCYSPSPKVVYKSPPPPYVYNSPPPP 197
            SPPP    P+P      PP+P     PPP    PP   P P      PPPP     PPPP
Sbjct: 976  SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPL----PPPP 1031

Query: 198  YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
               PSP       PPPS   P P     +PPPP+  PSP
Sbjct: 1032 SPPPSPPPSPPPSPPPS--PPPPTPPPPAPPPPAPPPSP 1068

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 40/99 (40%), Positives = 44/99 (44%), Gaps = 4/99 (4%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPP----PPCYSPSPKVVYKSPPPPYVYNSPPPP 197
            SPPP    P+P      PP+P     PPP    PP   P P      PPPP     PPPP
Sbjct: 1067 SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPL----PPPP 1122

Query: 198  YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
               PSP       PPPS   P P     +PPPP+  PSP
Sbjct: 1123 SPPPSPPPSPPPSPPPS--PPPPTPPPPAPPPPAPPPSP 1159

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 44/101 (43%), Positives = 47/101 (46%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P +   SP PP   PSP +    PP P   V PPP P  SP P      PPPP    SPP
Sbjct: 2095 PSLPSSSPSPP--PPSPPLPPSPPPLPPPPVPPPPTPPPSPPP-----LPPPPTPPPSPP 2147

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P    P P    +SPP PS   PSP      PPP   SPSP
Sbjct: 2148 P--LPPPPTPPPQSPPLPSPPPPSPPTPPPLPPP---SPSP 2183

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 42/101 (41%), Positives = 43/101 (42%), Gaps = 6/101 (5%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            SPPP   S SP     SPP P   + P PPP   P P V     PPP     PPPP   P
Sbjct: 2092 SPPPSLPSSSP-----SPPPPSPPLPPSPPPL--PPPPVPPPPTPPPSPPPLPPPPTPPP 2144

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSP------PPPSYSPSP 314
            SP      P PP    P P     SP      PPPS SP P
Sbjct: 2145 SPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLP 2185

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 41/91 (45%), Positives = 44/91 (48%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP 215
            PPP   PSP     SPP P      PPPP   PSP     SPPPP    +PPPP  +P P
Sbjct: 859  PPPSPPPSPP---PSPPPPTPPPPAPPPPAPPPSPP---PSPPPP----TPPPP--APPP 906

Query: 216  KVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
                 +PPPPS   P P     SPPPP   P
Sbjct: 907  ----PNPPPPSPPPPLPLPPPPSPPPPLPPP 933

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 38/92 (41%), Positives = 42/92 (45%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP   P        PP P   + PPP P  SP P       PPP    SPPPP  +P 
Sbjct: 936  PPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPS------PPPSPPPSPPPP--TPP 987

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     +PPPP+   PSP      PPPPS  P
Sbjct: 988  P----PAPPPPNPPPPSPPPPLPLPPPPSPPP 1015

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 40/96 (41%), Positives = 42/96 (43%), Gaps = 2/96 (2%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP   PS      SPP P   + P PPP   P P V     PPP     PPPP   PS
Sbjct: 2088 PPPPSPPPSLPSSSPSPPPPSPPLPPSPPPL--PPPPVPPPPTPPPSPPPLPPPPTPPPS 2145

Query: 213  PKVYYK--SPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P       +PPP S   PSP       PPP   PSP
Sbjct: 2146 PPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSP 2181

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 40/100 (40%), Positives = 43/100 (43%), Gaps = 3/100 (3%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPP---PPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
            SPPP    P+P      PP+P     PPP   PP  SP P +     PPP V   PPPP 
Sbjct: 889  SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPV---PPPPS 945

Query: 201  YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
              P P      PP P   SP P      PP P  SP P T
Sbjct: 946  PPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPT 985

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 41/93 (44%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPP-PPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            PPPP   P P      PP P     PP PPP   PSP     SPPPP    +PPPP  +P
Sbjct: 941  PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPP---PSPPPP----TPPPP--AP 991

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
             P     +PPPPS   P P     SPPPP   P
Sbjct: 992  PP----PNPPPPSPPPPLPLPPPPSPPPPLPPP 1020

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 41/87 (47%), Positives = 42/87 (48%)
 Frame = +3

Query: 54   PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKS 233
            PSP     SPP P      PPPP  SP P     SPPPP    SPPPP  SP P +    
Sbjct: 1532 PSP-----SPPPPS-----PPPPSPSPPP-----SPPPPSPPPSPPPP--SPPPPL---- 1570

Query: 234  PPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PPPP   SP P       PPPS  PSP
Sbjct: 1571 PPPPVPPSPLPPPSPPPSPPPSPPPSP 1597

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 40/94 (42%), Positives = 40/94 (42%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PP P   PSP       P P     PPPP    P P      PPPP     PPPP  SP 
Sbjct: 1576 PPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPV----PPPP--SPP 1629

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P      PPPPS   PSP       PPPS  PSP
Sbjct: 1630 PLPPPPLPPPPS-PPPSPPPSPPPSPPPSPPPSP 1662

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 40/101 (39%), Positives = 42/101 (41%), Gaps = 7/101 (6%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP-------PPPYVYNSPP 191
            PP P  SP P     +PP P     PPPP    PSP      P       PPP +   P 
Sbjct: 1152 PPAPPPSPPPSPPPPTPPPP----APPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPV 1207

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP  SP P      PPPP    PSP       PPPS  PSP
Sbjct: 1208 PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 1248

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 42/94 (44%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +3

Query: 33   PPPPYYSP-SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            PPPP   P SP +    PP P     P PPP   PSP  +   PPPP     PPPP  SP
Sbjct: 2150 PPPPTPPPQSPPLPSPPPPSP-----PTPPPLPPPSPSPL---PPPPI----PPPP--SP 2195

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
             P    +SP PPS   P P      PPPPS  PS
Sbjct: 2196 PPHPPPQSPLPPS--PPPPPPPPPLPPPPSPPPS 2227

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/90 (40%), Positives = 37/90 (41%), Gaps = 1/90 (1%)
 Frame = +3

Query: 30   SPPPPYYSPS-PKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
            SPPPP   P  P      PP P     PP PP   P P     SPPP    + PP P  S
Sbjct: 1192 SPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPS 1251

Query: 207  PSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            P P       PPP    PSP      PPPP
Sbjct: 1252 PPPPTPPPPAPPPPTPPPSPPPPTPPPPPP 1281

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 40/88 (45%), Positives = 42/88 (47%)
 Frame = +3

Query: 51  SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYK 230
           +PSP     SPP P      PPPP  SP P     SPPPP    SPPPP  SP P +   
Sbjct: 675 APSP-----SPPPPS-----PPPPSPSPPP-----SPPPPSPPPSPPPP--SPPPPLPPP 717

Query: 231 SPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             PPP    PSP       PPPS  PSP
Sbjct: 718 PLPPPPLPPPSP----PPSPPPSPPPSP 741

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 37/95 (38%), Positives = 42/95 (44%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            SPPP    P P      PP P     P PPP   PSP     SPPPP    +PPPP  +P
Sbjct: 1212 SPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPP---PSPPPP----TPPPP--AP 1262

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P     SPPPP+   P P   +      S S +P
Sbjct: 1263 PPPTPPPSPPPPTPPPPPPLAPFTCEDRASRSLAP 1297

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/102 (38%), Positives = 40/102 (39%), Gaps = 7/102 (6%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPPPPPC-------YSPSPKVVYKSPPPPYVYNSPPP 194
            PPP   P P     SPP P     PPPP          SP P      PPPP      PP
Sbjct: 1178 PPPPSPPPPLPPPPSPPPP----LPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPP 1233

Query: 195  PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            P   PSP       PPPS   P+P      PP P  SP P T
Sbjct: 1234 PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPPT 1275

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 37/98 (37%), Positives = 41/98 (41%), Gaps = 1/98 (1%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS-PPPPYYS 206
           SPPPP +SPSP     SP  P     P PPP   P P     SPPPP      PPPP   
Sbjct: 349 SPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPLPPPPIPPPPSPP 408

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           P P      PPP + ++          P    S SP T
Sbjct: 409 PPP------PPPLAPFTCEDLASRSLAPHGCTSVSPFT 440

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 37/96 (38%), Positives = 43/96 (44%), Gaps = 3/96 (3%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP---PPPYVYNSPPPPYY 203
            P PP   P P    +SPP P     PPPP   +P P +   SP   PPP +   P PP +
Sbjct: 2144 PSPPPLPPPPTPPPQSPPLPS----PPPPSPPTP-PPLPPPSPSPLPPPPIPPPPSPPPH 2198

Query: 204  SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
             P       SPPPP    P P +     PPPS  PS
Sbjct: 2199 PPPQSPLPPSPPPP---PPPPPLPPPPSPPPSQPPS 2231

[129][TOP]
>UniRef100_Q94ES4 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES4_PEA
          Length = 120

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 55/121 (45%), Positives = 61/121 (50%), Gaps = 26/121 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPPHPHV----CVCPPPPPCYS-PSPKVVYKSPPPP- 170
           P  Y   PPPP ++ P P   Y SPP PH        PPPPP ++ P P  VY SPPPP 
Sbjct: 6   PYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPP 65

Query: 171 ------YVYNSPPPP-------------YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
                 Y Y SPPPP             Y+SP P VY  SPPPP+YY       YKSPPP
Sbjct: 66  TPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVY--SPPPPAYY-------YKSPPP 116

Query: 294 P 296
           P
Sbjct: 117 P 117

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 35/84 (41%), Positives = 41/84 (48%), Gaps = 7/84 (8%)
 Frame = +3

Query: 84  PH--PHVCVCPPPPPCYS-PSPKVVYKSPPPP----YVYNSPPPPYYSPSPKVYYKSPPP 242
           PH  P+    PPPPP ++ P P  VY SPPPP    Y Y+SPPPP     P       P 
Sbjct: 2   PHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPH------PH 55

Query: 243 PSYYSPSPKVEYKSPPPPSYSPSP 314
           P Y+SP        PPPP+    P
Sbjct: 56  PVYHSP--------PPPPTPHKKP 71

[130][TOP]
>UniRef100_Q76KW4 Hydroxyproline-rich glycoprotein-1 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW4_PEA
          Length = 152

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/104 (45%), Positives = 53/104 (50%), Gaps = 9/104 (8%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS-PSPKVVYKSPPPPY--------V 176
           Y SPPPP +SP P      P  P+    PPPPP ++ P P  VY SPPPP         V
Sbjct: 35  YSSPPPPVHSPPP------PKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPVHTYPHPHPV 88

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           Y+SPPPP     P  Y   PPPP +  P P   Y SPPPP   P
Sbjct: 89  YHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKP 132

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 43/109 (39%), Positives = 49/109 (44%), Gaps = 11/109 (10%)
 Frame = +3

Query: 21  YYKSPPPP-----------YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP 167
           +Y SPPPP           Y+SP P V+  + PHPH     PPPP     P   YK P P
Sbjct: 53  HYSSPPPPPAHTYPHPHPVYHSPPPPVH--TYPHPHPVYHSPPPPTPHKKP---YKYPSP 107

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P     PPP +  P P   Y SPPPP         +Y SPPPP     P
Sbjct: 108 P-----PPPVHTYPHPHPVYHSPPPPH----KKPYKYSSPPPPPVHTYP 147

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 33/70 (47%), Positives = 38/70 (54%), Gaps = 2/70 (2%)
 Frame = +3

Query: 111 PPPPCYSPSPKVVYKSPPPPYVYNSPPPP--YYSPSPKVYYKSPPPPSYYSPSPKVEYKS 284
           PPPP +SP P      P  PY Y+SPPPP  +  P P   Y SPPPP +  P P   Y S
Sbjct: 38  PPPPVHSPPP------PKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPVHTYPHPHPVYHS 91

Query: 285 PPPPSYSPSP 314
           PPPP+    P
Sbjct: 92  PPPPTPHKKP 101

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/84 (46%), Positives = 45/84 (53%), Gaps = 16/84 (19%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPP------HPHVCVCPPPPPCYS-PSPKVVYKSPPP 167
           P   Y SPPPP ++ P P   Y SPP       P+    PPPPP ++ P P  VY SPPP
Sbjct: 68  PHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPP 127

Query: 168 ----PYVYNSPPPP----YYSPSP 215
               PY Y+SPPPP    Y  PSP
Sbjct: 128 PHKKPYKYSSPPPPPVHTYPHPSP 151

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 26/57 (45%), Positives = 32/57 (56%), Gaps = 5/57 (8%)
 Frame = +3

Query: 171 YVYNSPPPPYYSPSPKV----YYKSPPPPSYYSPSPKVEYKSPPPPSYS-PSPKTEY 326
           Y Y+SPPPP +SP P      Y   PPPP++  P P   Y SPPPP ++ P P   Y
Sbjct: 33  YSYSSPPPPVHSPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPVHTYPHPHPVY 89

[131][TOP]
>UniRef100_UPI00001631D5 LRX2 (LEUCINE-RICH REPEAT/EXTENSIN 2); protein binding / structural
           constituent of cell wall n=1 Tax=Arabidopsis thaliana
           RepID=UPI00001631D5
          Length = 826

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 55/122 (45%), Positives = 61/122 (50%), Gaps = 16/122 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY----SPSPKVVYKSPPPP-- 170
           S K Y   PPPP Y PSP     S   P V   PPPPP      SP P  +Y SPPPP  
Sbjct: 496 SVKAYPPPPPPPEYEPSPPPP-SSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554

Query: 171 -----YVYNSPPPPYYSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSY----SPSPKT 320
                Y+Y+SPPP    P      +SPPPP Y  +PSP+  Y SP PP Y    SP P T
Sbjct: 555 SPPPPYIYSSPPPVVNCPPTT---QSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPT 611

Query: 321 EY 326
            Y
Sbjct: 612 YY 613

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 60/134 (44%), Positives = 65/134 (48%), Gaps = 30/134 (22%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP-----PPPCY--SPSPKVVYKSPPPP 170
           P   Y SPPPP  SP P   Y SPP   V  CPP     PPP Y  +PSP+  Y SP PP
Sbjct: 542 PPYIYSSPPPPSPSPPPPYIYSSPPP--VVNCPPTTQSPPPPKYEQTPSPREYYPSPSPP 599

Query: 171 YV-YNS--PPPPYYS------PSPKVYY----KSPPPPSYY------SPSPKVEY----K 281
           Y  Y S  PPP YY+      P P  YY      PPPP YY       P P V Y    +
Sbjct: 600 YYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQ 659

Query: 282 SPPPPSYSPSPKTE 323
           SPPPP    SP T+
Sbjct: 660 SPPPPPVYYSPVTQ 673

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 65/154 (42%), Positives = 69/154 (44%), Gaps = 57/154 (37%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYY----SPSPKVYY----------------KSPP------HPHVCVCP 110
            SP+ YY SP PPYY    SP P  YY                +SPP      +P V   P
Sbjct: 588  SPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASP 647

Query: 111  PPPPCY------SPSPKVVYKSP------PPPYVYNSP----PPP---YY------SPSP 215
            PPPP Y      SP P  VY SP      PPP VY  P    PPP   YY       P P
Sbjct: 648  PPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPP 707

Query: 216  KVYY----KSPPPPS--YYSPSPKVEYKSPPPPS 299
             VYY    +SPPPPS  YY P      KSPPPPS
Sbjct: 708  PVYYLPVTQSPPPPSPVYYPPVA----KSPPPPS 737

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 53/122 (43%), Positives = 60/122 (49%), Gaps = 18/122 (14%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP----P 170
           RA P     SPPPP           SPP P++    PPPP  SP P  +Y SPPP    P
Sbjct: 525 RAYPPPPPLSPPPP-----------SPPPPYI-YSSPPPPSPSPPPPYIYSSPPPVVNCP 572

Query: 171 YVYNSPPPPYY--SPSPKVYYKSPPPPSYY---SPSPKVEYKS-----PPPPSY----SP 308
               SPPPP Y  +PSP+ YY SP PP Y    SP P   Y +     PPPP+Y    SP
Sbjct: 573 PTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSP 632

Query: 309 SP 314
            P
Sbjct: 633 PP 634

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 59/141 (41%), Positives = 69/141 (48%), Gaps = 36/141 (25%)
 Frame = +3

Query: 12   PKVYY----KSPPPP--YYSP-------SPKVYY----KSPP-----HPHVCVCPPPPPC 125
            P VYY    +SPPPP  YYSP        P VYY    +SPP     +P V   PPPPP 
Sbjct: 650  PPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPV 709

Query: 126  YSPSPKVVYKSPPPPYVYNSPPPPYYSPSPK-VYY----KSPPPPS----YYSP-----S 263
            Y      V +SPPPP     PP     P P  VYY    +SPPPPS    Y+ P     S
Sbjct: 710  YYLP---VTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQS 766

Query: 264  PKVEYKSPPPPSYSPSPKTEY 326
            P  EY+SPPP   + SP  ++
Sbjct: 767  PPPEYQSPPPKGCNDSPSNDH 787

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/109 (45%), Positives = 54/109 (49%), Gaps = 10/109 (9%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP-----PPPPCYSPSPKV-VYKSPPPPYVYN-SP 188
           +PPPP    SP  +  +PP P   + P     PPPP    SP V  Y  PPPP  Y  SP
Sbjct: 455 TPPPPSSKMSPS-FRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSP 513

Query: 189 PPPYYSPSPKVYYKSPPPP-SYYSPSPKVE--YKSPPPPSYSPSPKTEY 326
           PPP    SP V    PPPP S   PSP     Y SPPPPS SP P   Y
Sbjct: 514 PPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIY 562

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 50/126 (39%), Positives = 54/126 (42%), Gaps = 25/126 (19%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY----SPSPKVVY--KSPPP 167
           +SP      PP     P PK  Y+  P P      P PP Y    SP P   Y  +SPPP
Sbjct: 563 SSPPPVVNCPPTTQSPPPPK--YEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPP 620

Query: 168 P-----YVYNSPPPP---YY------SPSPKVYY-----KSPPPPSYYSPSPKVEYKSPP 290
           P     Y   SPPPP   YY       P P VYY       PPPP YY  SP  +   PP
Sbjct: 621 PPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYY--SPVTQSPPPP 678

Query: 291 PPSYSP 308
           PP Y P
Sbjct: 679 PPVYYP 684

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 45/115 (39%), Positives = 48/115 (41%), Gaps = 20/115 (17%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP-----PPPPCYSPSPKVVYKSPPP-----PYVY 179
           SPPPP +  SP V    PP P   + P     PPPP    SP      PPP     P   
Sbjct: 424 SPPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFR 483

Query: 180 NSPPPPYYSPSPKVY-YKSPPPPSYYSPSP---------KVEYKSPPPPSYSPSP 314
            +PPPP    SP V  Y  PPPP  Y PSP          V    PPPP   P P
Sbjct: 484 ATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPP 538

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 52/122 (42%), Positives = 59/122 (48%), Gaps = 26/122 (21%)
 Frame = +3

Query: 12   PKVYY----KSPPPP---YYSPSPKVYYKSPPHPHVCVCPP----PPPCYSP----SPKV 146
            P VYY    +SPPPP   YY P  K    SPP P     PP    PPP  +P     P  
Sbjct: 707  PPVYYLPVTQSPPPPSPVYYPPVAK----SPPPPSPVYYPPVTQSPPPPSTPVEYHPPAS 762

Query: 147  VYKSPPPPYVYNSPPPP--YYSPSPKVYYKSPPPPS----YYSPSP-----KVEYKSPPP 293
              +SPPP Y   SPPP     SPS   +Y++P PPS    YY  +P      V Y SPPP
Sbjct: 763  PNQSPPPEY--QSPPPKGCNDSPSNDHHYQTPTPPSLPPPYYEDTPLPPIRGVSYASPPP 820

Query: 294  PS 299
            PS
Sbjct: 821  PS 822

[132][TOP]
>UniRef100_Q40793 Tyrosine-rich hydroxyproline-rich glycoprotein (Fragment) n=1
           Tax=Petroselinum crispum RepID=Q40793_PETCR
          Length = 259

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 45/81 (55%), Positives = 45/81 (55%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y SPPPP  SP P  YY SPP P   V  PPPP Y  SP    KSPPPPY Y SPPPP  
Sbjct: 1   YHSPPPPVKSPPPPYYYSSPPPP---VKSPPPPYYYTSPPPPVKSPPPPYYYTSPPPP-- 55

Query: 204 SPSPKVYYKSPPPPSYYSPSP 266
                   KSPPPP Y  P P
Sbjct: 56  -------MKSPPPPYYPHPHP 69

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 39/63 (61%), Positives = 41/63 (65%)
 Frame = +3

Query: 126 YSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           +SP P V  KSPPPPY Y+SPPPP  SP P  YY SPPPP   SP P   Y SPPPP  S
Sbjct: 2   HSPPPPV--KSPPPPYYYSSPPPPVKSPPPPYYYTSPPPP-VKSPPPPYYYTSPPPPMKS 58

Query: 306 PSP 314
           P P
Sbjct: 59  PPP 61

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 41/68 (60%), Positives = 42/68 (61%)
 Frame = +3

Query: 111 PPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP 290
           PPPP  SP P   Y SPPPP    SPPPPYY  SP    KSPPPP YY+ SP    KSPP
Sbjct: 4   PPPPVKSPPPPYYYSSPPPPV--KSPPPPYYYTSPPPPVKSPPPPYYYT-SPPPPMKSPP 60

Query: 291 PPSYSPSP 314
           PP Y P P
Sbjct: 61  PP-YYPHP 67

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 29/50 (58%), Positives = 30/50 (60%)
 Frame = +3

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           Y+SPPPP  SP P  YY SPPPP   SP P   Y SPPPP  SP P   Y
Sbjct: 1   YHSPPPPVKSPPPPYYYSSPPPP-VKSPPPPYYYTSPPPPVKSPPPPYYY 49

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 37/95 (38%), Positives = 40/95 (42%), Gaps = 1/95 (1%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           A  KV  KS      S  P  Y    P+           CY P P       PP Y Y S
Sbjct: 174 AKLKVKSKSKYEVVLSAKPFAYAPKTPYKK---------CYKPVPTPAAPLTPP-YYYQS 223

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSP-KVEYKSP 287
           PPPP  SP+P  YY   PPP   SP+P    YKSP
Sbjct: 224 PPPPSKSPAPTPYYYKSPPPPTKSPAPTPYYYKSP 258

[133][TOP]
>UniRef100_O48809 F24O1.18 n=1 Tax=Arabidopsis thaliana RepID=O48809_ARATH
          Length = 786

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 55/122 (45%), Positives = 61/122 (50%), Gaps = 16/122 (13%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY----SPSPKVVYKSPPPP-- 170
           S K Y   PPPP Y PSP     S   P V   PPPPP      SP P  +Y SPPPP  
Sbjct: 456 SVKAYPPPPPPPEYEPSPPPP-SSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 514

Query: 171 -----YVYNSPPPPYYSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSY----SPSPKT 320
                Y+Y+SPPP    P      +SPPPP Y  +PSP+  Y SP PP Y    SP P T
Sbjct: 515 SPPPPYIYSSPPPVVNCPPTT---QSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPT 571

Query: 321 EY 326
            Y
Sbjct: 572 YY 573

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 60/134 (44%), Positives = 65/134 (48%), Gaps = 30/134 (22%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP-----PPPCY--SPSPKVVYKSPPPP 170
           P   Y SPPPP  SP P   Y SPP   V  CPP     PPP Y  +PSP+  Y SP PP
Sbjct: 502 PPYIYSSPPPPSPSPPPPYIYSSPPP--VVNCPPTTQSPPPPKYEQTPSPREYYPSPSPP 559

Query: 171 YV-YNS--PPPPYYS------PSPKVYY----KSPPPPSYY------SPSPKVEY----K 281
           Y  Y S  PPP YY+      P P  YY      PPPP YY       P P V Y    +
Sbjct: 560 YYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQ 619

Query: 282 SPPPPSYSPSPKTE 323
           SPPPP    SP T+
Sbjct: 620 SPPPPPVYYSPVTQ 633

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 65/154 (42%), Positives = 69/154 (44%), Gaps = 57/154 (37%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY----SPSPKVYY----------------KSPP------HPHVCVCP 110
           SP+ YY SP PPYY    SP P  YY                +SPP      +P V   P
Sbjct: 548 SPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASP 607

Query: 111 PPPPCY------SPSPKVVYKSP------PPPYVYNSP----PPP---YY------SPSP 215
           PPPP Y      SP P  VY SP      PPP VY  P    PPP   YY       P P
Sbjct: 608 PPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPP 667

Query: 216 KVYY----KSPPPPS--YYSPSPKVEYKSPPPPS 299
            VYY    +SPPPPS  YY P      KSPPPPS
Sbjct: 668 PVYYLPVTQSPPPPSPVYYPPVA----KSPPPPS 697

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 53/122 (43%), Positives = 60/122 (49%), Gaps = 18/122 (14%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP----P 170
           RA P     SPPPP           SPP P++    PPPP  SP P  +Y SPPP    P
Sbjct: 485 RAYPPPPPLSPPPP-----------SPPPPYI-YSSPPPPSPSPPPPYIYSSPPPVVNCP 532

Query: 171 YVYNSPPPPYY--SPSPKVYYKSPPPPSYY---SPSPKVEYKS-----PPPPSY----SP 308
               SPPPP Y  +PSP+ YY SP PP Y    SP P   Y +     PPPP+Y    SP
Sbjct: 533 PTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSP 592

Query: 309 SP 314
            P
Sbjct: 593 PP 594

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 59/141 (41%), Positives = 69/141 (48%), Gaps = 36/141 (25%)
 Frame = +3

Query: 12   PKVYY----KSPPPP--YYSP-------SPKVYY----KSPP-----HPHVCVCPPPPPC 125
            P VYY    +SPPPP  YYSP        P VYY    +SPP     +P V   PPPPP 
Sbjct: 610  PPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPV 669

Query: 126  YSPSPKVVYKSPPPPYVYNSPPPPYYSPSPK-VYY----KSPPPPS----YYSP-----S 263
            Y      V +SPPPP     PP     P P  VYY    +SPPPPS    Y+ P     S
Sbjct: 670  YYLP---VTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQS 726

Query: 264  PKVEYKSPPPPSYSPSPKTEY 326
            P  EY+SPPP   + SP  ++
Sbjct: 727  PPPEYQSPPPKGCNDSPSNDH 747

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/109 (45%), Positives = 54/109 (49%), Gaps = 10/109 (9%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP-----PPPPCYSPSPKV-VYKSPPPPYVYN-SP 188
           +PPPP    SP  +  +PP P   + P     PPPP    SP V  Y  PPPP  Y  SP
Sbjct: 415 TPPPPSSKMSPS-FRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSP 473

Query: 189 PPPYYSPSPKVYYKSPPPP-SYYSPSPKVE--YKSPPPPSYSPSPKTEY 326
           PPP    SP V    PPPP S   PSP     Y SPPPPS SP P   Y
Sbjct: 474 PPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIY 522

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 50/126 (39%), Positives = 54/126 (42%), Gaps = 25/126 (19%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY----SPSPKVVY--KSPPP 167
           +SP      PP     P PK  Y+  P P      P PP Y    SP P   Y  +SPPP
Sbjct: 523 SSPPPVVNCPPTTQSPPPPK--YEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPP 580

Query: 168 P-----YVYNSPPPP---YY------SPSPKVYY-----KSPPPPSYYSPSPKVEYKSPP 290
           P     Y   SPPPP   YY       P P VYY       PPPP YY  SP  +   PP
Sbjct: 581 PPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYY--SPVTQSPPPP 638

Query: 291 PPSYSP 308
           PP Y P
Sbjct: 639 PPVYYP 644

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 45/115 (39%), Positives = 48/115 (41%), Gaps = 20/115 (17%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCP-----PPPPCYSPSPKVVYKSPPP-----PYVY 179
           SPPPP +  SP V    PP P   + P     PPPP    SP      PPP     P   
Sbjct: 384 SPPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFR 443

Query: 180 NSPPPPYYSPSPKVY-YKSPPPPSYYSPSP---------KVEYKSPPPPSYSPSP 314
            +PPPP    SP V  Y  PPPP  Y PSP          V    PPPP   P P
Sbjct: 444 ATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPP 498

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 52/122 (42%), Positives = 59/122 (48%), Gaps = 26/122 (21%)
 Frame = +3

Query: 12   PKVYY----KSPPPP---YYSPSPKVYYKSPPHPHVCVCPP----PPPCYSP----SPKV 146
            P VYY    +SPPPP   YY P  K    SPP P     PP    PPP  +P     P  
Sbjct: 667  PPVYYLPVTQSPPPPSPVYYPPVAK----SPPPPSPVYYPPVTQSPPPPSTPVEYHPPAS 722

Query: 147  VYKSPPPPYVYNSPPPP--YYSPSPKVYYKSPPPPS----YYSPSP-----KVEYKSPPP 293
              +SPPP Y   SPPP     SPS   +Y++P PPS    YY  +P      V Y SPPP
Sbjct: 723  PNQSPPPEY--QSPPPKGCNDSPSNDHHYQTPTPPSLPPPYYEDTPLPPIRGVSYASPPP 780

Query: 294  PS 299
            PS
Sbjct: 781  PS 782

[134][TOP]
>UniRef100_Q41814 Hydroxyproline-rich glycoprotein n=1 Tax=Zea mays
           RepID=Q41814_MAIZE
          Length = 303

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 50/114 (43%), Positives = 57/114 (50%), Gaps = 11/114 (9%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPK     P PP Y+PSPK     PP P      P PP Y+PSPK     P PP    SP
Sbjct: 137 SPKPPTPKPTPPTYTPSPKPPATKPPTPK-----PTPPTYTPSPKPPTPKPTPPTYTPSP 191

Query: 189 PPPYYSPSPKVYYKSPPPPS------YYSPSPKVEYKSPP-----PPSYSPSPK 317
            PP   P+P  Y  SP PP+       Y+PSPK     PP     PP+Y+PSPK
Sbjct: 192 KPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYTPSPK 245

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/119 (42%), Positives = 57/119 (47%), Gaps = 16/119 (13%)
 Frame = +3

Query: 9   SPKVYYKSPP-----PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
           SPK     PP     PP Y+PSPK     PP P      P PP Y+PSPK     P PP 
Sbjct: 153 SPKPPATKPPTPKPTPPTYTPSPK-----PPTP-----KPTPPTYTPSPKPPTPKPTPPT 202

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPS-----------YYSPSPKVEYKSPPPPSYSPSPK 317
              SP PP   P+P  Y  SP PP+            Y+PSPK     P PP+Y+PSPK
Sbjct: 203 YTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPKPSPPTYTPSPK 261

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 46/109 (42%), Positives = 57/109 (52%), Gaps = 4/109 (3%)
 Frame = +3

Query: 3   RASPKVYYKSPPP----PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           + +P  Y  +P P    P  +P+P  Y  SP  P      P PP Y+PSPK     PP P
Sbjct: 108 KPTPPTYTPAPTPHKPTPKPTPTPPTYTPSPKPP---TPKPTPPTYTPSPKPPATKPPTP 164

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
                P PP Y+PSPK     P PP+ Y+PSPK     P PP+Y+PSPK
Sbjct: 165 ----KPTPPTYTPSPKPPTPKPTPPT-YTPSPKPPTPKPTPPTYTPSPK 208

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/107 (43%), Positives = 55/107 (51%), Gaps = 11/107 (10%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-----PPYVYNSPPP 194
           +P PP Y+PSPK     PP P      P PP Y+PSPK     PP     PP    SP P
Sbjct: 128 TPTPPTYTPSPK-----PPTPK-----PTPPTYTPSPKPPATKPPTPKPTPPTYTPSPKP 177

Query: 195 PYYSPSPKVYYKSPPPPS------YYSPSPKVEYKSPPPPSYSPSPK 317
           P   P+P  Y  SP PP+       Y+PSPK     P PP+Y+PSPK
Sbjct: 178 PTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPK 224

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/102 (42%), Positives = 51/102 (50%), Gaps = 4/102 (3%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SPK     P PP Y+PSPK     PP P      P PP Y+PSPK     P PP    SP
Sbjct: 206 SPKPPTPKPTPPTYTPSPKPPATKPPTPK-----PTPPTYTPSPKPPTPKPSPPTYTPSP 260

Query: 189 PPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPPPPSY 302
            PP   P+P  Y  +P PP+     Y+P+P V +   PPP Y
Sbjct: 261 KPPTPKPTPPTYTPTPKPPATKPPTYTPTPPVSHTPSPPPPY 302

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 50/130 (38%), Positives = 61/130 (46%), Gaps = 14/130 (10%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-----P 167
           + +P  Y  SP PP   P+P  Y  SP  P      P PP Y+PSPK     PP     P
Sbjct: 181 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPP---TPKPTPPTYTPSPKPPATKPPTPKPTP 237

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPS------YYSPSPKVEYKSPP---PPSYSPSPKT 320
           P    SP PP   PSP  Y  SP PP+       Y+P+PK     PP   PP+Y+P+P  
Sbjct: 238 PTYTPSPKPPTPKPSPPTYTPSPKPPTPKPTPPTYTPTPK-----PPATKPPTYTPTPPV 292

Query: 321 EY*ISRLPLY 350
            +  S  P Y
Sbjct: 293 SHTPSPPPPY 302

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 45/105 (42%), Positives = 55/105 (52%), Gaps = 10/105 (9%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPP-----PPCYSPSPKVVYKSPPPPYVYNSPPPP 197
           P PP Y+PSPK     P  P     PPP     PP Y+P+P     +P P     +P PP
Sbjct: 83  PTPPTYTPSPK-----PTPPTYTPTPPPTPKPTPPTYTPAPTPHKPTPKP-----TPTPP 132

Query: 198 YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP-----PPSYSPSPK 317
            Y+PSPK     P PP+Y +PSPK     PP     PP+Y+PSPK
Sbjct: 133 TYTPSPKPPTPKPTPPTY-TPSPKPPATKPPTPKPTPPTYTPSPK 176

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/103 (39%), Positives = 52/103 (50%), Gaps = 9/103 (8%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP------PP 197
           PP  + P P+     PP  H     P PP Y+PSPK     P PP    +PP      PP
Sbjct: 66  PPKEHGPKPE----KPPKEH----KPTPPTYTPSPK-----PTPPTYTPTPPPTPKPTPP 112

Query: 198 YYSPSPKVYYKSP---PPPSYYSPSPKVEYKSPPPPSYSPSPK 317
            Y+P+P  +  +P   P P  Y+PSPK     P PP+Y+PSPK
Sbjct: 113 TYTPAPTPHKPTPKPTPTPPTYTPSPKPPTPKPTPPTYTPSPK 155

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 31/73 (42%), Positives = 36/73 (49%), Gaps = 6/73 (8%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-----P 167
           + +P  Y  SP PP   PSP  Y  SP  P      P PP Y+P+PK     PP     P
Sbjct: 234 KPTPPTYTPSPKPPTPKPSPPTYTPSPKPP---TPKPTPPTYTPTPKPPATKPPTYTPTP 290

Query: 168 PYVYN-SPPPPYY 203
           P  +  SPPPPYY
Sbjct: 291 PVSHTPSPPPPYY 303

[135][TOP]
>UniRef100_UPI0000E125D3 Os05g0552600 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E125D3
          Length = 510

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/114 (43%), Positives = 55/114 (48%), Gaps = 10/114 (8%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP------ 164
           ++ P  ++ SPPPP  SP P VY  SPP P     PPPPP YSP P V    PP      
Sbjct: 67  KSPPPPHHDSPPPPRASPPPPVY--SPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPP 124

Query: 165 ----PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
               PP    SPPPP  +  P     SPPPP   SP P V    PP PS  P P
Sbjct: 125 PVSSPPPPVPSPPPPVPTSPPPSPLPSPPPPVPSSPPPPVSSPPPPVPSSPPPP 178

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/102 (49%), Positives = 51/102 (50%), Gaps = 8/102 (7%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSP--PHPHVCVCPPPPPCYSPSPKVVYKSP------PPPYVYNSP 188
           PPPP YSP P V    P  P P   V  PPPP  SP P V    P      PPP V +SP
Sbjct: 101 PPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPPPVPTSPPPSPLPSPPPPVPSSP 160

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP  SP P V   SPPPP   SP P V    PPP   SP P
Sbjct: 161 PPPVSSPPPPV-PSSPPPPVVPSPPPPVLSSPPPPVVASPPP 201

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 51/103 (49%), Positives = 53/103 (51%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           +SP     SPPPP  SP P V   SPP P V   PPP P  SP P V   S PPP V + 
Sbjct: 113 SSPPPPVPSPPPPVSSPPPPV--PSPPPP-VPTSPPPSPLPSPPPPV--PSSPPPPVSSP 167

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP   SP P V   SPPPP   SP P V    PPP   SP P
Sbjct: 168 PPPVPSSPPPPV-VPSPPPPVLSSPPPPVVASPPPPVVPSPPP 209

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 47/116 (40%), Positives = 52/116 (44%), Gaps = 15/116 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP-----PPPCYSPSPKV-------VY 152
           SP     SPPPP  SP P V    PP P     PP     PPP  SP P V       V 
Sbjct: 121 SPPPPVSSPPPPVPSPPPPVPTSPPPSPLPSPPPPVPSSPPPPVSSPPPPVPSSPPPPVV 180

Query: 153 KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP---SPKVEYKSPPPPSYSPS 311
            SPPPP + + PPP   SP P V   SPPPP        + K  Y +   P+Y PS
Sbjct: 181 PSPPPPVLSSPPPPVVASPPPPV-VPSPPPPGASDVVYCTNKTRYPTCTSPAYCPS 235

[136][TOP]
>UniRef100_Q7PNI8 AGAP000892-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=Q7PNI8_ANOGA
          Length = 157

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/105 (42%), Positives = 52/105 (49%), Gaps = 5/105 (4%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP 194
           K  +  PPPP     P+  Y  PP  H    PPPPP Y P P  VY  PPPP  Y  PPP
Sbjct: 39  KEKHHGPPPP-----PRPVY-GPPPVHHAPPPPPPPAYGPPPAPVY-GPPPPQSYGPPPP 91

Query: 195 PYYSPSPKVYYKSPPPP-----SYYSPSPKVEYKSPPPPSYSPSP 314
             Y P P V++  PPPP       Y P P+  Y  PPP  ++P P
Sbjct: 92  QSYGPPPPVHHAPPPPPPPPPRPVYGPPPQQSYGPPPPVHHAPPP 136

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 41/97 (42%), Positives = 47/97 (48%), Gaps = 5/97 (5%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-----YVYNSPPPP 197
           PPPP Y P P   Y  PP       PPPP  Y P P V +  PPPP      VY  PP  
Sbjct: 65  PPPPAYGPPPAPVYGPPPPQSYG--PPPPQSYGPPPPVHHAPPPPPPPPPRPVYGPPPQQ 122

Query: 198 YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            Y P P V++  PPPP    P P+  Y  PPP  ++P
Sbjct: 123 SYGPPPPVHHAPPPPP---PPPPRPVYGPPPPVHHAP 156

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 35/79 (44%), Positives = 37/79 (46%), Gaps = 6/79 (7%)
 Frame = +3

Query: 108 PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP 287
           PPP P Y P P      PPPP  Y  PP P Y P P   Y  PPPP  Y P P V +  P
Sbjct: 47  PPPRPVYGPPPVHHAPPPPPPPAYGPPPAPVYGPPPPQSY-GPPPPQSYGPPPPVHHAPP 105

Query: 288 PPPS------YSPSPKTEY 326
           PPP       Y P P+  Y
Sbjct: 106 PPPPPPPRPVYGPPPQQSY 124

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 36/83 (43%), Positives = 46/83 (55%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y  PPP  Y P P V++  PP P     PPP P Y P P+  Y  PPP  V+++PP
Sbjct: 82  PPQSYGPPPPQSYGPPPPVHHAPPPPPP----PPPRPVYGPPPQQSYGPPPP--VHHAPP 135

Query: 192 PPYYSPSPKVYYKSPPPPSYYSP 260
           PP   P P+  Y  PPPP +++P
Sbjct: 136 PPP-PPPPRPVY-GPPPPVHHAP 156

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 40/103 (38%), Positives = 47/103 (45%), Gaps = 9/103 (8%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPC---------YSPSPKVVYKSPPPPYVYNS 185
           PP P Y P P V++  PP P     PPP P            P P+      PPP V+++
Sbjct: 48  PPRPVYGPPP-VHHAPPPPPPPAYGPPPAPVYGPPPPQSYGPPPPQ---SYGPPPPVHHA 103

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP   P   VY   PPP   Y P P V +  PPPP   P P
Sbjct: 104 PPPPPPPPPRPVY--GPPPQQSYGPPPPVHHAPPPPPPPPPRP 144

[137][TOP]
>UniRef100_B9ILJ5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9ILJ5_POPTR
          Length = 509

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/99 (49%), Positives = 52/99 (52%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           R +P V    PPPP   PSP +   SPP        PPPP YSP P     SPPPP  Y 
Sbjct: 400 RCAPFVPSLPPPPP---PSPPMPVPSPP--------PPPPVYSPPPPPPSSSPPPPIHYK 448

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
            PP P   P P VYY SPPP S   P P V Y SPPPP+
Sbjct: 449 PPPSPSPPPPPAVYYHSPPPLS--PPPPPVIYGSPPPPT 485

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/103 (47%), Positives = 52/103 (50%), Gaps = 5/103 (4%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP +   SPPPP     P VY  SPP P     PPPP  Y P P      PPPP VY   
Sbjct: 415 SPPMPVPSPPPP-----PPVY--SPPPPPPSSSPPPPIHYKPPPSP--SPPPPPAVYYHS 465

Query: 189 PPPYYSPSPKVYYKSPPPPS--YYSPSPK---VEYKSPPPPSY 302
           PPP   P P V Y SPPPP+  Y  P P    V Y SPPPP +
Sbjct: 466 PPPLSPPPPPVIYGSPPPPTPVYEGPLPPITGVSYASPPPPPF 508

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 43/87 (49%), Positives = 48/87 (55%), Gaps = 6/87 (6%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P VY   PPPP  SP P ++YK PP P     PPPP  Y  SP  +   PPPP +Y SPP
Sbjct: 427 PPVYSPPPPPPSSSPPPPIHYKPPPSPSP---PPPPAVYYHSPPPL-SPPPPPVIYGSPP 482

Query: 192 PP---YYSPSPK---VYYKSPPPPSYY 254
           PP   Y  P P    V Y SPPPP +Y
Sbjct: 483 PPTPVYEGPLPPITGVSYASPPPPPFY 509

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/76 (52%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +3

Query: 90  PHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN-SPPPPYYSPSPKVYYKSPPPPSYYSPSP 266
           P V   PPPPP   P P  V   PPPP VY+  PPPP  SP P ++YK PP PS   P P
Sbjct: 403 PFVPSLPPPPPPSPPMP--VPSPPPPPPVYSPPPPPPSSSPPPPIHYKPPPSPS-PPPPP 459

Query: 267 KVEYKSPPPPSYSPSP 314
            V Y SPPP S  P P
Sbjct: 460 AVYYHSPPPLSPPPPP 475

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 30/65 (46%), Positives = 32/65 (49%), Gaps = 1/65 (1%)
 Frame = +3

Query: 135 SPKVVYKSPPPPYVYNSPPPPYYS-PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
           +P V    PPPP    SPP P  S P P   Y  PPPP   SP P + YK PP PS  P 
Sbjct: 402 APFVPSLPPPPP---PSPPMPVPSPPPPPPVYSPPPPPPSSSPPPPIHYKPPPSPSPPPP 458

Query: 312 PKTEY 326
           P   Y
Sbjct: 459 PAVYY 463

[138][TOP]
>UniRef100_UPI0001985257 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001985257
          Length = 448

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/98 (40%), Positives = 51/98 (52%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           YY  PP   +SP P   ++ PP P   + PPPPP   P P    + PPPP   N PPPP+
Sbjct: 8   YYNFPP---FSPPPPPPHRRPPPPPPHINPPPPPHTRPPPPPHTRPPPPPPHINPPPPPH 64

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P P  + + PPPP + +P P    + PPPP   P P
Sbjct: 65  TRPPPPPHRRPPPPPPHINPPPPPHTRPPPPPHTRPPP 102

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 40/92 (43%), Positives = 52/92 (56%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP+ +P P  + + PP PH    PPPPP  +P P    + PPPP+    PPPP+ +P 
Sbjct: 27  PPPPHINPPPPPHTRPPPPPHTRP-PPPPPHINPPPPPHTRPPPPPHRRPPPPPPHINPP 85

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           P  + + PPPP    P P   +  PPPPS SP
Sbjct: 86  PPPHTRPPPPPHTRPPPP--PHVLPPPPSPSP 115

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 31/73 (42%), Positives = 40/73 (54%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP+ +P P  + + PP PH    PPPPP  +P P    + PPPP+    PPPP+  P 
Sbjct: 52  PPPPHINPPPPPHTRPPPPPHRRP-PPPPPHINPPPPPHTRPPPPPHT-RPPPPPHVLPP 109

Query: 213 PKVYYKSPPPPSY 251
           P     SP P S+
Sbjct: 110 P----PSPSPDSH 118

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 30/68 (44%), Positives = 37/68 (54%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P  +   PPPP+  P P   ++ PP P   + PPPPP   P P    + PPPP+V   PP
Sbjct: 53  PPPHINPPPPPHTRPPPPP-HRRPPPPPPHINPPPPPHTRPPPPPHTRPPPPPHVL--PP 109

Query: 192 PPYYSPSP 215
           PP  SPSP
Sbjct: 110 PP--SPSP 115

[139][TOP]
>UniRef100_Q94ES7 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES7_PEA
          Length = 145

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 52/117 (44%), Positives = 62/117 (52%), Gaps = 23/117 (19%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS-PSPKVVYKSPPPP------YVYN 182
           Y SPPPP +SP P      P  P+    PPPPP ++ P P  VY SPPPP      Y Y 
Sbjct: 32  YSSPPPPVHSPPP------PKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPTPHKKPYKYP 85

Query: 183 SPPPP-----------YYSPSP---KVY-YKSPPPPSYYS-PSPKVEYKSPPPPSYS 305
           SPPPP           Y+SP P   K Y Y SPPPP  ++ P P   Y SPPPP+++
Sbjct: 86  SPPPPPAHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPAHT 142

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 43/95 (45%), Positives = 52/95 (54%), Gaps = 15/95 (15%)
 Frame = +3

Query: 21  YYKSPPPP--YYSPSPKVYYKSPP------HPHVCVCPPPPPCYS-PSPKVVYKSPPPP- 170
           +Y SPPPP  +  P P   Y SPP       P+    PPPPP ++ P P  VY SPPPP 
Sbjct: 50  HYSSPPPPPAHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPAHTYPHPHPVYHSPPPPH 109

Query: 171 ---YVYNSPPPP--YYSPSPKVYYKSPPPPSYYSP 260
              Y Y+SPPPP  +  P P   Y SPPPP++  P
Sbjct: 110 KKPYKYSSPPPPPVHTYPHPHPVYHSPPPPAHTYP 144

[140][TOP]
>UniRef100_Q4PSF3 Proline-rich extensin-like family protein n=1 Tax=Arabidopsis
           thaliana RepID=Q4PSF3_ARATH
          Length = 249

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 53/110 (48%), Positives = 55/110 (50%), Gaps = 7/110 (6%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-YSPSPKVYYKSPPHPHVCVCPPPPPCY-SPSPKVVYKSPPPPYVYNS 185
           P V    PPPP   SP P     SPP P V + PPPPP   SP P  V  SPPPP V  S
Sbjct: 56  PPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLS 115

Query: 186 PPPP---YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS--YSPSPKT 320
           PPPP      P P V    PPPP   SP P     SPPPP   +SP P T
Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPT 165

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/103 (47%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY-SPSPKVYYKSPPHPHVCVCPPPPPCY-SPSPKVVYKSPPPPYVYNS 185
           P V    PPPP   SP P     SPP P V + PPPPP   SP P  V  SPPPP V  S
Sbjct: 83  PPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLS 142

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP    SP      PPPP  +SP P    + PPPP+ + SP
Sbjct: 143 PPPPPVLLSP------PPPPVLFSPPPPTVTRPPPPPTITRSP 179

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 53/122 (43%), Positives = 60/122 (49%), Gaps = 21/122 (17%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY-SPSPKVYYKSPPHPHVCVCPPPPPC-YSPSPKVVYKSPPPPYVYNS 185
           P V    PPPP   SP P     SPP P V + PPPPP  +SP P  V + PPPP +  S
Sbjct: 119 PPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRS 178

Query: 186 PPPPYYSPSPKVYYK-SPPPPSY-----YSPSP------KVEYKSPPPPS-------YSP 308
           PPPP   P    YYK +PPPP Y     Y P P      +   +SPPPP        YSP
Sbjct: 179 PPPP--RPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSP 236

Query: 309 SP 314
            P
Sbjct: 237 PP 238

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/108 (48%), Positives = 56/108 (51%), Gaps = 6/108 (5%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY--SPSPKVYYKSPPHPHVCVCPPPPPC-YSPSPKVVYKSPPPPYVY 179
           +P V    PPPP    SP P V   SPP P V + PPPPP   SP P  V  SPPPP V 
Sbjct: 37  APLVDLSPPPPPVNISSPPPPVNL-SPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVL 95

Query: 180 NSPPPPYYS---PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SPPPP  +   P P V    PPPP   SP P     SPPPP  + SP
Sbjct: 96  LSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSP 143

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/106 (45%), Positives = 51/106 (48%), Gaps = 5/106 (4%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-YSPSPKVYYKSPPHPHVCVCPPPPPCY--SPSPKVVYKSPPPPYVYN 182
           P V   SPPPP   SP P     SPP P V + PPPPP     P P V+   PPPP   +
Sbjct: 47  PPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLS 106

Query: 183 SPPPP--YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PPPP     P P V    PPPP   SP P     SPPPP    SP
Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSP 152

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/102 (48%), Positives = 53/102 (51%), Gaps = 5/102 (4%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-YSPSPKVYYKSPPHPHVCVCPPPPPC-YSPSPKVVYKSPPPPYVYNS 185
           P V    PPPP   SP P     SPP P V + PPPPP   SP P  V  SPPPP V  S
Sbjct: 101 PPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFS 160

Query: 186 PPPPYYS--PSPKVYYKSPPPPSYYSPSPKVEY-KSPPPPSY 302
           PPPP  +  P P    +SPPPP    P     Y K+PPPP Y
Sbjct: 161 PPPPTVTRPPPPPTITRSPPPP---RPQAAAYYKKTPPPPPY 199

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 42/90 (46%), Positives = 44/90 (48%), Gaps = 3/90 (3%)
 Frame = +3

Query: 54  PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS---PSPKVY 224
           P+P V    PP P     PPPP   SP P  V  SPPPP V  SPPPP  +   P P V 
Sbjct: 36  PAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVL 95

Query: 225 YKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
              PPPP   SP P     SPPPP    SP
Sbjct: 96  LSPPPPPVNLSPPPPPVNLSPPPPPVLLSP 125

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 42/98 (42%), Positives = 48/98 (48%), Gaps = 6/98 (6%)
 Frame = +3

Query: 30  SPPPPY--YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS--PPPPYVYNS--PP 191
           SPPPP   +SP P    + PP P +   PPPP    P     YK   PPPPY Y    PP
Sbjct: 151 SPPPPPVLFSPPPPTVTRPPPPPTITRSPPPP---RPQAAAYYKKTPPPPPYKYGRVYPP 207

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           PP    + + Y +SPPPP    PS      SPPPP  S
Sbjct: 208 PPPPPQAARSYKRSPPPP---PPSKYGRVYSPPPPGKS 242

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 38/99 (38%), Positives = 42/99 (42%), Gaps = 21/99 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS--PPPPYVYN 182
           P V    PPPP  +SP P    + PP P +   PPPP    P     YK   PPPPY Y 
Sbjct: 146 PPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPP---RPQAAAYYKKTPPPPPYKYG 202

Query: 183 ------------------SPPPPYYSPSPKVYYKSPPPP 245
                             SPPPP  S   +VY  SPPPP
Sbjct: 203 RVYPPPPPPPQAARSYKRSPPPPPPSKYGRVY--SPPPP 239

[141][TOP]
>UniRef100_Q40150 Tomato cell wall HRGP (hydroxproline-rich glycoprotein) (Fragment)
           n=1 Tax=Solanum lycopersicum RepID=Q40150_SOLLC
          Length = 93

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 52/94 (55%), Positives = 58/94 (61%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP  SP P V+  SPP P V    PPPP +SP P V   SPPPP V++ PPPP  SP 
Sbjct: 10  PPPPKTSPPPPVH--SPPPPPVA--SPPPPVHSPPPPVA--SPPPP-VHSPPPPPVASPP 62

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P V+  SPPPP   SP P V   SPPPP +SP P
Sbjct: 63  PPVH--SPPPP-VASPPPPVH--SPPPPVHSPPP 91

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 46/95 (48%), Positives = 52/95 (54%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   +  PPPP  SP P V+  SPP P   V  PPPP +SP P  V  SPPPP   +SPP
Sbjct: 18  PPPVHSPPPPPVASPPPPVH--SPPPP---VASPPPPVHSPPPPPV-ASPPPP--VHSPP 69

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
           PP  SP P V+  SPPPP +          SPPPP
Sbjct: 70  PPVASPPPPVH--SPPPPVH----------SPPPP 92

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 5/74 (6%)
 Frame = +3

Query: 108 PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVY-----YKSPPPPSYYSPSPKV 272
           PPPP    P P    K+ PPP V++ PPPP  SP P V+       SPPPP +  P P V
Sbjct: 2   PPPPKTLPPPPP---KTSPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPPV 58

Query: 273 EYKSPPPPSYSPSP 314
              SPPPP +SP P
Sbjct: 59  --ASPPPPVHSPPP 70

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/71 (49%), Positives = 39/71 (54%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP +SP P      PP     V  PPPP +SP P V   SPPPP   +SP
Sbjct: 38  SPPPPVASPPPPVHSPPP------PP-----VASPPPPVHSPPPPVA--SPPPP--VHSP 82

Query: 189 PPPYYSPSPKV 221
           PPP +SP P V
Sbjct: 83  PPPVHSPPPPV 93

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 30/53 (56%), Positives = 31/53 (58%)
 Frame = +3

Query: 156 SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           SPPPP     PPPP  SP P V+  SPPPP   SP P V   SPPPP  SP P
Sbjct: 1   SPPPPKTL-PPPPPKTSPPPPVH--SPPPPPVASPPPPVH--SPPPPVASPPP 48

[142][TOP]
>UniRef100_B4MN04 GK17614 n=1 Tax=Drosophila willistoni RepID=B4MN04_DROWI
          Length = 257

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/132 (38%), Positives = 57/132 (43%), Gaps = 27/132 (20%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHP------------HVCVCPPPPPCYSPSPKVVYK 155
           P   +  PPPP   P+ KV Y  PP P             V   PPPPP   P+ KV+Y 
Sbjct: 88  PPTKHVPPPPPPPPPTKKVIYTPPPPPPPKPVPEYLPPKKVVYTPPPPPPPPPTKKVIYT 147

Query: 156 SPPPP-------------YVYNSPPPPYYSPSPKVYYKSPPPPSY--YSPSPKVEYKSPP 290
            PPPP              VY  PPPP   P+ KV Y  PPP     Y P  KV Y  PP
Sbjct: 148 PPPPPPPKPVPEYLPPKKVVYTPPPPPPPPPTKKVIYTPPPPKPVPEYLPPKKVVYTPPP 207

Query: 291 PPSYSPSPKTEY 326
           PP   P+ K  Y
Sbjct: 208 PPPPPPTKKVIY 219

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 49/119 (41%), Positives = 55/119 (46%), Gaps = 16/119 (13%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHPH-------------VCVCPPPPPCYSPSPKVVYK 155
           KV Y  PPPP   P+ KV Y  PP P              V   PPPPP   P+ KV+Y 
Sbjct: 127 KVVYTPPPPPPPPPTKKVIYTPPPPPPPKPVPEYLPPKKVVYTPPPPPP-PPPTKKVIYT 185

Query: 156 SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS---YSPSPKTE 323
            PPP       P P Y P  KV Y +PPPP    P+ KV Y  PPPP    Y P P  +
Sbjct: 186 PPPP------KPVPEYLPPKKVVY-TPPPPPPPPPTKKVIYTPPPPPPPVVYHPEPSNK 237

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 45/119 (37%), Positives = 53/119 (44%), Gaps = 15/119 (12%)
 Frame = +3

Query: 15  KVYYKSPPPP----------YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP 164
           KVY   PPPP          Y+   P V +++     V   PPPPP     P + Y  PP
Sbjct: 35  KVYTPPPPPPPPAGILKDDGYHYAEPTVKFET-----VVKTPPPPPPQPTKPNIEYLPPP 89

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPP-----SYYSPSPKVEYKSPPPPSYSPSPKTEY 326
             +V   PPPP   P+ KV Y  PPPP       Y P  KV Y  PPPP   P+ K  Y
Sbjct: 90  TKHVPPPPPPP--PPTKKVIYTPPPPPPPKPVPEYLPPKKVVYTPPPPPPPPPTKKVIY 146

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/109 (40%), Positives = 48/109 (44%), Gaps = 13/109 (11%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP 194
           KV Y  PPPP   P+ KV Y  PP       P P P Y P  KVVY  PPPP     PPP
Sbjct: 165 KVVYTPPPPPPPPPTKKVIYTPPP-------PKPVPEYLPPKKVVYTPPPPP-----PPP 212

Query: 195 P----YYSPSPKVYYKSPPPPSYYSPSPK---------VEYKSPPPPSY 302
           P     Y+P P      PPPP  Y P P            Y + P PS+
Sbjct: 213 PTKKVIYTPPP------PPPPVVYHPEPSNKIVVAHQGYSYPNDPQPSF 255

[143][TOP]
>UniRef100_Q8RWX5 Putative uncharacterized protein At3g19020 (Fragment) n=1
           Tax=Arabidopsis thaliana RepID=Q8RWX5_ARATH
          Length = 712

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 51/95 (53%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +3

Query: 33  PPPPYYSPSPK-VYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           P PP  SPS +     SP  P V   PPPPP +SP P V   SPPPP   +SPPPP YSP
Sbjct: 624 PQPP--SPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVF--SPPPPM--HSPPPPVYSP 677

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P V+  SPPPP  +SP P V   SPPPP +SP P
Sbjct: 678 PPPVH--SPPPPPVHSPPPPVH--SPPPPVHSPPP 708

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 44/99 (44%), Positives = 54/99 (54%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP V+   PPPP +SP P V+             PPPP +SP P V   SPPPP V++ P
Sbjct: 641 SPPVHSPPPPPPVHSPPPPVF------------SPPPPMHSPPPPVY--SPPPP-VHSPP 685

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           PPP +SP P V+  SPPPP +          SPPPP +S
Sbjct: 686 PPPVHSPPPPVH--SPPPPVH----------SPPPPVHS 712

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 45/104 (43%), Positives = 54/104 (51%), Gaps = 8/104 (7%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPC--------YSPSPKVVYKSPPPPYVYN 182
           K   PP  SP P   Y + P   +  C P PP          SP    V+  PPPP V+ 
Sbjct: 599 KMGSPPLESPVPNDPYDASP---IKKCRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVH- 654

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           SPPPP +SP P ++  SPPPP  YSP P V +  PPPP +SP P
Sbjct: 655 SPPPPVFSPPPPMH--SPPPP-VYSPPPPV-HSPPPPPVHSPPP 694

[144][TOP]
>UniRef100_UPI0001983BCD PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983BCD
          Length = 411

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 41/102 (40%), Positives = 58/102 (56%), Gaps = 4/102 (3%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPK-VYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP 197
           YY S PPPYY   P   ++ +  HP+    PPPP  Y  +P   Y + PPP+ Y + PPP
Sbjct: 240 YYSSTPPPYYPSGPSPTHFGAYVHPYAFT-PPPPSIYGAAPPSFYGAAPPPF-YGAAPPP 297

Query: 198 YY--SPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSYSPSP 314
           ++  +P P  Y  +PPPP+Y  +P P     +PPPP+Y  +P
Sbjct: 298 FHGVAPPPPTYGAAPPPPTYGAAPPPPTYGAAPPPPTYGAAP 339

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 39/102 (38%), Positives = 51/102 (50%), Gaps = 3/102 (2%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN-SP 188
           P   Y + PP +Y  +P  +Y + P P   V PPPP   +  P   Y + PPP  Y  +P
Sbjct: 271 PPSIYGAAPPSFYGAAPPPFYGAAPPPFHGVAPPPPTYGAAPPPPTYGAAPPPPTYGAAP 330

Query: 189 PPPYY--SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           PPP Y  +P P  Y  +PPPPSY +      Y    PP +SP
Sbjct: 331 PPPTYGAAPPPPTYGAAPPPPSYGA------YAYGEPPGFSP 366

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 36/95 (37%), Positives = 48/95 (50%), Gaps = 2/95 (2%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           +  PPP  Y  +P  +Y + P P     PPP    +P P     +PPPP    +PPPP Y
Sbjct: 267 FTPPPPSIYGAAPPSFYGAAPPPFYGAAPPPFHGVAPPPPTYGAAPPPPTYGAAPPPPTY 326

Query: 204 --SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
             +P P  Y  +PPPP+Y +        +PPPPSY
Sbjct: 327 GAAPPPPTYGAAPPPPTYGA--------APPPPSY 353

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 40/111 (36%), Positives = 55/111 (49%), Gaps = 10/111 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPY--YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPK----VVYK---SPP 164
           P  Y    P P+  Y PSP   Y  P HP+    PPP     PSP      V+    +PP
Sbjct: 212 PAPYGAYVPAPHGAYGPSPYYAY-GPQHPYYSSTPPPYYPSGPSPTHFGAYVHPYAFTPP 270

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSYSPSP 314
           PP +Y + PP +Y  +P  +Y + PPP +  +P P     +PPPP+Y  +P
Sbjct: 271 PPSIYGAAPPSFYGAAPPPFYGAAPPPFHGVAPPPPTYGAAPPPPTYGAAP 321

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/110 (31%), Positives = 45/110 (40%), Gaps = 17/110 (15%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS--- 206
           P PY +  P  Y    P PH    P P   Y P     Y S PPPY  + P P ++    
Sbjct: 204 PAPYGAYGPAPYGAYVPAPHGAYGPSPYYAYGPQHPY-YSSTPPPYYPSGPSPTHFGAYV 262

Query: 207 -------PSPKVY-------YKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                  P P +Y       Y + PPP Y +  P     +PPPP+Y  +P
Sbjct: 263 HPYAFTPPPPSIYGAAPPSFYGAAPPPFYGAAPPPFHGVAPPPPTYGAAP 312

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 32/90 (35%), Positives = 42/90 (46%), Gaps = 1/90 (1%)
 Frame = +3

Query: 84  PHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPS 263
           P P+    P P   Y P+P   Y   P PY    P  PYYS +P  YY S P P+++   
Sbjct: 204 PAPYGAYGPAPYGAYVPAPHGAYG--PSPYYAYGPQHPYYSSTPPPYYPSGPSPTHFGAY 261

Query: 264 PKVEYKSPPPPS-YSPSPKTEY*ISRLPLY 350
                 +PPPPS Y  +P + Y  +  P Y
Sbjct: 262 VHPYAFTPPPPSIYGAAPPSFYGAAPPPFY 291

[145][TOP]
>UniRef100_Q5N8V9 Os01g0899700 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5N8V9_ORYSJ
          Length = 412

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 60/144 (41%), Positives = 65/144 (45%), Gaps = 43/144 (29%)
 Frame = +3

Query: 24  YKSPPP-PYYSPSPKVYYKSPPHPHVCVCPP----PPPC------------------YSP 134
           Y SPPP PY  PSP   YKSPP P+    PP    PPP                   Y+P
Sbjct: 186 YNSPPPSPYQYPSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSYHSPPPYQYTP 245

Query: 135 -----SPKVVYKSPPPPYVYNSP--------PPPYYSPSPKVYYK-SPPPPSYYSPS--- 263
                +P   Y  PPPPY YNSP        PPPYY  SP   Y+ SPP  SY SP    
Sbjct: 246 PNSYQAPPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQHSPPANSYVSPPLAH 305

Query: 264 --PKVEYKSPP-PPSYSPSPKTEY 326
             P   YKSPP PP Y  SP   +
Sbjct: 306 QYPPPPYKSPPIPPYYFNSPPANH 329

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 52/134 (38%), Positives = 63/134 (47%), Gaps = 30/134 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSP--KVYYKSPPHPHVCVCPP-----PPPCYS-PSPKVVYKSP- 161
           SP  + K PPP +  PSP    Y+  PP+ +    PP     PP  Y+ P P   Y SP 
Sbjct: 213 SPPPFNKFPPPSHQYPSPPQSSYHSPPPYQYT---PPNSYQAPPTSYNHPPPPYGYNSPI 269

Query: 162 -------PPPYVYNSPPPPY-YSPSPKVY-------------YKSPPPPSYYSPSPKVEY 278
                  PPPY +NSPPP Y +SP    Y             YKSPP P YY  SP   +
Sbjct: 270 PPTNKYLPPPYYFNSPPPQYQHSPPANSYVSPPLAHQYPPPPYKSPPIPPYYFNSPPANH 329

Query: 279 KSPPPPSYSPSPKT 320
            SPPP ++  SP T
Sbjct: 330 YSPPPYNFGSSPPT 343

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 54/134 (40%), Positives = 66/134 (49%), Gaps = 22/134 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSP-----SPKVYYKSPPHPHV--CVCPP-----PPPCYSPSPKVVYK 155
           P+  Y SPPP  Y+P     +P   Y  PP P+      PP     PPP Y  SP   Y+
Sbjct: 231 PQSSYHSPPPYQYTPPNSYQAPPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQ 290

Query: 156 -SPP------PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS- 311
            SPP      PP  +  PPPPY SP    YY + PP ++YSP P     SPP   YSP  
Sbjct: 291 HSPPANSYVSPPLAHQYPPPPYKSPPIPPYYFNSPPANHYSPPPYNFGSSPPTYQYSPPL 350

Query: 312 -PKT-EY*ISRLPL 347
            PKT +Y   ++PL
Sbjct: 351 LPKTPKYLPPKVPL 364

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 47/112 (41%), Positives = 51/112 (45%), Gaps = 17/112 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP------PPY 173
           P  Y+ SPPP Y    P   Y SPP  H    PPPP    P P   + SPP      PPY
Sbjct: 278 PPYYFNSPPPQYQHSPPANSYVSPPLAHQY--PPPPYKSPPIPPYYFNSPPANHYSPPPY 335

Query: 174 VYNSPPPPY-YSPS----------PKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            + S PP Y YSP           PKV  +  PP    SP P V Y SPPPP
Sbjct: 336 NFGSSPPTYQYSPPLLPKTPKYLPPKVPLEMSPPAHATSPQPLVHY-SPPPP 386

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 49/111 (44%), Positives = 60/111 (54%), Gaps = 16/111 (14%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPS-PKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPP- 164
           SP + ++ PPPPY SP  P  Y+ SPP  H    PPP      PP Y  SP ++ K+P  
Sbjct: 300 SPPLAHQYPPPPYKSPPIPPYYFNSPPANH--YSPPPYNFGSSPPTYQYSPPLLPKTPKY 357

Query: 165 -PPYV--YNSPPPPYYSPSPKVYYKSPPPPSYY----SPSPKV-EYKSPPP 293
            PP V    SPP    SP P V+Y SPPPP  +    S +P V  Y+SPPP
Sbjct: 358 LPPKVPLEMSPPAHATSPQPLVHY-SPPPPLQHAGISSTTPSVNSYQSPPP 407

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 37/89 (41%), Positives = 45/89 (50%), Gaps = 6/89 (6%)
 Frame = +3

Query: 78  SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP-PPYYSPSPKVYYKSPPPPSYY 254
           S PH    + PP  P  SP P   Y+ P PP+ Y SPP P  +SP P  + K PPP   Y
Sbjct: 175 SKPH----IQPPIFPYNSPPPSP-YQYPSPPFNYKSPPLPNQFSPPP--FNKFPPPSHQY 227

Query: 255 SPSPKVEYKSPPPPSYSP-----SPKTEY 326
              P+  Y SPPP  Y+P     +P T Y
Sbjct: 228 PSPPQSSYHSPPPYQYTPPNSYQAPPTSY 256

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 42/115 (36%), Positives = 46/115 (40%), Gaps = 20/115 (17%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCY-SP------SPKVVYKSPPPPYVYNSPPPPY 200
           P+  P    Y   PP P+    P PP  Y SP      SP    K PPP + Y SPP   
Sbjct: 177 PHIQPPIFPYNSPPPSPYQY--PSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSS 234

Query: 201 YSPSPKVYYKSP-----PPPSYYSPSPKVEYKSP--------PPPSYSPSPKTEY 326
           Y   P   Y  P     PP SY  P P   Y SP        PPP Y  SP  +Y
Sbjct: 235 YHSPPPYQYTPPNSYQAPPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQY 289

[146][TOP]
>UniRef100_Q1PDU7 Proline-rich extensin-like family protein n=1 Tax=Arabidopsis
           thaliana RepID=Q1PDU7_ARATH
          Length = 168

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/123 (43%), Positives = 61/123 (49%), Gaps = 21/123 (17%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYY-SPSPKVYYKSPPHPHVCVCPPPPPC-YSPSPKVVYKSPPPPYVYN 182
           +P V    PPPP   SP P     SPP P V + PPPPP  +SP P  V + PPPP +  
Sbjct: 37  APLVDLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITR 96

Query: 183 SPPPPYYSPSPKVYYK-SPPPPSY-----YSPSP------KVEYKSPPPPS-------YS 305
           SPPPP   P    YYK +PPPP Y     Y P P      +   +SPPPP        YS
Sbjct: 97  SPPPP--RPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYS 154

Query: 306 PSP 314
           P P
Sbjct: 155 PPP 157

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/87 (49%), Positives = 48/87 (55%), Gaps = 4/87 (4%)
 Frame = +3

Query: 54  PSPKVYYKSPPHPHVCVCPPPPPC-YSPSPKVVYKSPPPPYVYNSPPPPYYS--PSPKVY 224
           P+P V   SPP P V + PPPPP   SP P  V  SPPPP V  SPPPP  +  P P   
Sbjct: 36  PAPLVDL-SPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTI 94

Query: 225 YKSPPPPSYYSPSPKVEY-KSPPPPSY 302
            +SPPPP    P     Y K+PPPP Y
Sbjct: 95  TRSPPPP---RPQAAAYYKKTPPPPPY 118

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 42/98 (42%), Positives = 48/98 (48%), Gaps = 6/98 (6%)
 Frame = +3

Query: 30  SPPPPY--YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS--PPPPYVYNS--PP 191
           SPPPP   +SP P    + PP P +   PPPP    P     YK   PPPPY Y    PP
Sbjct: 70  SPPPPPVLFSPPPPTVTRPPPPPTITRSPPPP---RPQAAAYYKKTPPPPPYKYGRVYPP 126

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           PP    + + Y +SPPPP    PS      SPPPP  S
Sbjct: 127 PPPPPQAARSYKRSPPPP---PPSKYGRVYSPPPPGKS 161

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 31/77 (40%), Positives = 38/77 (49%)
 Frame = +3

Query: 84  PHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPS 263
           P P V + PPPPP       V+   PPPP   + PPPP       V    PPPP  +SP 
Sbjct: 36  PAPLVDLSPPPPP-------VLLSPPPPPVNLSPPPPP-------VLLSPPPPPVLFSPP 81

Query: 264 PKVEYKSPPPPSYSPSP 314
           P    + PPPP+ + SP
Sbjct: 82  PPTVTRPPPPPTITRSP 98

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 38/99 (38%), Positives = 42/99 (42%), Gaps = 21/99 (21%)
 Frame = +3

Query: 12  PKVYYKSPPPPY-YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS--PPPPYVYN 182
           P V    PPPP  +SP P    + PP P +   PPPP    P     YK   PPPPY Y 
Sbjct: 65  PPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPP---RPQAAAYYKKTPPPPPYKYG 121

Query: 183 ------------------SPPPPYYSPSPKVYYKSPPPP 245
                             SPPPP  S   +VY  SPPPP
Sbjct: 122 RVYPPPPPPPQAARSYKRSPPPPPPSKYGRVY--SPPPP 158

[147][TOP]
>UniRef100_A2WXZ6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2WXZ6_ORYSI
          Length = 412

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 60/144 (41%), Positives = 65/144 (45%), Gaps = 43/144 (29%)
 Frame = +3

Query: 24  YKSPPP-PYYSPSPKVYYKSPPHPHVCVCPP----PPPC------------------YSP 134
           Y SPPP PY  PSP   YKSPP P+    PP    PPP                   Y+P
Sbjct: 186 YNSPPPSPYQYPSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSYHSPPPYQYTP 245

Query: 135 -----SPKVVYKSPPPPYVYNSP--------PPPYYSPSPKVYYK-SPPPPSYYSPS--- 263
                +P   Y  PPPPY YNSP        PPPYY  SP   Y+ SPP  SY SP    
Sbjct: 246 PNSYQAPPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQHSPPANSYVSPPLAH 305

Query: 264 --PKVEYKSPP-PPSYSPSPKTEY 326
             P   YKSPP PP Y  SP   +
Sbjct: 306 QYPPPPYKSPPIPPYYFNSPPANH 329

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 52/134 (38%), Positives = 63/134 (47%), Gaps = 30/134 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSP--KVYYKSPPHPHVCVCPP-----PPPCYS-PSPKVVYKSP- 161
           SP  + K PPP +  PSP    Y+  PP+ +    PP     PP  Y+ P P   Y SP 
Sbjct: 213 SPPPFNKFPPPSHQYPSPPQSSYHSPPPYQYT---PPNSYQAPPTSYNHPPPPYGYNSPI 269

Query: 162 -------PPPYVYNSPPPPY-YSPSPKVY-------------YKSPPPPSYYSPSPKVEY 278
                  PPPY +NSPPP Y +SP    Y             YKSPP P YY  SP   +
Sbjct: 270 PPTNKYLPPPYYFNSPPPQYQHSPPANSYVSPPLAHQYPPPPYKSPPIPPYYFNSPPANH 329

Query: 279 KSPPPPSYSPSPKT 320
            SPPP ++  SP T
Sbjct: 330 YSPPPYNFGSSPPT 343

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 54/134 (40%), Positives = 66/134 (49%), Gaps = 22/134 (16%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSP-----SPKVYYKSPPHPHV--CVCPP-----PPPCYSPSPKVVYK 155
           P+  Y SPPP  Y+P     +P   Y  PP P+      PP     PPP Y  SP   Y+
Sbjct: 231 PQSSYHSPPPYQYTPPNSYQAPPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQ 290

Query: 156 -SPP------PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS- 311
            SPP      PP  +  PPPPY SP    YY + PP ++YSP P     SPP   YSP  
Sbjct: 291 HSPPANSYVSPPLAHQYPPPPYKSPPIPPYYFNSPPANHYSPPPYNFGSSPPTYQYSPPL 350

Query: 312 -PKT-EY*ISRLPL 347
            PKT +Y   ++PL
Sbjct: 351 LPKTPKYLPPKVPL 364

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 47/112 (41%), Positives = 51/112 (45%), Gaps = 17/112 (15%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP------PPY 173
           P  Y+ SPPP Y    P   Y SPP  H    PPPP    P P   + SPP      PPY
Sbjct: 278 PPYYFNSPPPQYQHSPPANSYVSPPLAHQY--PPPPYKSPPIPPYYFNSPPANHYSPPPY 335

Query: 174 VYNSPPPPY-YSPS----------PKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            + S PP Y YSP           PKV  +  PP    SP P V Y SPPPP
Sbjct: 336 NFGSSPPTYQYSPPLLPKTPKYLPPKVPLEMSPPAHATSPQPLVHY-SPPPP 386

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 49/111 (44%), Positives = 60/111 (54%), Gaps = 16/111 (14%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPS-PKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPP- 164
           SP + ++ PPPPY SP  P  Y+ SPP  H    PPP      PP Y  SP ++ K+P  
Sbjct: 300 SPPLAHQYPPPPYKSPPIPPYYFNSPPANH--YSPPPYNFGSSPPTYQYSPPLLPKTPKY 357

Query: 165 -PPYV--YNSPPPPYYSPSPKVYYKSPPPPSYY----SPSPKV-EYKSPPP 293
            PP V    SPP    SP P V+Y SPPPP  +    S +P V  Y+SPPP
Sbjct: 358 LPPKVPLEMSPPAHATSPQPLVHY-SPPPPLQHAGISSTTPSVNSYQSPPP 407

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 37/89 (41%), Positives = 45/89 (50%), Gaps = 6/89 (6%)
 Frame = +3

Query: 78  SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP-PPYYSPSPKVYYKSPPPPSYY 254
           S PH    + PP  P  SP P   Y+ P PP+ Y SPP P  +SP P  + K PPP   Y
Sbjct: 175 SKPH----IQPPIFPYNSPPPSP-YQYPSPPFNYKSPPLPNQFSPPP--FNKFPPPSHQY 227

Query: 255 SPSPKVEYKSPPPPSYSP-----SPKTEY 326
              P+  Y SPPP  Y+P     +P T Y
Sbjct: 228 PSPPQSSYHSPPPYQYTPPNSYQAPPTSY 256

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 42/115 (36%), Positives = 46/115 (40%), Gaps = 20/115 (17%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCY-SP------SPKVVYKSPPPPYVYNSPPPPY 200
           P+  P    Y   PP P+    P PP  Y SP      SP    K PPP + Y SPP   
Sbjct: 177 PHIQPPIFPYNSPPPSPYQY--PSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSS 234

Query: 201 YSPSPKVYYKSP-----PPPSYYSPSPKVEYKSP--------PPPSYSPSPKTEY 326
           Y   P   Y  P     PP SY  P P   Y SP        PPP Y  SP  +Y
Sbjct: 235 YHSPPPYQYTPPNSYQAPPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQY 289

[148][TOP]
>UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH
          Length = 470

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 49/95 (51%), Positives = 49/95 (51%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P      PP P     PPPPP   P P      PPPPYVY SPPPP  SP
Sbjct: 378 SPPPPPPPPPP------PPPP-----PPPPPPPPPPP------PPPPYVYPSPPPPPPSP 420

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P V Y  PPPP  Y P P   Y  PPPP  SP P
Sbjct: 421 PPYV-YPPPPPPYVYPPPPSPPYVYPPPPP-SPQP 453

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 41/86 (47%), Positives = 42/86 (48%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP   P P   Y SPP P     P PPP        VY  PPPPYVY  PPP    PS
Sbjct: 397 PPPPPPPPPPPYVYPSPPPPP----PSPPPY-------VYPPPPPPYVY--PPP----PS 439

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPP 290
           P   Y  PPP    SP P + Y SPP
Sbjct: 440 PPYVYPPPPP----SPQPYM-YPSPP 460

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 39/86 (45%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-PPYVYNSP 188
           P   Y SPPPP   PSP  Y          V PPPPP Y      VY  PP PPYVY  P
Sbjct: 406 PPYVYPSPPPP--PPSPPPY----------VYPPPPPPY------VYPPPPSPPYVYPPP 447

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSP 266
           PP   SP P +Y   P PP    P+P
Sbjct: 448 PP---SPQPYMY---PSPPCNDLPTP 467

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 33/70 (47%), Positives = 34/70 (48%), Gaps = 5/70 (7%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY----SPSPKVVYKSPPP-PYVYNSPPPP 197
           PPPPY  PSP      PP P   V PPPPP Y     PSP  VY  PPP P  Y  P PP
Sbjct: 404 PPPPYVYPSPP---PPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460

Query: 198 YYSPSPKVYY 227
                  V+Y
Sbjct: 461 CNDLPTPVHY 470

[149][TOP]
>UniRef100_Q01946 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q01946_SOLLC
          Length = 67

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 45/80 (56%), Positives = 45/80 (56%)
 Frame = +3

Query: 69  YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPS 248
           YYKSPP        PP P           SPPPPY Y SPPPP  SP P  YYKSPPPPS
Sbjct: 2   YYKSPP--------PPSP-----------SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 42

Query: 249 YYSPSPKVEYKSPPPPSYSP 308
             SP P   YKSPPPP  SP
Sbjct: 43  -PSPPPPYYYKSPPPPVKSP 61

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 42/75 (56%), Positives = 42/75 (56%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           YYKSPPPP  SP P  YYKSPP         PP            SPPPPY Y SPPPP 
Sbjct: 2   YYKSPPPPSPSPPPPYYYKSPP---------PPSP----------SPPPPYYYKSPPPPS 42

Query: 201 YSPSPKVYYKSPPPP 245
            SP P  YYKSPPPP
Sbjct: 43  PSPPPPYYYKSPPPP 57

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 34/52 (65%), Positives = 34/52 (65%)
 Frame = +3

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           Y Y SPPPP  SP P  YYKSPPPPS  SP P   YKSPPPPS SP P   Y
Sbjct: 1   YYYKSPPPPSPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYY 51

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 36/67 (53%), Positives = 36/67 (53%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPPY       YYKSPP P      PPPP Y  SP     SPPPPY Y SP
Sbjct: 5   SPPPPSPSPPPPY-------YYKSPPPPSP---SPPPPYYYKSPPPPSPSPPPPYYYKSP 54

Query: 189 PPPYYSP 209
           PPP  SP
Sbjct: 55  PPPVKSP 61

[150][TOP]
>UniRef100_UPI0000DD9D0C Os11g0657400 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD9D0C
          Length = 1399

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/109 (45%), Positives = 52/109 (47%), Gaps = 6/109 (5%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVY------KSPPP 167
            +SP    KSPPPP     P    KSPP P   + PPPP    P P  V       KSPPP
Sbjct: 1143 SSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1202

Query: 168  PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P    SPPPP  SP P      PPPP   SP P     SPPPP  SP P
Sbjct: 1203 PAPVISPPPPVKSPPPPAPVILPPPP-VKSPPPPAPVISPPPPEKSPPP 1250

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/101 (48%), Positives = 50/101 (49%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P V   SPPPP  SP P      PP P +   PPP P  SP P V  KSPPPP     PP
Sbjct: 1138 PPVPVSSPPPPEKSPPPPAPVILPPPP-IKSPPPPAPVISPPPPV--KSPPPPAPVILPP 1194

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP  SP P     SPPPP   SP P      PPPP  SP P
Sbjct: 1195 PPVKSPPPPAPVISPPPP-VKSPPPPAPVILPPPPVKSPPP 1234

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/95 (46%), Positives = 45/95 (47%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            S PPP   P P     S P P     PPP P   P P +  KSPPPP    SPPPP  SP
Sbjct: 1127 SLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPI--KSPPPPAPVISPPPPVKSP 1184

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P      PPPP   SP P     SPPPP  SP P
Sbjct: 1185 PPPAPVILPPPP-VKSPPPPAPVISPPPPVKSPPP 1218

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 46/101 (45%), Positives = 46/101 (45%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P V   S PP   S  P      PP P V   PPP P  SP P    KSPPPP     PP
Sbjct: 1106 PSVPKASSPPTEKSLPPPATVSLPP-PTVKPLPPPVPVSSPPPPE--KSPPPPAPVILPP 1162

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP  SP P     SPPPP   SP P      PPPP  SP P
Sbjct: 1163 PPIKSPPPPAPVISPPPP-VKSPPPPAPVILPPPPVKSPPP 1202

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 48/117 (41%), Positives = 49/117 (41%), Gaps = 15/117 (12%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV-------VYKSPPP 167
            SP    KSPPPP     P    KSPP P   V  PPPP  SP P           KSPPP
Sbjct: 1176 SPPPPVKSPPPPAPVILPPPPVKSPPPP-APVISPPPPVKSPPPPAPVILPPPPVKSPPP 1234

Query: 168  PYVYNSPPPPYYSP--------SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P    SPPPP  SP        SP      PPP     P P V+   PP P   P P
Sbjct: 1235 PAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKSLPPPAPVSLPPP 1291

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 40/96 (41%), Positives = 47/96 (48%)
 Frame = +3

Query: 27   KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
            KSPP   +  SP    KSPP P     PP P   SPSP   ++  PP  V +S PP    
Sbjct: 788  KSPPSEAHPTSPPPSEKSPPTPAEESSPPTPE-KSPSPPSGHEGTPPSPVKSSSPP---- 842

Query: 207  PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
              P+ +  SPPP    SP P+    SPPPP  SP P
Sbjct: 843  --PEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPP 876

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 48/117 (41%), Positives = 56/117 (47%), Gaps = 6/117 (5%)
 Frame = +3

Query: 12   PKVYYKSPPPPY-YSPSPKVYY----KSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV 176
            P   + SPP P  Y+PSP        KSPP PH     PP   +  SP    KSPP P  
Sbjct: 753  PPTSHTSPPTPEEYTPSPPKSSPPEEKSPP-PHSPEKSPPSEAHPTSPPPSEKSPPTPAE 811

Query: 177  YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVE-YKSPPPPSYSPSPKTEY*ISRLP 344
             +SPP P  SPSP   ++  PP    S SP  E + S PPP  S SP  E  +S  P
Sbjct: 812  ESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPP 868

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/105 (41%), Positives = 47/105 (44%), Gaps = 1/105 (0%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV-VYKSPPPPYVYNS 185
            SP    KSPP P    SP    KSP  P      PP P  S SP    + S PPP   +S
Sbjct: 798  SPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSS 857

Query: 186  PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            PPP  +  SP    KSPPPP   SP       SPPP   SP   T
Sbjct: 858  PPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHT 902

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 45/120 (37%), Positives = 50/120 (41%), Gaps = 4/120 (3%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPY----YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
            +SP    KSP PP       PSP      PP  HV   PPP    SP P+    SPPPP 
Sbjct: 813  SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVS-SPPPEKSSSPPPEAHVSSPPPPE 871

Query: 174  VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPLYE 353
               SPPPP     P +  +  PPP   SP       S PP   S  P T    S  P +E
Sbjct: 872  --KSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHE 929

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 43/116 (37%), Positives = 46/116 (39%), Gaps = 14/116 (12%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP--------- 161
            SP    KSPPPP     P    KSPP P   + PPPP    P    V  SP         
Sbjct: 1208 SPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPP 1267

Query: 162  -----PPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                 PPP V + PPP   S  P V    PPP     P P V+   PP P   P P
Sbjct: 1268 APVSLPPPPVKSLPPPAPVSLPPPVVKSLPPPAPVSLPPPAVKPLPPPAPVSLPPP 1323

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 45/103 (43%), Positives = 47/103 (45%), Gaps = 2/103 (1%)
 Frame = +3

Query: 12   PKVYYKSPPP--PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
            P+   KS PP  P  S  P V   S P P     PPP     P P V  K  PPP   +S
Sbjct: 1088 PETPEKSYPPSTPEESSPPSVPKASSP-PTEKSLPPPATVSLPPPTV--KPLPPPVPVSS 1144

Query: 186  PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PPPP  SP P      PPPP   SP P     SPPPP  SP P
Sbjct: 1145 PPPPEKSPPPPAPVILPPPP-IKSPPPPAPVISPPPPVKSPPP 1186

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 45/118 (38%), Positives = 53/118 (44%), Gaps = 15/118 (12%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP----PPCYSP---SPKVVYKSPPPP 170
            P+ +  SPPPP  SP P    KSPP     + PPP    PP ++P   SP      PPP 
Sbjct: 860  PEAHVSSPPPPEKSPPPPET-KSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPT 918

Query: 171  YVYNSPPPPYYSPSPKVYYKSPPPPSYYSP--------SPKVEYKSPPPPSYSPSPKT 320
                S PP +    P    KS PPP   SP        SP  E   PPP   SP+PK+
Sbjct: 919  PTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPP---SPTPKS 973

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 48/141 (34%), Positives = 58/141 (41%), Gaps = 36/141 (25%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---YSPSPKVYY----KSPPHPHVCVCPPPPPCYS------------ 131
            +P+    SPPPP    ++PSP        KSPP P      PPPP               
Sbjct: 653  TPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPP 712

Query: 132  -----PSPKVVYKSPPPPY--------VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSP-- 266
                 P+P+    SPPPP           +SPP     P P   + SPP P  Y+PSP  
Sbjct: 713  VEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPK 772

Query: 267  --KVEYKSPPPPSYSPSPKTE 323
                E KSPPP S   SP +E
Sbjct: 773  SSPPEEKSPPPHSPEKSPPSE 793

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 43/110 (39%), Positives = 54/110 (49%), Gaps = 8/110 (7%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY--YSPSPKVYYKSPP---HPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
           SP   Y +PPPP   + P      K+PP    P     PP  P  SP P+   KSPP P 
Sbjct: 503 SPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEG--KSPPTPT 560

Query: 174 VYNSPP--PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP-PPSYSPSP 314
             +SPP  P  ++PSP    KS PP     P+P+ +   PP P  Y+PSP
Sbjct: 561 ASHSPPPVPEGHTPSPP---KSGPPAGESPPTPESKASPPPTPEEYTPSP 607

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 51/134 (38%), Positives = 59/134 (44%), Gaps = 22/134 (16%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---YSPSPKVYY----KSPPHPHVC-VCPPPPPCYSPSPKVVY---- 152
            +P+    SPPPP    ++PSP        KSPP P      PP P  Y+PSP        
Sbjct: 719  TPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEE 778

Query: 153  KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS----------Y 302
            KSPPP     SPP   +  SP    KSPP P+  S  P  E KSP PPS           
Sbjct: 779  KSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPE-KSPSPPSGHEGTPPSPVK 837

Query: 303  SPSPKTEY*ISRLP 344
            S SP  E  +S  P
Sbjct: 838  SSSPPPEAHVSSPP 851

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 46/117 (39%), Positives = 49/117 (41%), Gaps = 21/117 (17%)
 Frame = +3

Query: 27   KSPPPPYYSP-SPKVYYKSPPHPHVCVCPPPPPCYSPS-------PKVVYKSPPPPYVY- 179
            KS PP   SP +P+    SPP P      P PP  SP        P   + SPP P  Y 
Sbjct: 708  KSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYT 767

Query: 180  ----NSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSP 314
                 S PP   SP P    KSP        PPPS  SP    E  SPP P  SPSP
Sbjct: 768  PSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSP 824

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 46/112 (41%), Positives = 56/112 (50%), Gaps = 18/112 (16%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYY----KSPPHPHVCVCPPPPPC---YSPSP----KVVYKSPP-PPYV 176
           P P  Y+PSP        KSPP P      PPPP    ++PSP        KSPP P   
Sbjct: 598 PTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESK 657

Query: 177 YNSPPPPY---YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS---YSPSP 314
            +SPPPP    ++PSP    KS PP     P+P+ E  SPPPP+   + PSP
Sbjct: 658 ASSPPPPTPEGHTPSPP---KSTPPTEKSPPTPESESSSPPPPAPEGHMPSP 706

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 47/139 (33%), Positives = 57/139 (41%), Gaps = 33/139 (23%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP-PPCYSPSPKV----VYKSPPP 167
           +A P   Y  P  P  SP P+   KSPP P     PPP P  ++PSP        +SPP 
Sbjct: 532 QAEPPTEYSPPATPESSPPPEG--KSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPT 589

Query: 168 PYVYNSPPPP--YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS-------------- 299
           P    SPPP    Y+PSP    KS PP     P+P+ +  SPPPP+              
Sbjct: 590 PESKASPPPTPEEYTPSPP---KSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPP 646

Query: 300 ------------YSPSPKT 320
                        SP P T
Sbjct: 647 SEKSPPTPESKASSPPPPT 665

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 39/98 (39%), Positives = 42/98 (42%), Gaps = 1/98 (1%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP  S  P      PP P V   PPP P   P P V  K  PPP   + PPP      
Sbjct: 1273 PPPPVKSLPPPAPVSLPP-PVVKSLPPPAPVSLPPPAV--KPLPPPAPVSLPPPAVKPLP 1329

Query: 213  PKVYYKSPPPPSYYS-PSPKVEYKSPPPPSYSPSPKTE 323
            P V   S PPP   S P P  E ++PP     P P  E
Sbjct: 1330 PPVPQVSLPPPKQESLPPPAKEAEAPPAKESKPPPAME 1367

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 50/143 (34%), Positives = 63/143 (44%), Gaps = 39/143 (27%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---YSPSPKVYY----KSPPHPHVCVCPPPPPC---YSPSPKV---- 146
            +P+    SPPPP    ++PSP        KSPP P      PPPP    ++PSP      
Sbjct: 620  TPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPP 679

Query: 147  VYKSPPPPYVYNSPPPP------------------YYSPSPKVYYKSPPPPS--YYSPSP 266
              KSPP P   +S PPP                     P+P+    SPPPP+   ++PSP
Sbjct: 680  TEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSP 739

Query: 267  ----KVEYKSPP-PPSYSPSPKT 320
                  E KSPP PP+   SP T
Sbjct: 740  PKSSPPEEKSPPIPPTSHTSPPT 762

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 46/115 (40%), Positives = 52/115 (45%), Gaps = 9/115 (7%)
 Frame = +3

Query: 3    RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
            ++SP    KS PPP    S     KS P PH  V   PPP  S  P+V   S PPP   +
Sbjct: 1021 KSSPPPAEKSQPPPSPVESVLPPVKSSP-PHAPVISEPPPTKSSPPQVPVTSEPPP-AKS 1078

Query: 183  SPPPPYYSPSPKVYYKSPPP--PSYYSP-------SPKVEYKSPPPPSYSPSPKT 320
            SPP    SP P+   KS PP  P   SP       SP  E   PPP + S  P T
Sbjct: 1079 SPPHEPISP-PETPEKSYPPSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPT 1132

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 42/120 (35%), Positives = 44/120 (36%), Gaps = 22/120 (18%)
 Frame = +3

Query: 30   SPPPPYYSP--------SPKVYYKSPPHPHVCVCPPP-----PPCYSPSPKVVYKSPPPP 170
            SPPPP  SP        SP      PP   V + PPP     PP     P  V KS PPP
Sbjct: 1240 SPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKSLPPPAPVSLPPPVVKSLPPP 1299

Query: 171  YVYNSPPP---------PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
               + PPP         P   P P V    PP P    P PK E   PP       P  E
Sbjct: 1300 APVSLPPPAVKPLPPPAPVSLPPPAVKPLPPPVPQVSLPPPKQESLPPPAKEAEAPPAKE 1359

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/111 (35%), Positives = 48/111 (43%), Gaps = 7/111 (6%)
 Frame = +3

Query: 3    RASPKVYYKSPPPPYYSPSPKVYYKSPPH-PHVCVCPP------PPPCYSPSPKVVYKSP 161
            ++SP  + +  PP     +P      PPH P +   PP      PP     SP    KS 
Sbjct: 972  KSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQ 1031

Query: 162  PPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PPP    S  PP  S  P     S PPP+  SP P+V   S PPP+ S  P
Sbjct: 1032 PPPSPVESVLPPVKSSPPHAPVISEPPPTKSSP-PQVPVTSEPPPAKSSPP 1081

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 40/116 (34%), Positives = 49/116 (42%), Gaps = 13/116 (11%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS-PPPPYVYN 182
           A+P       PPP    SP+   + P        P  P   +P P    K    PP  Y 
Sbjct: 450 AAPSTPTSHGPPPPEEESPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYG 509

Query: 183 SPPPPY--YSPSPKVYYKSPP----PPSYYSP------SPKVEYKSPPPPSYSPSP 314
           +PPPP   + P      K+PP    PP+ YSP      SP  E KSPP P+ S SP
Sbjct: 510 APPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSP 565

[151][TOP]
>UniRef100_Q2L049 Filamentous hemagglutinin/adhesin n=1 Tax=Bordetella avium 197N
            RepID=Q2L049_BORA1
          Length = 2621

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 51/118 (43%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVC-------VCPPPPPCYSPSPKVVYKSPPPP 170
            PKV    PPPP   P PKV    PP P          V PPPPP   P PKV    PPPP
Sbjct: 2349 PKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPP 2408

Query: 171  -------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
                        PPPP   P PKV    PPPP    P PKV+   PPPP   P PK +
Sbjct: 2409 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVK 2466

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 51/104 (49%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            PKV    PPPP   P PKV    PP       PPPPP   P PKV    PPPP     PP
Sbjct: 2398 PKVKKVDPPPPPPPPPPKVKKVDPP-------PPPPP---PPPKVKKVDPPPP-----PP 2442

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
            PP   P PKV    PPPP    P PKV+   PPPP   P PK +
Sbjct: 2443 PP---PPPKVKKVDPPPPPP-PPPPKVKKVDPPPPPPPPPPKVK 2482

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/97 (43%), Positives = 44/97 (45%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP   P PKV    PP P     PPPP      P      PPP      PPPP   P 
Sbjct: 2326 PPPPPPPPPPKVKKVDPPPP-----PPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2380

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
            PKV    PPPP    P PKV+   PPPP   P PK +
Sbjct: 2381 PKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVK 2417

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 50/110 (45%), Positives = 52/110 (47%), Gaps = 6/110 (5%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYY------KSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
            PKV    PPPP   P PKV          PP P V    PPPP   P PKV    PPPP 
Sbjct: 2335 PKVKKVDPPPP--PPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP- 2391

Query: 174  VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
                PPPP   P PKV    PPPP    P PKV+   PPPP   P PK +
Sbjct: 2392 ----PPPP---PPPKVKKVDPPPPP-PPPPPKVKKVDPPPPPPPPPPKVK 2433

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/117 (41%), Positives = 52/117 (44%), Gaps = 13/117 (11%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP------- 170
            PKV    PPPP   P PKV    PP       PPPPP   P PKV    PPPP       
Sbjct: 2414 PKVKKVDPPPPPPPPPPKVKKVDPP-------PPPPP--PPPPKVKKVDPPPPPPPPPPK 2464

Query: 171  YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP------PSYSPSPKTE 323
                 PPPP   P PKV    PPPP    P PKV+   PPP      P  +P PK +
Sbjct: 2465 VKKVDPPPPPPPPPPKVKKVDPPPPP--PPPPKVKKVDPPPKDEVDGPKPAPKPKAQ 2519

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 38/82 (46%), Positives = 39/82 (47%), Gaps = 3/82 (3%)
 Frame = +3

Query: 78   SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSPPPPYYSPSPKVYYKSPPPPS 248
            SPP P     PPPPP   P  K V   PPPP        PPPP   P PKV    PPPP 
Sbjct: 2320 SPPPPPP---PPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP 2376

Query: 249  YYSPSPKVEYKSPPPPSYSPSP 314
               P PKV+   PPPP   P P
Sbjct: 2377 -PPPPPKVKKVDPPPPPPPPPP 2397

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 43/99 (43%), Positives = 45/99 (45%), Gaps = 1/99 (1%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            PKV    PPPP   P PKV    PP       PPPPP   P PKV  K  PPP     PP
Sbjct: 2447 PKVKKVDPPPPPPPPPPKVKKVDPP-------PPPPP---PPPKVK-KVDPPP-----PP 2490

Query: 192  PPYYSPSPKVYYKSPPPPSYY-SPSPKVEYKSPPPPSYS 305
            P    P PKV    PPP      P P  + K+ P PS S
Sbjct: 2491 P----PPPKVKKVDPPPKDEVDGPKPAPKPKAQPRPSPS 2525

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 33/71 (46%), Positives = 35/71 (49%)
 Frame = +3

Query: 111  PPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP 290
            PPPP   P P      PPPP V    PPP   P PKV    PPPP    P PKV+   PP
Sbjct: 2321 PPPP--PPPPP---PPPPPPKVKKVDPPP-PPPPPKVKKVDPPPPP-PPPPPKVKKVDPP 2373

Query: 291  PPSYSPSPKTE 323
            PP   P PK +
Sbjct: 2374 PPPPPPPPKVK 2384

[152][TOP]
>UniRef100_Q8GD27 Adhesin FhaB n=1 Tax=Bordetella avium RepID=Q8GD27_BORAV
          Length = 2621

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 51/118 (43%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVC-------VCPPPPPCYSPSPKVVYKSPPPP 170
            PKV    PPPP   P PKV    PP P          V PPPPP   P PKV    PPPP
Sbjct: 2349 PKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPP 2408

Query: 171  -------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
                        PPPP   P PKV    PPPP    P PKV+   PPPP   P PK +
Sbjct: 2409 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVK 2466

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 51/104 (49%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            PKV    PPPP   P PKV    PP       PPPPP   P PKV    PPPP     PP
Sbjct: 2398 PKVKKVDPPPPPPPPPPKVKKVDPP-------PPPPP---PPPKVKKVDPPPP-----PP 2442

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
            PP   P PKV    PPPP    P PKV+   PPPP   P PK +
Sbjct: 2443 PP---PPPKVKKVDPPPPPP-PPPPKVKKVDPPPPPPPPPPKVK 2482

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/97 (43%), Positives = 44/97 (45%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP   P PKV    PP P     PPPP      P      PPP      PPPP   P 
Sbjct: 2326 PPPPPPPPPPKVKKVDPPPP-----PPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2380

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
            PKV    PPPP    P PKV+   PPPP   P PK +
Sbjct: 2381 PKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVK 2417

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 50/110 (45%), Positives = 52/110 (47%), Gaps = 6/110 (5%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYY------KSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
            PKV    PPPP   P PKV          PP P V    PPPP   P PKV    PPPP 
Sbjct: 2335 PKVKKVDPPPP--PPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP- 2391

Query: 174  VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
                PPPP   P PKV    PPPP    P PKV+   PPPP   P PK +
Sbjct: 2392 ----PPPP---PPPKVKKVDPPPPP-PPPPPKVKKVDPPPPPPPPPPKVK 2433

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/117 (41%), Positives = 52/117 (44%), Gaps = 13/117 (11%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP------- 170
            PKV    PPPP   P PKV    PP       PPPPP   P PKV    PPPP       
Sbjct: 2414 PKVKKVDPPPPPPPPPPKVKKVDPP-------PPPPP--PPPPKVKKVDPPPPPPPPPPK 2464

Query: 171  YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP------PSYSPSPKTE 323
                 PPPP   P PKV    PPPP    P PKV+   PPP      P  +P PK +
Sbjct: 2465 VKKVDPPPPPPPPPPKVKKVDPPPPP--PPPPKVKKVDPPPKDEVDGPKPAPKPKAQ 2519

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 38/82 (46%), Positives = 39/82 (47%), Gaps = 3/82 (3%)
 Frame = +3

Query: 78   SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---YVYNSPPPPYYSPSPKVYYKSPPPPS 248
            SPP P     PPPPP   P  K V   PPPP        PPPP   P PKV    PPPP 
Sbjct: 2320 SPPPPPP---PPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP 2376

Query: 249  YYSPSPKVEYKSPPPPSYSPSP 314
               P PKV+   PPPP   P P
Sbjct: 2377 -PPPPPKVKKVDPPPPPPPPPP 2397

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 43/99 (43%), Positives = 45/99 (45%), Gaps = 1/99 (1%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            PKV    PPPP   P PKV    PP       PPPPP   P PKV  K  PPP     PP
Sbjct: 2447 PKVKKVDPPPPPPPPPPKVKKVDPP-------PPPPP---PPPKVK-KVDPPP-----PP 2490

Query: 192  PPYYSPSPKVYYKSPPPPSYY-SPSPKVEYKSPPPPSYS 305
            P    P PKV    PPP      P P  + K+ P PS S
Sbjct: 2491 P----PPPKVKKVDPPPKDEVDGPKPAPKPKAQPRPSPS 2525

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 33/71 (46%), Positives = 35/71 (49%)
 Frame = +3

Query: 111  PPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP 290
            PPPP   P P      PPPP V    PPP   P PKV    PPPP    P PKV+   PP
Sbjct: 2321 PPPP--PPPPP---PPPPPPKVKKVDPPP-PPPPPKVKKVDPPPPP-PPPPPKVKKVDPP 2373

Query: 291  PPSYSPSPKTE 323
            PP   P PK +
Sbjct: 2374 PPPPPPPPKVK 2384

[153][TOP]
>UniRef100_B9G8N7 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9G8N7_ORYSJ
          Length = 1360

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/109 (45%), Positives = 52/109 (47%), Gaps = 6/109 (5%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVY------KSPPP 167
            +SP    KSPPPP     P    KSPP P   + PPPP    P P  V       KSPPP
Sbjct: 1143 SSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1202

Query: 168  PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P    SPPPP  SP P      PPPP   SP P     SPPPP  SP P
Sbjct: 1203 PAPVISPPPPVKSPPPPAPVILPPPP-VKSPPPPAPVISPPPPEKSPPP 1250

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/101 (48%), Positives = 50/101 (49%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P V   SPPPP  SP P      PP P +   PPP P  SP P V  KSPPPP     PP
Sbjct: 1138 PPVPVSSPPPPEKSPPPPAPVILPPPP-IKSPPPPAPVISPPPPV--KSPPPPAPVILPP 1194

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP  SP P     SPPPP   SP P      PPPP  SP P
Sbjct: 1195 PPVKSPPPPAPVISPPPP-VKSPPPPAPVILPPPPVKSPPP 1234

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/95 (46%), Positives = 45/95 (47%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            S PPP   P P     S P P     PPP P   P P +  KSPPPP    SPPPP  SP
Sbjct: 1127 SLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPI--KSPPPPAPVISPPPPVKSP 1184

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P      PPPP   SP P     SPPPP  SP P
Sbjct: 1185 PPPAPVILPPPP-VKSPPPPAPVISPPPPVKSPPP 1218

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 46/101 (45%), Positives = 46/101 (45%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P V   S PP   S  P      PP P V   PPP P  SP P    KSPPPP     PP
Sbjct: 1106 PSVPKASSPPTEKSLPPPATVSLPP-PTVKPLPPPVPVSSPPPPE--KSPPPPAPVILPP 1162

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP  SP P     SPPPP   SP P      PPPP  SP P
Sbjct: 1163 PPIKSPPPPAPVISPPPP-VKSPPPPAPVILPPPPVKSPPP 1202

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 40/96 (41%), Positives = 47/96 (48%)
 Frame = +3

Query: 27   KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
            KSPP   +  SP    KSPP P     PP P   SPSP   ++  PP  V +S PP    
Sbjct: 788  KSPPSEAHPTSPPPSEKSPPTPAEESSPPTPE-KSPSPPSGHEGTPPSPVKSSSPP---- 842

Query: 207  PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
              P+ +  SPPP    SP P+    SPPPP  SP P
Sbjct: 843  --PEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPP 876

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 47/104 (45%), Positives = 47/104 (45%), Gaps = 2/104 (1%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
            SP    KSPPPP     P    KSPP P   V  PPPP  SP P      PPPP    SP
Sbjct: 1176 SPPPPVKSPPPPAPVILPPPPVKSPPPP-APVISPPPPVKSPPPPAPVILPPPP--VKSP 1232

Query: 189  PPPYYSPSPKVYYKSPPP--PSYYSPSPKVEYKSPPPPSYSPSP 314
            PPP    SP    KSPPP  P   SP        P P S  PSP
Sbjct: 1233 PPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPSP 1276

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 48/117 (41%), Positives = 56/117 (47%), Gaps = 6/117 (5%)
 Frame = +3

Query: 12   PKVYYKSPPPPY-YSPSPKVYY----KSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV 176
            P   + SPP P  Y+PSP        KSPP PH     PP   +  SP    KSPP P  
Sbjct: 753  PPTSHTSPPTPEEYTPSPPKSSPPEEKSPP-PHSPEKSPPSEAHPTSPPPSEKSPPTPAE 811

Query: 177  YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVE-YKSPPPPSYSPSPKTEY*ISRLP 344
             +SPP P  SPSP   ++  PP    S SP  E + S PPP  S SP  E  +S  P
Sbjct: 812  ESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPP 868

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/105 (41%), Positives = 47/105 (44%), Gaps = 1/105 (0%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV-VYKSPPPPYVYNS 185
            SP    KSPP P    SP    KSP  P      PP P  S SP    + S PPP   +S
Sbjct: 798  SPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSS 857

Query: 186  PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            PPP  +  SP    KSPPPP   SP       SPPP   SP   T
Sbjct: 858  PPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHT 902

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 45/120 (37%), Positives = 50/120 (41%), Gaps = 4/120 (3%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPY----YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
            +SP    KSP PP       PSP      PP  HV   PPP    SP P+    SPPPP 
Sbjct: 813  SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVS-SPPPEKSSSPPPEAHVSSPPPPE 871

Query: 174  VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPLYE 353
               SPPPP     P +  +  PPP   SP       S PP   S  P T    S  P +E
Sbjct: 872  --KSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHE 929

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 45/103 (43%), Positives = 47/103 (45%), Gaps = 2/103 (1%)
 Frame = +3

Query: 12   PKVYYKSPPP--PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
            P+   KS PP  P  S  P V   S P P     PPP     P P V  K  PPP   +S
Sbjct: 1088 PETPEKSYPPSTPEESSPPSVPKASSP-PTEKSLPPPATVSLPPPTV--KPLPPPVPVSS 1144

Query: 186  PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PPPP  SP P      PPPP   SP P     SPPPP  SP P
Sbjct: 1145 PPPPEKSPPPPAPVILPPPP-IKSPPPPAPVISPPPPVKSPPP 1186

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 45/118 (38%), Positives = 53/118 (44%), Gaps = 15/118 (12%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP----PPCYSP---SPKVVYKSPPPP 170
            P+ +  SPPPP  SP P    KSPP     + PPP    PP ++P   SP      PPP 
Sbjct: 860  PEAHVSSPPPPEKSPPPPET-KSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPT 918

Query: 171  YVYNSPPPPYYSPSPKVYYKSPPPPSYYSP--------SPKVEYKSPPPPSYSPSPKT 320
                S PP +    P    KS PPP   SP        SP  E   PPP   SP+PK+
Sbjct: 919  PTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPP---SPTPKS 973

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 48/141 (34%), Positives = 58/141 (41%), Gaps = 36/141 (25%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---YSPSPKVYY----KSPPHPHVCVCPPPPPCYS------------ 131
            +P+    SPPPP    ++PSP        KSPP P      PPPP               
Sbjct: 653  TPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPP 712

Query: 132  -----PSPKVVYKSPPPPY--------VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSP-- 266
                 P+P+    SPPPP           +SPP     P P   + SPP P  Y+PSP  
Sbjct: 713  VEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPK 772

Query: 267  --KVEYKSPPPPSYSPSPKTE 323
                E KSPPP S   SP +E
Sbjct: 773  SSPPEEKSPPPHSPEKSPPSE 793

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 42/91 (46%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
 Frame = +3

Query: 27   KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP--PY 200
            KSPPPP    SP    KSPP P   + PPPP   SP P     SPPPP    SPPP  P 
Sbjct: 1198 KSPPPPAPVISPPPPVKSPPPPAPVILPPPP-VKSPPPPAPVISPPPP--EKSPPPAAPV 1254

Query: 201  YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
                P V    PP P    PSP    KS PP
Sbjct: 1255 ILSPPAVKSLPPPAPVSLPPSP---VKSLPP 1282

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 43/110 (39%), Positives = 54/110 (49%), Gaps = 8/110 (7%)
 Frame = +3

Query: 9   SPKVYYKSPPPPY--YSPSPKVYYKSPP---HPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
           SP   Y +PPPP   + P      K+PP    P     PP  P  SP P+   KSPP P 
Sbjct: 503 SPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEG--KSPPTPT 560

Query: 174 VYNSPP--PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP-PPSYSPSP 314
             +SPP  P  ++PSP    KS PP     P+P+ +   PP P  Y+PSP
Sbjct: 561 ASHSPPPVPEGHTPSPP---KSGPPAGESPPTPESKASPPPTPEEYTPSP 607

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 51/134 (38%), Positives = 59/134 (44%), Gaps = 22/134 (16%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---YSPSPKVYY----KSPPHPHVC-VCPPPPPCYSPSPKVVY---- 152
            +P+    SPPPP    ++PSP        KSPP P      PP P  Y+PSP        
Sbjct: 719  TPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEE 778

Query: 153  KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS----------Y 302
            KSPPP     SPP   +  SP    KSPP P+  S  P  E KSP PPS           
Sbjct: 779  KSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPE-KSPSPPSGHEGTPPSPVK 837

Query: 303  SPSPKTEY*ISRLP 344
            S SP  E  +S  P
Sbjct: 838  SSSPPPEAHVSSPP 851

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 46/117 (39%), Positives = 49/117 (41%), Gaps = 21/117 (17%)
 Frame = +3

Query: 27   KSPPPPYYSP-SPKVYYKSPPHPHVCVCPPPPPCYSPS-------PKVVYKSPPPPYVY- 179
            KS PP   SP +P+    SPP P      P PP  SP        P   + SPP P  Y 
Sbjct: 708  KSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYT 767

Query: 180  ----NSPPPPYYSPSPKVYYKSP--------PPPSYYSPSPKVEYKSPPPPSYSPSP 314
                 S PP   SP P    KSP        PPPS  SP    E  SPP P  SPSP
Sbjct: 768  PSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSP 824

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 46/112 (41%), Positives = 56/112 (50%), Gaps = 18/112 (16%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYY----KSPPHPHVCVCPPPPPC---YSPSP----KVVYKSPP-PPYV 176
           P P  Y+PSP        KSPP P      PPPP    ++PSP        KSPP P   
Sbjct: 598 PTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESK 657

Query: 177 YNSPPPPY---YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS---YSPSP 314
            +SPPPP    ++PSP    KS PP     P+P+ E  SPPPP+   + PSP
Sbjct: 658 ASSPPPPTPEGHTPSPP---KSTPPTEKSPPTPESESSSPPPPAPEGHMPSP 706

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 47/139 (33%), Positives = 57/139 (41%), Gaps = 33/139 (23%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP-PPCYSPSPKV----VYKSPPP 167
           +A P   Y  P  P  SP P+   KSPP P     PPP P  ++PSP        +SPP 
Sbjct: 532 QAEPPTEYSPPATPESSPPPEG--KSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPT 589

Query: 168 PYVYNSPPPP--YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS-------------- 299
           P    SPPP    Y+PSP    KS PP     P+P+ +  SPPPP+              
Sbjct: 590 PESKASPPPTPEEYTPSPP---KSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPP 646

Query: 300 ------------YSPSPKT 320
                        SP P T
Sbjct: 647 SEKSPPTPESKASSPPPPT 665

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 50/143 (34%), Positives = 63/143 (44%), Gaps = 39/143 (27%)
 Frame = +3

Query: 9    SPKVYYKSPPPPY---YSPSPKVYY----KSPPHPHVCVCPPPPPC---YSPSPKV---- 146
            +P+    SPPPP    ++PSP        KSPP P      PPPP    ++PSP      
Sbjct: 620  TPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPP 679

Query: 147  VYKSPPPPYVYNSPPPP------------------YYSPSPKVYYKSPPPPS--YYSPSP 266
              KSPP P   +S PPP                     P+P+    SPPPP+   ++PSP
Sbjct: 680  TEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSP 739

Query: 267  ----KVEYKSPP-PPSYSPSPKT 320
                  E KSPP PP+   SP T
Sbjct: 740  PKSSPPEEKSPPIPPTSHTSPPT 762

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 46/115 (40%), Positives = 52/115 (45%), Gaps = 9/115 (7%)
 Frame = +3

Query: 3    RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
            ++SP    KS PPP    S     KS P PH  V   PPP  S  P+V   S PPP   +
Sbjct: 1021 KSSPPPAEKSQPPPSPVESVLPPVKSSP-PHAPVISEPPPTKSSPPQVPVTSEPPP-AKS 1078

Query: 183  SPPPPYYSPSPKVYYKSPPP--PSYYSP-------SPKVEYKSPPPPSYSPSPKT 320
            SPP    SP P+   KS PP  P   SP       SP  E   PPP + S  P T
Sbjct: 1079 SPPHEPISP-PETPEKSYPPSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPT 1132

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 42/123 (34%), Positives = 47/123 (38%), Gaps = 21/123 (17%)
 Frame = +3

Query: 9    SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV-------VYKSPPP 167
            SP    KSPPPP     P    KSPP P   + PPPP   SP P           KS PP
Sbjct: 1208 SPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPE-KSPPPAAPVILSPPAVKSLPP 1266

Query: 168  PYVYNSPPPPYYSPSPKVYYKSPP--------------PPSYYSPSPKVEYKSPPPPSYS 305
            P   + PP P  S  P+     PP              P     P P+    S PPP+  
Sbjct: 1267 PAPVSLPPSPVKSLPPRAPVSLPPRVVKSLPPRAPVSLPQPAVKPFPQRAPVSLPPPAVK 1326

Query: 306  PSP 314
            P P
Sbjct: 1327 PLP 1329

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/111 (35%), Positives = 48/111 (43%), Gaps = 7/111 (6%)
 Frame = +3

Query: 3    RASPKVYYKSPPPPYYSPSPKVYYKSPPH-PHVCVCPP------PPPCYSPSPKVVYKSP 161
            ++SP  + +  PP     +P      PPH P +   PP      PP     SP    KS 
Sbjct: 972  KSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQ 1031

Query: 162  PPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PPP    S  PP  S  P     S PPP+  SP P+V   S PPP+ S  P
Sbjct: 1032 PPPSPVESVLPPVKSSPPHAPVISEPPPTKSSP-PQVPVTSEPPPAKSSPP 1081

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 40/116 (34%), Positives = 49/116 (42%), Gaps = 13/116 (11%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS-PPPPYVYN 182
           A+P       PPP    SP+   + P        P  P   +P P    K    PP  Y 
Sbjct: 450 AAPSTPTSHGPPPPEEESPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYG 509

Query: 183 SPPPPY--YSPSPKVYYKSPP----PPSYYSP------SPKVEYKSPPPPSYSPSP 314
           +PPPP   + P      K+PP    PP+ YSP      SP  E KSPP P+ S SP
Sbjct: 510 APPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSP 565

[154][TOP]
>UniRef100_Q9SPM0 Extensin-like protein n=1 Tax=Zea mays RepID=Q9SPM0_MAIZE
          Length = 1016

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 54/111 (48%), Positives = 56/111 (50%), Gaps = 9/111 (8%)
 Frame = +3

Query: 9   SPKVYYKSPPP--PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           SP     SPPP  P  SP P+V  KSPP P   V  PPPP  SP P     SPPP  +  
Sbjct: 537 SPPAPVASPPPEAPVSSPQPQV--KSPPPP-APVASPPPPMKSPPPPARVASPPP--LMK 591

Query: 183 SPPPPYYSPSPKVYYKSPPP-------PSYYSPSPKVEYKSPPPPSYSPSP 314
           SPPPP    SP    KSPPP       PS  SP P V   SPPPP  SP P
Sbjct: 592 SPPPPAPVASPPQPLKSPPPPVLWLSTPSVKSPPPPVPVASPPPPVKSPPP 642

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/126 (38%), Positives = 55/126 (43%), Gaps = 21/126 (16%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP---------------PPPPCYSPSP 140
           +SP+   KSPPPP    SP    KSPP P     P               PP P  SP P
Sbjct: 552 SSPQPQVKSPPPPAPVASPPPPMKSPPPPARVASPPPLMKSPPPPAPVASPPQPLKSPPP 611

Query: 141 KVVY------KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
            V++      KSPPPP    SPPPP  SP P     SP PP    P P     +PPP   
Sbjct: 612 PVLWLSTPSVKSPPPPVPVASPPPPVKSPPPLAPVSSPSPPVKLPPLPAPGKSTPPPEEE 671

Query: 303 SPSPKT 320
            P+P T
Sbjct: 672 KPTPPT 677

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/112 (43%), Positives = 53/112 (47%), Gaps = 7/112 (6%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVC-------PPPPPCYSPSPKVVYKSPP 164
           ASP    KSPPPP    SP    KSPP P + +        PPP P  SP P V  KSPP
Sbjct: 584 ASPPPLMKSPPPPAPVASPPQPLKSPPPPVLWLSTPSVKSPPPPVPVASPPPPV--KSPP 641

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
           P    +SP PP   P      KS PPP    P+P    KS PPP  S  P T
Sbjct: 642 PLAPVSSPSPPVKLPPLPAPGKSTPPPEEEKPTPPTPVKSSPPPEKSLPPPT 693

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 45/106 (42%), Positives = 48/106 (45%), Gaps = 9/106 (8%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV-------VYKSPPPPYVYNSPP 191
            PP P   P P+V    PP P   +  PPPP  SP P           KSPPPP   +SPP
Sbjct: 874  PPAPVSLPPPEVKSSPPPAP---ISSPPPPAKSPPPPAPMSSLPPPVKSPPPPAPVSSPP 930

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPS--PKVEYKSPPPPSYSPSPKTE 323
            PP  SP P     SPPP     PS  P     SPPP   S  PK E
Sbjct: 931  PPMKSPPPPAPISSPPPAPVKPPSLPPPAPVSSPPPAVTSAPPKKE 976

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 45/102 (44%), Positives = 47/102 (46%)
 Frame = +3

Query: 3    RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
            + SP     S PPP   P P     S P P V   PPP P  SP P    KSPPPP   +
Sbjct: 854  KTSPPPAPVSSPPPTPKPLPPPAPVSLPPPEVKSSPPPAPISSPPPPA--KSPPPPAPMS 911

Query: 183  SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            S PPP  SP P     SPPPP   SP P     SPPP    P
Sbjct: 912  SLPPPVKSPPPPAPVSSPPPP-MKSPPPPAPISSPPPAPVKP 952

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 45/104 (43%), Positives = 50/104 (48%)
 Frame = +3

Query: 3    RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
            ++SP +   S PP     SP     S P P     PPP P   P P+V  KS PPP   +
Sbjct: 838  KSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKPLPPPAPVSLPPPEV--KSSPPPAPIS 895

Query: 183  SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SPPPP  SP P     S PPP   SP P     SPPPP  SP P
Sbjct: 896  SPPPPAKSPPPPAPMSSLPPP-VKSPPPPAPVSSPPPPMKSPPP 938

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 45/95 (47%), Positives = 46/95 (48%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPP      P     SPP P V   PP  P  SP P+V  KSPPPP    SPPPP  SP
Sbjct: 521 SPPPAAVVLPPPAKTPSPPAP-VASPPPEAPVSSPQPQV--KSPPPPAPVASPPPPMKSP 577

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     S PPP   SP P     SPP P  SP P
Sbjct: 578 PPPARVAS-PPPLMKSPPPPAPVASPPQPLKSPPP 611

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 52/135 (38%), Positives = 56/135 (41%), Gaps = 31/135 (22%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVY------KSPPP 167
           ASP    KSPPPP    SP    KSPP P   V  PP P  SP P V++      KSPPP
Sbjct: 568 ASPPPPMKSPPPPARVASPPPLMKSPPPP-APVASPPQPLKSPPPPVLWLSTPSVKSPPP 626

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP------------------------SPKVE 275
           P    SPPPP  SP P     SP PP    P                        SP  E
Sbjct: 627 PVPVASPPPPVKSPPPLAPVSSPSPPVKLPPLPAPGKSTPPPEEEKPTPPTPVKSSPPPE 686

Query: 276 YKSPPPP-SYSPSPK 317
              PPP  + SP P+
Sbjct: 687 KSLPPPTLTTSPPPQ 701

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 46/112 (41%), Positives = 54/112 (48%), Gaps = 9/112 (8%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPY-YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY- 179
           ASP    KSPPPP  +  +P V  KSPP P V V  PPPP  SP P     SP PP    
Sbjct: 600 ASPPQPLKSPPPPVLWLSTPSV--KSPPPP-VPVASPPPPVKSPPPLAPVSSPSPPVKLP 656

Query: 180 -------NSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                  ++PPP    P+P    KS PPP    P P +   + PPP   P+P
Sbjct: 657 PLPAPGKSTPPPEEEKPTPPTPVKSSPPPEKSLPPPTL--TTSPPPQEKPTP 706

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/104 (42%), Positives = 47/104 (45%), Gaps = 3/104 (2%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P     SPPPP  SP P     S P P   V  PPPP    SP    KSPPPP   +SPP
Sbjct: 890  PPAPISSPPPPAKSPPPPAPMSSLPPP---VKSPPPPAPVSSPPPPMKSPPPPAPISSPP 946

Query: 192  P-PYYSPS--PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P P   PS  P     SPPP    +P  K E  + PP    P P
Sbjct: 947  PAPVKPPSLPPPAPVSSPPPAVTSAPPKKEEDSTAPPAEALPPP 990

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 45/106 (42%), Positives = 51/106 (48%), Gaps = 2/106 (1%)
 Frame = +3

Query: 6   ASPKVYYKSPPP--PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           ASP    KSPPP  P  SPSP V  K PP P      PPP    P+P    KS PPP   
Sbjct: 631 ASPPPPVKSPPPLAPVSSPSPPV--KLPPLPAPGKSTPPPEEEKPTPPTPVKSSPPP--E 686

Query: 180 NSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
            S PPP  + SP    K  PP +   P P    ++ PPPS S  P+
Sbjct: 687 KSLPPPTLTTSPPPQEKPTPPSTPSKPPPPSPVETLPPPSKSSPPE 732

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 45/110 (40%), Positives = 48/110 (43%), Gaps = 14/110 (12%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPP--HPHVCVCPPP----PPCYSPSPKVVYKSPPPPYVYNSP 188
           +SPP   Y P+P V  KSPP   P      PP    PP  S  P    KS PPP     P
Sbjct: 471 RSPPADEYIPTPPVPAKSPPGTSPPASRGAPPLQAQPPAASSPPATPVKSSPPPAAVVLP 530

Query: 189 PPPYYSPSPKVYYKSPPP--------PSYYSPSPKVEYKSPPPPSYSPSP 314
           PP   +PSP     SPPP        P   SP P     SPPPP  SP P
Sbjct: 531 PPA-KTPSPPAPVASPPPEAPVSSPQPQVKSPPPPAPVASPPPPMKSPPP 579

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 44/109 (40%), Positives = 49/109 (44%), Gaps = 6/109 (5%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP------SPKVVYKSPPP 167
            +SP    KS PP     SP    K+ P P     PPP P  SP      SP  V K+ PP
Sbjct: 799  SSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTSPP 858

Query: 168  PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P   +SPPP    P P     S PPP   S  P     SPPPP+ SP P
Sbjct: 859  PAPVSSPPPT-PKPLPPPAPVSLPPPEVKSSPPPAPISSPPPPAKSPPP 906

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/107 (35%), Positives = 47/107 (43%), Gaps = 12/107 (11%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPP-----PPPCYSPSPKVVYKSPPPPYVYNSPPP 194
           +PPP    P+P    KS P P   + PP     PPP   P+P      PPPP    + PP
Sbjct: 665 TPPPEEEKPTPPTPVKSSPPPEKSLPPPTLTTSPPPQEKPTPPSTPSKPPPPSPVETLPP 724

Query: 195 PYYSPSPKVYYKSPP-------PPSYYSPSPKVEYKSPPPPSYSPSP 314
           P  S  P+    SPP       PP+  S  P ++   PP P  SP P
Sbjct: 725 PSKSSPPEEPVSSPPQAPKSSSPPAPVSSPPPLKSSPPPVPESSPPP 771

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 45/120 (37%), Positives = 50/120 (41%), Gaps = 21/120 (17%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP------ 167
            +SP    KSPPPP    S     KSPP P   V  PPPP  SP P     SPPP      
Sbjct: 895  SSPPPPAKSPPPPAPMSSLPPPVKSPPPP-APVSSPPPPMKSPPPPAPISSPPPAPVKPP 953

Query: 168  ----PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKV-----------EYKSPPPPSY 302
                P   +SPPP   S  PK    S  PP+   P P             +Y SPPPP +
Sbjct: 954  SLPPPAPVSSPPPAVTSAPPKKEEDSTAPPAEALPPPSFNDIILPPIMANKYASPPPPLF 1013

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 44/109 (40%), Positives = 47/109 (43%), Gaps = 6/109 (5%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP------PPY 173
            P V   SPPP   S  P     SPP       PPP P  SP P     SPP      PP 
Sbjct: 762  PPVPESSPPPTPKSSPPLAPVSSPPQVEK-TSPPPAPVSSP-PPTPKSSPPLAPVSSPPQ 819

Query: 174  VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            V  + PPP    SP    KS PP +  S  P+VE  SPPP   S  P T
Sbjct: 820  VEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPT 868

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/99 (41%), Positives = 43/99 (43%), Gaps = 6/99 (6%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP------SPKVVYKSPPPPYVYNSPP 191
            SPP P  SP P    KS P P     PPP P  SP      SP  V K+ PPP   +SPP
Sbjct: 746  SPPAPVSSPPP---LKSSPPPVPESSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPP 802

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P   S  P     SPP     SP P      PP P  SP
Sbjct: 803  PTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSP 841

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/119 (35%), Positives = 49/119 (41%), Gaps = 13/119 (10%)
 Frame = +3

Query: 3    RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
            ++ P     + PPP   P+P      PP P      PPP   SP P+    SPP     +
Sbjct: 687  KSLPPPTLTTSPPPQEKPTPPSTPSKPPPPSPVETLPPPSKSSP-PEEPVSSPPQAPKSS 745

Query: 183  SPPPPYYSP------SPKVYYKSPPPPSYYSP-------SPKVEYKSPPPPSYSPSPKT 320
            SPP P  SP       P V   SPPP    SP        P+VE  SPPP   S  P T
Sbjct: 746  SPPAPVSSPPPLKSSPPPVPESSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPT 804

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 41/114 (35%), Positives = 50/114 (43%), Gaps = 7/114 (6%)
 Frame = +3

Query: 3    RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
            ++SP +   S PP     SP     S P P     PP  P  SP P+V   SPPP  V +
Sbjct: 774  KSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSP-PQVEKTSPPPAPVSS 832

Query: 183  SPPPPYYSP-------SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
             PP P  SP        P+V   SPPP    SP P  +   PP P   P P+ +
Sbjct: 833  PPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKPLPPPAPVSLPPPEVK 886

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 43/118 (36%), Positives = 47/118 (39%), Gaps = 14/118 (11%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCP-------PPPPCYSPSPKVVYKSPPPP 170
            P    K PPP      P     SPP   V   P       PP P  SP P    KS PPP
Sbjct: 707  PSTPSKPPPPSPVETLPPPSKSSPPEEPVSSPPQAPKSSSPPAPVSSPPP---LKSSPPP 763

Query: 171  YVYNSPPP-PYYSP------SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
               +SPPP P  SP      SP    K+ PPP+  S  P     SPP    S  P+ E
Sbjct: 764  VPESSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVE 821

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/104 (37%), Positives = 44/104 (42%), Gaps = 11/104 (10%)
 Frame = +3

Query: 39  PPYYSPSPKVYYKSPPHPHVCVCP----PPPPCYSPSPKVVYKSPP---PPYVYNSPP-- 191
           PP  SP P       P P     P    PP   Y P+P V  KSPP   PP    +PP  
Sbjct: 445 PPDVSPEPLPEPSPVPAPAPMRMPTLRSPPADEYIPTPPVPAKSPPGTSPPASRGAPPLQ 504

Query: 192 --PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
             PP  S  P    KS PPP+     P  +  SPP P  SP P+
Sbjct: 505 AQPPAASSPPATPVKSSPPPAAVVLPPPAKTPSPPAPVASPPPE 548

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 43/115 (37%), Positives = 49/115 (42%), Gaps = 20/115 (17%)
 Frame = +3

Query: 36   PPPYYSPSPKVYYKSPPHPHVCVCPP-----PPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
            PPP  S  P+    SPP       PP     PPP  S SP  V +S PPP   +SPP   
Sbjct: 723  PPPSKSSPPEEPVSSPPQAPKSSSPPAPVSSPPPLKS-SPPPVPESSPPPTPKSSPPLAP 781

Query: 201  YSPSPKVYYKSPPP-------PSY--------YSPSPKVEYKSPPPPSYSPSPKT 320
             S  P+V   SPPP       P+          S  P+VE  SPPP   S  P T
Sbjct: 782  VSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPT 836

[155][TOP]
>UniRef100_B9RL73 LRX2, putative n=1 Tax=Ricinus communis RepID=B9RL73_RICCO
          Length = 766

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 60/156 (38%), Positives = 67/156 (42%), Gaps = 48/156 (30%)
 Frame = +3

Query: 3   RASPKVYYKSPPPP----YYSPSPKVYYKS--PPHP--------HVCVCPPPPPCYSPSP 140
           R SPK +   PPPP      SP P  +Y S  PP P        H    PPPP  Y+P+P
Sbjct: 465 RVSPKTHLPPPPPPPPVVEQSPPPPAHYHSYAPPPPTKKVSPSTHHAPPPPPPVDYTPTP 524

Query: 141 KVVYKSPPPPYVYNSPPPPYYSPSPKVYYK-------SPPPP---SYYS---------PS 263
           K    SPPPP  Y   PP + SP P  YY        SPPPP    Y S         P 
Sbjct: 525 K---HSPPPPVEYTPSPPKHSSPPPVEYYPPPYQHQTSPPPPPPVQYQSPPYHHKPPPPP 581

Query: 264 PKVEYKS---------PPPPSYS------PSPKTEY 326
           P +EY+S         PPPP Y       P PK EY
Sbjct: 582 PPIEYQSPPYQHKTSPPPPPGYDTYSSPPPPPKNEY 617

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 50/114 (43%), Positives = 63/114 (55%), Gaps = 10/114 (8%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYY---KSPPHPHVCVCP----PPPPCYSPSPKVVYKSP 161
           ++SP      PPPP  +P+ K Y+     PP P   V P    PPPP   P P VV +SP
Sbjct: 431 KSSPSTRSHPPPPPPQTPA-KSYHPPPSPPPPPTKRVSPKTHLPPPP---PPPPVVEQSP 486

Query: 162 PPPYVYNS--PPPPYYSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSYSPSP 314
           PPP  Y+S  PPPP    SP  ++  PPPP   Y+P+PK  +  PPP  Y+PSP
Sbjct: 487 PPPAHYHSYAPPPPTKKVSPSTHHAPPPPPPVDYTPTPK--HSPPPPVEYTPSP 538

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 50/120 (41%), Positives = 56/120 (46%), Gaps = 15/120 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P V Y   PP + SP P  YY  PP+ H    PPPPP    SP   +K PPPP     PP
Sbjct: 530 PPVEYTPSPPKHSSPPPVEYYP-PPYQHQTSPPPPPPVQYQSPPYHHKPPPPP-----PP 583

Query: 192 PPYYSPSPKVYYKSPPPPSYYS------PSPKVEYKSPPPPSYS---------PSPKTEY 326
             Y SP P  +  SPPPP  Y       P PK EY   PPP++          P PK EY
Sbjct: 584 IEYQSP-PYQHKTSPPPPPGYDTYSSPPPPPKNEYAHSPPPTHGHYPPKRESPPPPKNEY 642

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 45/114 (39%), Positives = 54/114 (47%), Gaps = 12/114 (10%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP----YV 176
           SP  ++K PPPP     P + Y+SPP+ H    PPPPP Y       Y SPPPP    Y 
Sbjct: 570 SPPYHHKPPPPP-----PPIEYQSPPYQHK-TSPPPPPGYD-----TYSSPPPPPKNEYA 618

Query: 177 YNSPPPPYY--------SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           + SPPP +          P PK  Y   PPP++    PK E   PPPP     P
Sbjct: 619 H-SPPPTHGHYPPKRESPPPPKNEYTHSPPPTHGHYPPKRESPPPPPPPPPQEP 671

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 44/114 (38%), Positives = 49/114 (42%), Gaps = 12/114 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHP--------HVCVCPPPPPCYSPSPKVVYKSPPP 167
           P V    PPPP    SP      PP P        H    PPPPP    SPK     PPP
Sbjct: 418 PFVKPSPPPPPTSKSSPSTRSHPPPPPPQTPAKSYHPPPSPPPPPTKRVSPKTHLPPPPP 477

Query: 168 P--YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP--SYSPSPK 317
           P   V  SPPPP +      Y+   PPP     SP   +  PPPP   Y+P+PK
Sbjct: 478 PPPVVEQSPPPPAH------YHSYAPPPPTKKVSPSTHHAPPPPPPVDYTPTPK 525

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 41/105 (39%), Positives = 53/105 (50%), Gaps = 14/105 (13%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSP-PHPHVCVCPPP-PPCYSPSPKVVYKSPPPP--YVYNSPPP 194
           +SPPPP   P  + ++  P P P  C+  PP PP  +PS       PPPP    ++ P P
Sbjct: 658 ESPPPPPPPPPQEPFHPLPSPPPTGCITTPPSPPSSTPSYHHSPSPPPPPPEQHWHYPTP 717

Query: 195 PYYS-------PSPKVYYKSPPPPSYYSPSPK---VEYKSPPPPS 299
           P YS       P P   + SPPPP+  +P P    V Y SPPPP+
Sbjct: 718 PSYSHHQSPPPPPPLSPFPSPPPPADNTPLPPIVGVSYASPPPPT 762

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 41/112 (36%), Positives = 49/112 (43%), Gaps = 11/112 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPP-----PCYSPSPKVVYKSPPPP-- 170
           PK  Y   PPP +   P      PP P     PPPP     P  SP P     +PP P  
Sbjct: 638 PKNEYTHSPPPTHGHYPPKRESPPPPP-----PPPPQEPFHPLPSPPPTGCITTPPSPPS 692

Query: 171 ---YVYNSPPPPYYSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSYSPSP 314
                ++SP PP   P P+ ++  P PPSY +  SP      PPPP  SP P
Sbjct: 693 STPSYHHSPSPP--PPPPEQHWHYPTPPSYSHHQSP------PPPPPLSPFP 736

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/85 (42%), Positives = 42/85 (49%), Gaps = 2/85 (2%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           +S   Y+ SP PP   P    +Y +PP       PPPPP  SP P     SPPPP   N+
Sbjct: 692 SSTPSYHHSPSPPPPPPEQHWHYPTPPSYSHHQSPPPPPPLSPFP-----SPPPP-ADNT 745

Query: 186 PPPPYYSPSPKVYYKSPPPPS--YY 254
           P PP       V Y SPPPP+  YY
Sbjct: 746 PLPPIVG----VSYASPPPPTIPYY 766

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 44/115 (38%), Positives = 51/115 (44%), Gaps = 17/115 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS---------PSPK-VYYKSPP-----HPHVCVCPPPPPCYSP-SPK 143
           PK  Y   PPP +          P PK  Y  SPP     +P     PPPPP   P  P 
Sbjct: 613 PKNEYAHSPPPTHGHYPPKRESPPPPKNEYTHSPPPTHGHYPPKRESPPPPPPPPPQEPF 672

Query: 144 VVYKSPPPPYVYNSPP-PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
               SPPP     +PP PP  +PS   Y+ SP PP    P P+  +  P PPSYS
Sbjct: 673 HPLPSPPPTGCITTPPSPPSSTPS---YHHSPSPP---PPPPEQHWHYPTPPSYS 721

[156][TOP]
>UniRef100_A8MQW1 Uncharacterized protein At1g44191.1 n=1 Tax=Arabidopsis thaliana
           RepID=A8MQW1_ARATH
          Length = 359

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 55/111 (49%), Positives = 58/111 (52%), Gaps = 10/111 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPP---CYSPSPKVVYKSPP 164
           P+   KSPPPP  S  P +  KSPP P     PP      PPP      PSPK   KSPP
Sbjct: 110 PRTPKKSPPPPKPSSPPPIPKKSPPPPKPSSPPPTPKKSPPPPKPSSPPPSPK---KSPP 166

Query: 165 PPYVYNSPPPPYY-SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP    SPP P    P+PK    SPP PS   PSPK   KSPPPP  SPSP
Sbjct: 167 PPKPSPSPPKPSTPPPTPKKSPPSPPKPSSPPPSPK---KSPPPPKPSPSP 214

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 50/110 (45%), Positives = 54/110 (49%), Gaps = 7/110 (6%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP-------P 164
           A+  + Y SPP P  SP P      PP P      PP P  SP P+   KSP       P
Sbjct: 67  AAVSISYPSPPHPP-SPKPPTPSSRPPSPLSPKKSPPSPKPSPPPRTPKKSPPPPKPSSP 125

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP    SPPPP  S  P    KSPPPP   SP P  + KSPPPP  SPSP
Sbjct: 126 PPIPKKSPPPPKPSSPPPTPKKSPPPPKPSSPPPSPK-KSPPPPKPSPSP 174

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 52/111 (46%), Positives = 55/111 (49%), Gaps = 8/111 (7%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCV-------CPPPPPCYSPSPKVVYKSPPP 167
           SPK   KSPP P  SP P+   KSPP P            PPPP   SP P    KSPPP
Sbjct: 96  SPK---KSPPSPKPSPPPRTPKKSPPPPKPSSPPPIPKKSPPPPKPSSP-PPTPKKSPPP 151

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY-SPSPK 317
           P   + PP P  SP P     SPP PS   P+PK    SPP PS   PSPK
Sbjct: 152 PKPSSPPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPPSPPKPSSPPPSPK 202

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 50/115 (43%), Positives = 51/115 (44%), Gaps = 12/115 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-----PPYV 176
           P    KSPPPP  S  P    KSPP P     PP P    P+PK    SPP     PP  
Sbjct: 142 PPTPKKSPPPPKPSSPPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPPSPPKPSSPPPSP 201

Query: 177 YNSPPPPYYSPSPK-------VYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
             SPPPP  SPSP           KSPPPP    P PK     P PP   PSP T
Sbjct: 202 KKSPPPPKPSPSPPKPSTPPPTPKKSPPPPKPSQPPPK-----PSPPRRKPSPPT 251

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 41/87 (47%), Positives = 43/87 (49%), Gaps = 2/87 (2%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPP--PCYSPSPKVVYKSPPPPYVYN 182
           SPK   KSPPPP  SPSP      PP P     PP P  P   PSP     SPP P    
Sbjct: 200 SPK---KSPPPPKPSPSPPKPSTPPPTPKKSPPPPKPSQPPPKPSPPRRKPSPPTPKPST 256

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPS 263
           +PP P  SP      KSPPPP+  SPS
Sbjct: 257 TPPSPKPSPPRPTPKKSPPPPTTPSPS 283

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/107 (40%), Positives = 48/107 (44%), Gaps = 3/107 (2%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           ++ P     S PPP     PK   KSPP P     PP P    P+PK   KSPPPP    
Sbjct: 186 KSPPSPPKPSSPPPS----PK---KSPPPPKPSPSPPKPSTPPPTPK---KSPPPPKPSQ 235

Query: 183 SPP---PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP   PP   PSP     S  PPS     P+   K  PPP  +PSP
Sbjct: 236 PPPKPSPPRRKPSPPTPKPSTTPPSPKPSPPRPTPKKSPPPPTTPSP 282

[157][TOP]
>UniRef100_Q9FFW5 Similarity to protein kinase n=1 Tax=Arabidopsis thaliana
           RepID=Q9FFW5_ARATH
          Length = 681

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/103 (44%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYY--SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           P     SPPPP    SP P     +PP P   V PPPPP  SPSP     + PPP    S
Sbjct: 81  PPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPP--KPS 138

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P PP  +PSP     SPP PS  +P+P      PPPP+ S SP
Sbjct: 139 PSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASP 181

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 51/123 (41%), Positives = 57/123 (46%), Gaps = 17/123 (13%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP----- 167
           ++ P V   SPPPP  S SP      PP P V   PPP    SP P VV  SPPP     
Sbjct: 46  QSPPPVVSSSPPPPVVS-SPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPAT 104

Query: 168 -----PYVYNSPPPPYYSPSPKVYYKSPPPPSYY------SPSPKVEYKSPPPPSYS-PS 311
                P   + PPPP  SPSP     + PPP         +PSP  E  SPP PS S P+
Sbjct: 105 TPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPT 164

Query: 312 PKT 320
           P T
Sbjct: 165 PTT 167

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 47/106 (44%), Positives = 50/106 (47%), Gaps = 9/106 (8%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVV-------YKSPPPPYVYNSPP 191
           PP P  SP P V   S P P V   PPP     PSP V+         SPPPP V  SPP
Sbjct: 41  PPSPPQSPPPVV--SSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPP 98

Query: 192 P--PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           P  P  +P       SPPPP   SPSP     + PPP  SPSP  E
Sbjct: 99  PSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGE 144

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 47/99 (47%), Positives = 51/99 (51%), Gaps = 4/99 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP-PYVYNSPPPPY-Y 203
           +PPP    PSP    +SPP P V   PPPP   SP P     SPPP P V  SPPP    
Sbjct: 34  APPPVTPPPSPP---QSPP-PVVSSSPPPPVVSSPPPS---SSPPPSPPVITSPPPTVAS 86

Query: 204 SPSPKVYYKSPPP--PSYYSPSPKVEYKSPPPPSYSPSP 314
           SP P V   SPPP  P+   P+P      PPPP  SPSP
Sbjct: 87  SPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSP 125

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 42/95 (44%), Positives = 48/95 (50%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           +PPP    P+      S P P   V PPP P  SP P VV  SPPPP V + PP     P
Sbjct: 21  APPPLQTQPTTP----SAPPP---VTPPPSPPQSPPP-VVSSSPPPPVVSSPPPSSSPPP 72

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           SP V   SPPP    SP P V   SPPP + + +P
Sbjct: 73  SPPV-ITSPPPTVASSPPPPVVIASPPPSTPATTP 106

[158][TOP]
>UniRef100_C5XFE4 Putative uncharacterized protein Sb03g042800 n=1 Tax=Sorghum
           bicolor RepID=C5XFE4_SORBI
          Length = 401

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 51/121 (42%), Positives = 60/121 (49%), Gaps = 13/121 (10%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPP----PPPCYS-PSPKVVYKSPPPPYVYNSP 188
           Y SPP PY  PSP   +KSPP P+    PP    PPP Y  PSP   Y   PPPY  + P
Sbjct: 185 YSSPPLPYQYPSPPAIHKSPPLPYQYSPPPSNQLPPPAYQYPSPPQNYYISPPPYQQSMP 244

Query: 189 PPPYYSPSPKVYYKSP-------PPPSYY-SPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           P  Y +P      KSP       PPP YY SP P+ ++   PPP     P   Y I++ P
Sbjct: 245 PNNYQTPPTSQGTKSPVQPHKYLPPPYYYNSPPPQHQHNYVPPPLVYQYPPPPY-INKSP 303

Query: 345 L 347
           L
Sbjct: 304 L 304

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 48/115 (41%), Positives = 56/115 (48%), Gaps = 16/115 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYY--------KSPPHPHVCVCPPPPPCY-SPSPKVVYKSPP 164
           P+ YY SPPP   S  P  Y         KSP  PH  +  PPP  Y SP P+  +   P
Sbjct: 229 PQNYYISPPPYQQSMPPNNYQTPPTSQGTKSPVQPHKYL--PPPYYYNSPPPQHQHNYVP 286

Query: 165 PPYVYNSPPPPYYSPSPKV-------YYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           PP VY  PPPPY + SP +       Y+ + PP   YSP P     SPPP  YSP
Sbjct: 287 PPLVYQYPPPPYINKSPLLPSSPVTPYHYNSPPTYQYSPPPYNYLSSPPPAQYSP 341

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 46/121 (38%), Positives = 52/121 (42%), Gaps = 30/121 (24%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPP--HPHVCVCPP-----PPPCYSPSPKVVYKSPPPPYVYNS 185
           KSP  P+    P  YY SPP  H H  V PP     PPP Y     ++  SP  PY YNS
Sbjct: 258 KSPVQPHKYLPPPYYYNSPPPQHQHNYVPPPLVYQYPPPPYINKSPLLPSSPVTPYHYNS 317

Query: 186 PPPPYYSPSPKVYYKSPPPPSY-----------------------YSPSPKVEYKSPPPP 296
           PP   YSP P  Y  SPPP  Y                        SP P  +Y +PPPP
Sbjct: 318 PPTYQYSPPPYNYLSSPPPAQYSPPLPPNAPKHLHPNAPHAKSPPASPQPLYQYNTPPPP 377

Query: 297 S 299
           +
Sbjct: 378 N 378

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/105 (41%), Positives = 51/105 (48%), Gaps = 7/105 (6%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           P  PY SP     Y SPP  H    PP P  YSP P    + PPP Y Y SPP  YY  S
Sbjct: 181 PIHPYSSPPLPYQYPSPPAIH--KSPPLPYQYSPPPS--NQLPPPAYQYPSPPQNYYI-S 235

Query: 213 PKVYYKSPPPPSYYSP-------SPKVEYKSPPPPSYSPSPKTEY 326
           P  Y +S PP +Y +P       SP   +K  PPP Y  SP  ++
Sbjct: 236 PPPYQQSMPPNNYQTPPTSQGTKSPVQPHKYLPPPYYYNSPPPQH 280

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 39/96 (40%), Positives = 49/96 (51%), Gaps = 8/96 (8%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSP-----SPKVVYKSPPPPYVYNSPPP 194
           SP  PY+  SP  Y  SPP P+  +  PPP  YSP     +PK ++ + P      SPP 
Sbjct: 308 SPVTPYHYNSPPTYQYSPP-PYNYLSSPPPAQYSPPLPPNAPKHLHPNAPHA---KSPPA 363

Query: 195 PYYSPSPKVYYKSPPPPSYYSPS---PKVEYKSPPP 293
              SP P   Y +PPPP+   PS   P   Y+SPPP
Sbjct: 364 ---SPQPLYQYNTPPPPNDVMPSTMPPLHSYQSPPP 396

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 31/65 (47%), Positives = 38/65 (58%), Gaps = 1/65 (1%)
 Frame = +3

Query: 153 KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS-PSPKTEY* 329
           ++ PP + Y+SPP PY  PSP   +KSPP P  YSP P  +    PPP+Y  PSP   Y 
Sbjct: 177 QTQPPIHPYSSPPLPYQYPSPPAIHKSPPLPYQYSPPPSNQL---PPPAYQYPSPPQNYY 233

Query: 330 ISRLP 344
           IS  P
Sbjct: 234 ISPPP 238

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 32/73 (43%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 111 PPPPCYSPSPKVVYKSPPPPYVYNSPPPPY-YSPSPKVYYKSPPPPSYYSPSPKVEYKSP 287
           PP   YS SP + Y+ P PP ++ SPP PY YSP P       PPP+Y  PSP   Y   
Sbjct: 180 PPIHPYS-SPPLPYQYPSPPAIHKSPPLPYQYSPPPS---NQLPPPAYQYPSPPQNYYIS 235

Query: 288 PPPSYSPSPKTEY 326
           PPP     P   Y
Sbjct: 236 PPPYQQSMPPNNY 248

[159][TOP]
>UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA
          Length = 464

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/103 (47%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPP--PCYSPSPKVVYKSPPPPYVYNS 185
           P+     PPPP   PSP     SPP P     PPPP  P  SP P     SPPPP    S
Sbjct: 304 PQPVSSPPPPPPPRPSP-----SPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPS 358

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP  SP P     SPPPP   SP P      PPPPS  PSP
Sbjct: 359 PPPPVVSPPPPPPRASPPPPPASSPPPP---PRPPPPSPPPSP 398

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/96 (52%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPP-PCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP  SP P      PP P V   PPPP P  SP P      PPPP    SPPPP  S
Sbjct: 281 SPPPPVASPPP------PPPPRVSPSPPPPQPVSSPPP------PPPPRPSPSPPPPRSS 328

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PSP     SPPPP   SP P     SPPPP  SPSP
Sbjct: 329 PSPPP--PSPPPP---SPPPPRPSPSPPPPRSSPSP 359

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/99 (47%), Positives = 49/99 (49%), Gaps = 4/99 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SPSP      PP P     PPP P  SP P     SPPPP V   PPPP  SP
Sbjct: 321 SPPPPRSSPSPPPPSPPPPSP-----PPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASP 375

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS----PSP 314
            P      PPPP    PSP     SPPPP+ +    PSP
Sbjct: 376 PPPPASSPPPPPRPPPPSPP---PSPPPPATAAANPPSP 411

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 47/106 (44%), Positives = 48/106 (45%), Gaps = 12/106 (11%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP------------PPPYV 176
           PPPP  SPSP      PP P     PPPPP  SPSP     SP            PPP  
Sbjct: 292 PPPPRVSPSPP-----PPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRP 346

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             SPPPP  SPSP     SPPPP   +  P     SPPPP   P P
Sbjct: 347 SPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPP 392

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 47/111 (42%), Positives = 50/111 (45%), Gaps = 10/111 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSP-------PHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           P+V    PPP   S SP    +SP       P P +   PP P    P P  V  SPPPP
Sbjct: 226 PRVSTSPPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVPPSPPPP 285

Query: 171 YVYNSPPPP---YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                PPPP     SP P     SPPPP    PSP     SPPPP  SPSP
Sbjct: 286 VASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSP-----SPPPPRSSPSP 331

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 45/109 (41%), Positives = 50/109 (45%), Gaps = 14/109 (12%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY-- 203
           SPPPP  SPSP     SPP P     PPPPP  SP P      PPPP    SPPPP    
Sbjct: 349 SPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPP---PRPPPPSPPPSPPPPATAA 405

Query: 204 ----SPSPK--------VYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
               SP+P         +  + PPPP     +P  +Y  PPP   SP P
Sbjct: 406 ANPPSPAPSRSRAGGPPLGTRPPPPPP-EDDAPPPDYYFPPPQDMSPPP 453

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 43/106 (40%), Positives = 48/106 (45%), Gaps = 7/106 (6%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSP-PHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP  SPSP     SP P P V   PPPPP  SP P      PPPP     PPPP   
Sbjct: 340 SPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPP----RPPPPSPP 395

Query: 207 PSP------KVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           PSP           SP P    +  P +  + PPPP    +P  +Y
Sbjct: 396 PSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPPPPPEDDAPPPDY 441

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 41/101 (40%), Positives = 48/101 (47%), Gaps = 3/101 (2%)
 Frame = +3

Query: 51  SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYK 230
           +PSP      PP P V   PPPP   S SP    +SPPP  +  + P P  + SP +   
Sbjct: 219 TPSP------PPPPRVSTSPPPPARVSSSPPPATRSPPPRRI--TSPSPVLTASPPLPKT 270

Query: 231 SPPPPSYYSPSPKVEYKS---PPPPSYSPSPKTEY*ISRLP 344
           SPPPP    PSP     S   PPPP  SPSP     +S  P
Sbjct: 271 SPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPP 311

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/85 (42%), Positives = 41/85 (48%), Gaps = 4/85 (4%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPS----PKVVYKSPPPP 170
           RASP     S PPP   P P     SPP P      PP P  S S    P +  + PPPP
Sbjct: 372 RASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPPPP 431

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPP 245
              ++PPP YY P P+    SPPPP
Sbjct: 432 PEDDAPPPDYYFPPPQ--DMSPPPP 454

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 40/103 (38%), Positives = 44/103 (42%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP    SP      PP P     PPPPP   P P     SPPPP    + 
Sbjct: 358 SPPPPVVSPPPPPPRASP------PPPP--ASSPPPPP--RPPPPSPPPSPPPPATAAAN 407

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           PP   SP+P       PP     P P  E  +PPP  Y P P+
Sbjct: 408 PP---SPAPSRSRAGGPPLGTRPPPPPPEDDAPPPDYYFPPPQ 447

[160][TOP]
>UniRef100_B9RQU4 Putative uncharacterized protein n=1 Tax=Ricinus communis
           RepID=B9RQU4_RICCO
          Length = 154

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 55/123 (44%), Positives = 64/123 (52%), Gaps = 22/123 (17%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-----YVYNSP 188
           Y+SPPPP++    K    SPPH H C   P     +P P   YKSPPPP     Y + SP
Sbjct: 31  YRSPPPPFHY---KYESPSPPH-HKCKHTP----LAPLPFYTYKSPPPPPSPPVYEHKSP 82

Query: 189 PPP-----YYSPSPK-VY-YKSPPPPSYY----------SPSPKVEYKSPPPPSYSPSPK 317
           PPP     Y+SP P  VY Y+ PPPP ++          SP P V YKSPPPP     PK
Sbjct: 83  PPPPFVYKYWSPPPPPVYRYEPPPPPKHHHHHHHHKHKWSPYPYVTYKSPPPP-----PK 137

Query: 318 TEY 326
            EY
Sbjct: 138 QEY 140

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 44/94 (46%), Positives = 47/94 (50%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVY-YKSPPHPHVCV---CPPPPPCYS----PSPKV------- 146
           P   YKSPPPP   PSP VY +KSPP P        PPPPP Y     P PK        
Sbjct: 61  PFYTYKSPPPP---PSPPVYEHKSPPPPPFVYKYWSPPPPPVYRYEPPPPPKHHHHHHHH 117

Query: 147 VYKSPPPPYV-YNSPPPPYYSPSPKVYYKSPPPP 245
            +K  P PYV Y SPPPP     P  +Y SP PP
Sbjct: 118 KHKWSPYPYVTYKSPPPPPKQEYPVYHYISPAPP 151

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/76 (47%), Positives = 43/76 (56%), Gaps = 15/76 (19%)
 Frame = +3

Query: 144 VVYKSPPPP--YVYNSPPPPYY-------SPSPKVYYKSPPPPSYYSPSPKV-EYKSPPP 293
           + Y+SPPPP  Y Y SP PP++       +P P   YKSPPPP    PSP V E+KSPPP
Sbjct: 29  LTYRSPPPPFHYKYESPSPPHHKCKHTPLAPLPFYTYKSPPPP----PSPPVYEHKSPPP 84

Query: 294 PSY-----SPSPKTEY 326
           P +     SP P   Y
Sbjct: 85  PPFVYKYWSPPPPPVY 100

[161][TOP]
>UniRef100_Q8IRB3 CG32241 n=1 Tax=Drosophila melanogaster RepID=Q8IRB3_DROME
          Length = 440

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 58/140 (41%), Positives = 64/140 (45%), Gaps = 27/140 (19%)
 Frame = +3

Query: 12  PKVYYKSPP--------PPYYSPSP--KVYYKSPPHP---HVCVCPPPPPCYSPSPKVVY 152
           PKV Y  PP        PP Y P P  KV Y  PP P    V   PPPPP   P+ KVVY
Sbjct: 135 PKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVVYTPPPPP---PTKKVVY 191

Query: 153 KSPPPP----YVYNSPPPPYYSPSPKVYYKSPPPPS--------YYSPSPKVEYKSPPPP 296
             PPPP     VY  PPPP   P PK    +PPP          Y  PS K E  +PP P
Sbjct: 192 TPPPPPPTKKVVYTPPPPP---PPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAP 248

Query: 297 --SYSPSPKTEY*ISRLPLY 350
              Y P P  +  I+  P+Y
Sbjct: 249 KVEYLPPPTKKVVIAPPPVY 268

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/107 (46%), Positives = 56/107 (52%), Gaps = 5/107 (4%)
 Frame = +3

Query: 12  PKVYYK-SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP----YV 176
           P V ++ S PPP     PKV Y  PP   V + PPP     P+ KVVY  PPPP     V
Sbjct: 123 PSVKFEVSAPPP-----PKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVV 177

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           Y  PPPP   P+ KV Y  PPPP    P+ KV Y  PPPP   P PK
Sbjct: 178 YTPPPPP---PTKKVVYTPPPPP----PTKKVVYTPPPPP---PPPK 214

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 51/128 (39%), Positives = 58/128 (45%), Gaps = 14/128 (10%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP----YV 176
           +PKV Y  PP      +P   Y  PP   V   PPPPP   P+ KVVY  PPPP     V
Sbjct: 247 APKVEYLPPPTKKVVIAPPPVYVPPPTKKVIYTPPPPP---PTKKVVYTPPPPPPTKKVV 303

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPS--------YYSPSPKVEYKSPPPP--SYSPSPKTEY 326
           Y  PPPP   P PK    +PPP          Y  PS K E  +PP P   Y P P T+ 
Sbjct: 304 YTPPPPP---PPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYLPPPPTKK 360

Query: 327 *ISRLPLY 350
                P+Y
Sbjct: 361 VYVAPPVY 368

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 52/127 (40%), Positives = 57/127 (44%), Gaps = 27/127 (21%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHP---HVCVCPPPPPCYSPSPKVVYKSPPPP----- 170
           KV Y  PPPP   P+ KV Y  PP P    V   PPPPP   P PK V  +PPP      
Sbjct: 175 KVVYTPPPPP---PTKKVVYTPPPPPPTKKVVYTPPPPP---PPPKKVVYTPPPTGILKD 228

Query: 171 --YVYNSPPPPY---YSPSPKVYYKSPP-------PPSYYSPSP--KVEYKSPPPPS--- 299
             Y Y  P   +     P+PKV Y  PP       PP  Y P P  KV Y  PPPP    
Sbjct: 229 DGYHYGQPSVKFEVSAPPAPKVEYLPPPTKKVVIAPPPVYVPPPTKKVIYTPPPPPPTKK 288

Query: 300 --YSPSP 314
             Y+P P
Sbjct: 289 VVYTPPP 295

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 51/125 (40%), Positives = 55/125 (44%), Gaps = 25/125 (20%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHP---HVCVCPPPPPCYSPSPKVVYKSPPPP----- 170
           KV Y  PPPP   P+ KV Y  PP P    V   PPPPP   P PK V  +PPP      
Sbjct: 275 KVIYTPPPPP---PTKKVVYTPPPPPPTKKVVYTPPPPP---PPPKKVVYTPPPTGILKD 328

Query: 171 --YVYNSPPPPY---YSPSPKVYYKSPPP-------PSYYSPSPK---VEYKSPPPPS-- 299
             Y Y  P   +     P+PKV Y  PPP       P  Y P P    V Y  PPPP   
Sbjct: 329 DGYHYGQPSVKFEVSAPPAPKVEYLPPPPTKKVYVAPPVYVPPPTKKVVVYTPPPPPPPV 388

Query: 300 YSPSP 314
           Y P P
Sbjct: 389 YIPPP 393

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 48/123 (39%), Positives = 52/123 (42%), Gaps = 25/123 (20%)
 Frame = +3

Query: 12  PKVYYKSPPPP---------YYSPSPKVYYKSPPHPHVCVCPPP--------PPCYSPSP 140
           PK    +PPP          Y  PS K    +PP P V   PPP        PP Y P P
Sbjct: 313 PKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYLPPPPTKKVYVAPPVYVPPP 372

Query: 141 --KVVYKSPPPPYVYNSPPPPYYSPSPK---VYYKSPPPP---SYYSPSPKVEYKSPPPP 296
             KVV  +PPP      PPPP Y P P    V Y  PPPP        +PKVEY  P   
Sbjct: 373 TKKVVVYTPPP------PPPPVYIPPPTKKVVVYTPPPPPPPTKKVYVTPKVEYLPPVQK 426

Query: 297 SYS 305
            YS
Sbjct: 427 GYS 429

[162][TOP]
>UniRef100_Q9LHF1 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9LHF1_ARATH
          Length = 494

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 45/102 (44%), Positives = 54/102 (52%), Gaps = 2/102 (1%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS--PSPKVVYKSPPPPYV 176
           + SP +    PPPP   P P   Y  PP P V   PP PP YS  P P + Y SPPPP V
Sbjct: 402 KPSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPV 461

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           ++S PPP   PSP+  ++ P PP        V Y SPPPP +
Sbjct: 462 HHSSPPP---PSPE--FEGPLPPVI-----GVSYASPPPPPF 493

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/88 (43%), Positives = 43/88 (48%), Gaps = 7/88 (7%)
 Frame = +3

Query: 84  PHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP-PPYYSPSPKVYYKSPPPPSYYS- 257
           P P +   PPPPP   PSP      P PP VY+ PP PP +SP        PP P  YS 
Sbjct: 403 PSPPIVALPPPPP---PSP------PLPPPVYSPPPSPPVFSP--------PPSPPVYSP 445

Query: 258 -PSPKVEYKSPPPP----SYSPSPKTEY 326
            P P + Y SPPPP    S  P P  E+
Sbjct: 446 PPPPSIHYSSPPPPPVHHSSPPPPSPEF 473

[163][TOP]
>UniRef100_A5B045 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5B045_VITVI
          Length = 410

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 41/109 (37%), Positives = 58/109 (53%), Gaps = 11/109 (10%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPK-VYYKSPPHPHVCVCPPP-------PPCYSPSPKVVYKSPPPPYV 176
           YY S PPPYY   P   ++ +  HP+    PPP       P  Y  +P   Y + PPP+ 
Sbjct: 240 YYSSTPPPYYPSGPSPTHFGAYVHPYAFTPPPPSIYGAAPPSFYGAAPPSFYGAAPPPF- 298

Query: 177 YNSPPPPYY--SPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSYSPSP 314
           Y + PPP++  +P P  Y  +PPPP+Y  +P P     +PPPP+Y  +P
Sbjct: 299 YGAAPPPFHGVAPPPPTYGAAPPPPTYGAAPPPPTYGAAPPPPTYGAAP 347

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 9/110 (8%)
 Frame = +3

Query: 12  PKVYYKSPPPPY--YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPK----VVYK---SPP 164
           P  Y    P P+  Y PSP   Y  P HP+    PPP     PSP      V+    +PP
Sbjct: 212 PAPYGAYVPAPHGAYGPSPYYAY-GPQHPYYSSTPPPYYPSGPSPTHFGAYVHPYAFTPP 270

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP +Y + PP +Y  +P  +Y + PPP Y +  P     +PPPP+Y  +P
Sbjct: 271 PPSIYGAAPPSFYGAAPPSFYGAAPPPFYGAAPPPFHGVAPPPPTYGAAP 320

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 41/111 (36%), Positives = 55/111 (49%), Gaps = 10/111 (9%)
 Frame = +3

Query: 12  PKVYYK-SPPPPYYSPSPKVYYKSPPHP-HVCVCPPPPPCYSPSPKVVYKSPP------P 167
           P  YY   P  PYYS +P  YY S P P H      P     P P +   +PP      P
Sbjct: 228 PSPYYAYGPQHPYYSSTPPPYYPSGPSPTHFGAYVHPYAFTPPPPSIYGAAPPSFYGAAP 287

Query: 168 PYVYNSPPPPYYSPSPKVYY-KSPPPPSY-YSPSPKVEYKSPPPPSYSPSP 314
           P  Y + PPP+Y  +P  ++  +PPPP+Y  +P P     +PPPP+Y  +P
Sbjct: 288 PSFYGAAPPPFYGAAPPPFHGVAPPPPTYGAAPPPPTYGAAPPPPTYGAAP 338

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 37/101 (36%), Positives = 49/101 (48%), Gaps = 2/101 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y + PP +Y  +P  +Y + P P     PPP    +P P     +PPPP    +PP
Sbjct: 271 PPSIYGAAPPSFYGAAPPSFYGAAPPPFYGAAPPPFHGVAPPPPTYGAAPPPPTYGAAPP 330

Query: 192 PPYY--SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           PP Y  +P P  Y  +PPPPSY +      Y    PP +SP
Sbjct: 331 PPTYGAAPPPPTYGAAPPPPSYGA------YAYGEPPGFSP 365

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 34/97 (35%), Positives = 42/97 (43%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP 215
           P PY +  P  Y    P PH    P P   Y P     Y S PPPY  + P P ++    
Sbjct: 204 PAPYGAYGPAPYGAYVPAPHGAYGPSPYYAYGPQHPY-YSSTPPPYYPSGPSPTHFGAYV 262

Query: 216 KVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
             Y  +PPPPS Y  +P   Y + PP  Y  +P   Y
Sbjct: 263 HPYAFTPPPPSIYGAAPPSFYGAAPPSFYGAAPPPFY 299

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 33/91 (36%), Positives = 45/91 (49%), Gaps = 2/91 (2%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV-VYKSPPPPYVYN 182
           A+P  +Y + PPP+Y  +P  ++   P P      PPPP Y  +P    Y + PPP  Y 
Sbjct: 285 AAPPSFYGAAPPPFYGAAPPPFHGVAPPPPTYGAAPPPPTYGAAPPPPTYGAAPPPPTYG 344

Query: 183 SPPPPYYSPSPKVY-YKSPPPPSYYSPSPKV 272
           + PPP   PS   Y Y  PP  S +S +  V
Sbjct: 345 AAPPP---PSYGAYAYGEPPGFSPHSANHSV 372

[164][TOP]
>UniRef100_Q581B0 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei
           RepID=Q581B0_9TRYP
          Length = 370

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 45/101 (44%), Positives = 48/101 (47%), Gaps = 5/101 (4%)
 Frame = +3

Query: 12  PKVYYKSPPPP-YYSPSPKVYYKSPPHPHVCVCPPPPPCY-SPSPKVVYKSPPPPYVYNS 185
           P  Y + PPP  Y  P P   Y  PP P     PPPP  Y  P P   Y  PPPP  Y  
Sbjct: 90  PAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQ 149

Query: 186 PPPP--YYSPSPKVYYKSPPPPS-YYSPSPKVEYKSPPPPS 299
           PPPP  Y  P P   Y  PPPP+ Y  P P   Y  PPPP+
Sbjct: 150 PPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPA 190

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 45/106 (42%), Positives = 47/106 (44%), Gaps = 6/106 (5%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS-PSPKVVYKSPPPPYVYNSPPPP-- 197
           K PPPP         Y  PP P     PPPP  Y  P P   Y  PPPP  Y  PPPP  
Sbjct: 85  KQPPPP-------AGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAG 137

Query: 198 YYSPSPKVYYKSPPPPS-YYSPSPKVEYKSPPPPS--YSPSPKTEY 326
           Y  P P   Y  PPPP+ Y  P P   Y  PPPP+    P P   Y
Sbjct: 138 YGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGY 183

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 35/86 (40%), Positives = 38/86 (44%), Gaps = 5/86 (5%)
 Frame = +3

Query: 84  PHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP--YYSPSPKVYYKSPPPPS-YY 254
           P  +V   PP      P P   Y  PPPP  Y  PPPP  Y  P P   Y  PPPP+ Y 
Sbjct: 71  PALNVLAGPPTDNGKQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYG 130

Query: 255 SPSPKVEYKSPPPPS--YSPSPKTEY 326
            P P   Y  PPPP+    P P   Y
Sbjct: 131 QPPPPAGYGQPPPPAGYGQPPPPAGY 156

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 42/108 (38%), Positives = 47/108 (43%), Gaps = 4/108 (3%)
 Frame = +3

Query: 12  PKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYS-PSPKVVYKSPPPPYVYN 182
           P   Y  PPPP  Y  P P   Y  PP P     PPPP  Y  P P   Y  PPPP  Y 
Sbjct: 125 PPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYG 184

Query: 183 SPPPPY-YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
            PPPP  Y   P   YK   PP  Y+   K E ++    S   +P +E
Sbjct: 185 QPPPPAGYGQPPCGVYK---PPDDYAEVQKWEGENEWETSMLGAPCSE 229

[165][TOP]
>UniRef100_Q5W1I2 Putative extensin (Fragment) n=1 Tax=Nicotiana glauca
           RepID=Q5W1I2_NICGL
          Length = 85

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/99 (52%), Positives = 55/99 (55%), Gaps = 4/99 (4%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY-VYNSPP 191
           K Y+ SP P  Y P+P   YKSPP       PPP   Y P    VYKSPPPP  VY SPP
Sbjct: 5   KPYHPSPTP--YHPAP--VYKSPP-------PPPKKPYYPPHTPVYKSPPPPTPVYKSPP 53

Query: 192 P---PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
           P   PYY P   V YKSPPPP+         YKSPPPPS
Sbjct: 54  PPKKPYYPPHTPV-YKSPPPPT-------PVYKSPPPPS 84

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/69 (56%), Positives = 39/69 (56%), Gaps = 7/69 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPP----YYSPSPKVYYKSPPHPHVCVCPPPPPC--YSPSPKVVYKSPPPPY 173
           P   YKSPPPP    YY P   VY KSPP P      PPPP   Y P    VYKSPPPP 
Sbjct: 16  PAPVYKSPPPPPKKPYYPPHTPVY-KSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPT 74

Query: 174 -VYNSPPPP 197
            VY SPPPP
Sbjct: 75  PVYKSPPPP 83

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 32/72 (44%), Positives = 37/72 (51%), Gaps = 7/72 (9%)
 Frame = +3

Query: 159 PPPPYVYNSPPPPYYSPSPKVYYKSPPPPS---YYSPSPKVEYKSPPPPS----YSPSPK 317
           PPP   Y+  P PY+   P   YKSPPPP    YY P   V YKSPPPP+      P PK
Sbjct: 1   PPPMKPYHPSPTPYH---PAPVYKSPPPPPKKPYYPPHTPV-YKSPPPPTPVYKSPPPPK 56

Query: 318 TEY*ISRLPLYE 353
             Y     P+Y+
Sbjct: 57  KPYYPPHTPVYK 68

[166][TOP]
>UniRef100_UPI00015B42DB PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B42DB
          Length = 454

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 48/119 (40%), Positives = 60/119 (50%), Gaps = 18/119 (15%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYS--------PSPKVYYKSPPHPHVCVCPPPPPCYS---PSPKVVY 152
           A P+  Y +PPPP +         P P   Y +PP P     PPPP  Y+   P+P   Y
Sbjct: 150 AVPQPSYGAPPPPAHPAAYGAPPPPPPPASYAAPPPP-----PPPPASYAAPPPAPPASY 204

Query: 153 KSPPP-----PYVYNSPPPP--YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            +PPP     P  YN PPPP  Y  PSP   Y   PPP+ Y+P P +   +PPP SY+P
Sbjct: 205 AAPPPARPSPPASYNQPPPPATYSQPSPPASYNQSPPPASYNP-PSL---TPPPASYNP 259

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 52/136 (38%), Positives = 60/136 (44%), Gaps = 31/136 (22%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPP-------------------HPHVCVCPPPPP-- 122
           A P   Y +PPP  Y+  P   Y SPP                   HP     PPPPP  
Sbjct: 118 AQPPPSYSAPPPAAYAHQPAAAYPSPPVRPAYAVPQPSYGAPPPPAHPAAYGAPPPPPPP 177

Query: 123 -CYS-----PSPKVVYKSPPP--PYVYNSPPPPYYSPSPKVYYKSPPPPS-YYSPSPKVE 275
             Y+     P P   Y +PPP  P  Y +PPP    PSP   Y  PPPP+ Y  PSP   
Sbjct: 178 ASYAAPPPPPPPPASYAAPPPAPPASYAAPPPA--RPSPPASYNQPPPPATYSQPSPPAS 235

Query: 276 Y-KSPPPPSYSPSPKT 320
           Y +SPPP SY+P   T
Sbjct: 236 YNQSPPPASYNPPSLT 251

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 42/111 (37%), Positives = 51/111 (45%), Gaps = 10/111 (9%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y +PPPP   PSP      PP  +     PPP  Y+  P   Y SPP    Y  P P Y 
Sbjct: 102 YAAPPPPR-PPSPLYSVAQPPPSYSA---PPPAAYAHQPAAAYPSPPVRPAYAVPQPSYG 157

Query: 204 SPSPKVY---YKSPPPP----SYYSPSPKVEYKSPPPPSYS---PSPKTEY 326
           +P P  +   Y +PPPP    SY +P P      PPP SY+   P+P   Y
Sbjct: 158 APPPPAHPAAYGAPPPPPPPASYAAPPP----PPPPPASYAAPPPAPPASY 204

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 48/128 (37%), Positives = 54/128 (42%), Gaps = 20/128 (15%)
 Frame = +3

Query: 3   RASPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCP---PPPPCYSPSPKVVYKSPPP 167
           R SP   Y  PPPP  Y  PSP   Y   P P     P   PPP  Y+P  +     PPP
Sbjct: 211 RPSPPASYNQPPPPATYSQPSPPASYNQSPPPASYNPPSLTPPPASYNPPSRP--PPPPP 268

Query: 168 PYVYNSP-----PPPYYSPSPKVYY--KSPPPPSYYSPSP---KVEYKSPPPP-----SY 302
           P V   P       P   PS K  Y  K PPPP+  +  P   K  +K PPPP     +Y
Sbjct: 269 PPVTEKPLKITLSRPSPPPSTKSSYPNKLPPPPAIPNEPPLSDKPCFKQPPPPPSKPKTY 328

Query: 303 SPSPKTEY 326
            P P   Y
Sbjct: 329 DPLPMPRY 336

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/115 (37%), Positives = 50/115 (43%), Gaps = 13/115 (11%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP----PPYV 176
           +P   Y +PPP    PSP   Y  PP P     P PP  Y+ SP     +PP    PP  
Sbjct: 199 APPASYAAPPPA--RPSPPASYNQPPPPATYSQPSPPASYNQSPPPASYNPPSLTPPPAS 256

Query: 177 YN------SPPPPYYSPSP-KVYYKSPPPPSYYSPSPKVEY--KSPPPPSYSPSP 314
           YN       PPPP  +  P K+    P PP    PS K  Y  K PPPP+    P
Sbjct: 257 YNPPSRPPPPPPPPVTEKPLKITLSRPSPP----PSTKSSYPNKLPPPPAIPNEP 307

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 36/93 (38%), Positives = 46/93 (49%), Gaps = 3/93 (3%)
 Frame = +3

Query: 33  PP--PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           PP  PP Y+   +    S   P     PPPP    PSP  +Y    PP  Y++PPP  Y+
Sbjct: 78  PPYAPPAYNAVQQQQQYSVQQPGSYAAPPPP--RPPSP--LYSVAQPPPSYSAPPPAAYA 133

Query: 207 PSPKVYYKSPP-PPSYYSPSPKVEYKSPPPPSY 302
             P   Y SPP  P+Y  P P   Y +PPPP++
Sbjct: 134 HQPAAAYPSPPVRPAYAVPQP--SYGAPPPPAH 164

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 40/123 (32%), Positives = 46/123 (37%), Gaps = 18/123 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPS----PKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP--- 170
           P  Y +SPPP  Y+P     P   Y  P  P     PPPPP      K+    P PP   
Sbjct: 233 PASYNQSPPPASYNPPSLTPPPASYNPPSRPPP---PPPPPVTEKPLKITLSRPSPPPST 289

Query: 171 ---YVYNSPPPPYYSPSP----KVYYKSPPP----PSYYSPSPKVEYKSPPPPSYSPSPK 317
              Y    PPPP     P    K  +K PPP    P  Y P P   Y     P    +P 
Sbjct: 290 KSSYPNKLPPPPAIPNEPPLSDKPCFKQPPPPPSKPKTYDPLPMPRYNHLTNPWAPIAPP 349

Query: 318 TEY 326
            +Y
Sbjct: 350 AQY 352

[167][TOP]
>UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PES6_VITVI
          Length = 486

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 47/98 (47%), Positives = 50/98 (51%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           R SP V     PPP   PSP V+   PP P       PPP +SP P V+  SPPPP    
Sbjct: 399 RCSPFVPSLPTPPP---PSPPVFPSPPPTPVYS----PPPVFSPPPPVL-SSPPPP---- 446

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
           SPPPP  SP P   Y  PPPP  YSP P      PPPP
Sbjct: 447 SPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPPP 484

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/85 (47%), Positives = 43/85 (50%)
 Frame = +3

Query: 60  PKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPP 239
           P +    PP P V   PPP P YSP P     SPPPP + + PPP    PSP     SPP
Sbjct: 405 PSLPTPPPPSPPVFPSPPPTPVYSPPPVF---SPPPPVLSSPPPPSPPPPSP-----SPP 456

Query: 240 PPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP  YSP P     SPPPP   P P
Sbjct: 457 PPPVYSPPPPPPVYSPPPPPPPPPP 481

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 38/79 (48%), Positives = 41/79 (51%)
 Frame = +3

Query: 90  PHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPK 269
           P V   P PPP   PSP V + SPPP  VY+  PPP +SP P V   SPPPPS       
Sbjct: 402 PFVPSLPTPPP---PSPPV-FPSPPPTPVYS--PPPVFSPPPPVL-SSPPPPS------- 447

Query: 270 VEYKSPPPPSYSPSPKTEY 326
                PPPPS SP P   Y
Sbjct: 448 -----PPPPSPSPPPPPVY 461

[168][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/95 (47%), Positives = 47/95 (49%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P     SPP P      PPPP  SP P  +   PPPP   + PPPP  SP
Sbjct: 87  SPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPP---SPPPPPLLSP 143

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P      PPPP    PSP     SPPPP   PSP
Sbjct: 144 PPPPPSPPPPPP----PSPPPPPPSPPPPLPPPSP 174

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 46/95 (48%), Positives = 47/95 (49%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   PSP     SPP P     PPPPP    SP     SPPPP +  SPPPP  SP
Sbjct: 79  SPPPPP-PPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPL--SPPPPPPSP 135

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P      PPPP    P P     SPPPP  SP P
Sbjct: 136 PPPPLLSPPPPPPSPPPPPP---PSPPPPPPSPPP 167

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 43/94 (45%), Positives = 44/94 (46%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP  SP P    + PP P     PPPPP   P P     SPPPP     PPPP  SP 
Sbjct: 49  PPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPP---PSPPPPLPSPPPPPPLPSPP 105

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P     S PPP   SP P      PPPPS  P P
Sbjct: 106 PPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPP 139

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 42/95 (44%), Positives = 44/95 (46%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   PSP       P P +   PPPPP  SP P     S PPP   + PPPP   P
Sbjct: 70  SPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPP 129

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPP   SP P      PPPP   P P
Sbjct: 130 PPP---PSPPPPPLLSPPPPPPSPPPPPPPSPPPP 161

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 44/95 (46%), Positives = 46/95 (48%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P      PP P     PPPPP  SP P      PPPP    SPPPP  SP
Sbjct: 113 SPPPPPPSPPPPPLSPPPPPPS----PPPPPLLSPPPPPPSPPPPPP---PSPPPPPPSP 165

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P +   SP PP   SP   +    PPPP  SP P
Sbjct: 166 PPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPP 200

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 44/100 (44%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS-- 206
           PPPP   P P     SPP P     PPPPP  SP P +    PPPP     PPPP  S  
Sbjct: 58  PPPPSQPPPPP---SSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSP 114

Query: 207 ----PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
               PSP     SPPPP    P P +    PPPPS  P P
Sbjct: 115 PPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPP 154

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/102 (43%), Positives = 46/102 (45%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP     P     SPP P     PPPPP   P P      PPPP   + P
Sbjct: 24  SPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPP--SSPPPPPPPPSPP 81

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP  SP P +    PPPP    P P     SPPPP  SP P
Sbjct: 82  PPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPP 123

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 46/98 (46%), Positives = 46/98 (46%), Gaps = 4/98 (4%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPP----PPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           PPPP   PSP      PP P     PPP    PP  SP P     SPPPP    SPPPP 
Sbjct: 34  PPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPP-PPPSPPPPL 92

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SP P     SPPPP     SP     SPPPP  SP P
Sbjct: 93  PSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPP 130

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 44/106 (41%), Positives = 46/106 (43%), Gaps = 12/106 (11%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP------------PPPYV 176
           PPPP   P P     SPP P     PPPPP   P P     SP            PPP  
Sbjct: 1   PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPP 60

Query: 177 YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            + PPPP  SP P     SPPPP   SP P +    PPPP  SP P
Sbjct: 61  PSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPP 106

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 49/103 (47%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           SP     SPPPP   PSP      SPPHP +   PPPPP  SP P      PPPP    S
Sbjct: 157 SPPPPPPSPPPPLPPPSPLPPPPPSPPHP-LPPSPPPPPPPSPPPPPPPSPPPPP--LPS 213

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP P   PSP +    PPPPS   P P     SPPPPS  P P
Sbjct: 214 PPAP-SPPSPPLPPPPPPPPSPPPPPP----PSPPPPSPPPPP 251

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 43/94 (45%), Positives = 47/94 (50%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP  SP P      PP P     PPPPP  SP P  +  SPPPP   + PPPP  SP 
Sbjct: 151 PPPPPPSPPPPPPSPPPPLPPPSPLPPPPP--SP-PHPLPPSPPPPPPPSPPPPPPPSPP 207

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P      P PP+   PSP +    PPPPS  P P
Sbjct: 208 PPPL---PSPPAPSPPSPPLPPPPPPPPSPPPPP 238

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 42/93 (45%), Positives = 42/93 (45%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P      PP P     P PPP   PSP     SPPPP    SP PP    
Sbjct: 127 SPPPPPPSPPPPPLLSPPPPP-----PSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPS 181

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     SPPPP   SP P      PPPP  SP
Sbjct: 182 PPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSP 214

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 42/97 (43%), Positives = 44/97 (45%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP           SPP       PPPPP  SP P      PPPP    SPPPP  SP 
Sbjct: 2   PPPP-----------SPP-------PPPPPPSSPPP------PPPP----SPPPPPPSPP 33

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           P      PPPPS  SP P      PPPPS  P P ++
Sbjct: 34  P------PPPPSPPSPLPPSP-PPPPPPSPPPPPPSQ 63

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 39/89 (43%), Positives = 41/89 (46%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP   P P      PP P     PPPP    P+P     SPP P +   PPPP   PS
Sbjct: 192 PPPPPSPPPP-----PPPSP-----PPPPLPSPPAP-----SPPSPPLPPPPPPP---PS 233

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
           P      PPPPS   PSP      PPPPS
Sbjct: 234 P----PPPPPPSPPPPSP-----PPPPPS 253

[169][TOP]
>UniRef100_B9RZK7 Nutrient reservoir, putative n=1 Tax=Ricinus communis
           RepID=B9RZK7_RICCO
          Length = 171

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 50/108 (46%), Positives = 53/108 (49%), Gaps = 12/108 (11%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP-PYVYNSPPPP--- 197
           SPPPP   PSP      PP      CPPPP   SPS    Y  PPP  Y Y+SPPPP   
Sbjct: 49  SPPPP--PPSP------PPPASTNNCPPPPSPPSPSGSYYYSPPPPATYTYSSPPPPQGG 100

Query: 198 ------YYSPSPKVY--YKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
                 YY P P  Y  Y +PPPP+   P     Y SPPPPS S S K
Sbjct: 101 NGGGSYYYYPPPADYKNYPAPPPPNPIVPYFPFYYYSPPPPSMSASLK 148

[170][TOP]
>UniRef100_B5DR41 GA28343 n=1 Tax=Drosophila pseudoobscura pseudoobscura
           RepID=B5DR41_DROPS
          Length = 578

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 52/115 (45%), Positives = 58/115 (50%), Gaps = 13/115 (11%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSP--KVYYKSPPHP-----HVCVCPPPPPCY-SPSPKVVYKS 158
           +P VY K  PP   Y  P+P  KV Y  PP P      V   PPPPP Y  P+P  V   
Sbjct: 302 APPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEYL 361

Query: 159 PPPPY---VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PP P    VY  PPPP  +P  KV Y  PPPP   +P  KV Y  PPPP   P+P
Sbjct: 362 PPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPP-PAPVKKVVYTPPPPP---PAP 412

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 49/103 (47%), Positives = 55/103 (53%), Gaps = 6/103 (5%)
 Frame = +3

Query: 36  PPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP---YY 203
           PP Y  P+P KV Y  P      V  PPPP  +P  KVVY  PPPP VY  P PP   Y 
Sbjct: 303 PPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPP-VYVKPAPPKVEYL 361

Query: 204 SPSP--KVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            P+P  KV Y +PPPP   +P  KV Y  PPPP  +P  K  Y
Sbjct: 362 PPAPVKKVVY-TPPPPPPPAPVKKVVYTPPPPPPPAPVKKVVY 403

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 51/116 (43%), Positives = 57/116 (49%), Gaps = 14/116 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPP---YYSPSP--KVYYKSPPHP-----HVCVCPPPPPCY-SPSPKVVYK 155
           +P   Y  P PP   Y  P+P  KV Y  PP P      V   PPPPP Y  P+P  V  
Sbjct: 154 APAPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEY 213

Query: 156 SPPPPY---VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP P    VY  PPPP  +P  KV Y  PPPP   +P  KV Y  PPPP   P+P
Sbjct: 214 LPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPP-PAPVKKVVYTPPPPP---PAP 265

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 51/111 (45%), Positives = 57/111 (51%), Gaps = 13/111 (11%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSP--KVYYKSPPHP-----HVCVCPPPPPCY-SPSPKVVYKS 158
           +P VY K  PP   Y  P+P  KV Y  PP P      V   PPPPP Y  P+P  V   
Sbjct: 449 APPVYVKPAPPKVEYLPPAPVKKVVYTPPPTPPAPVKKVVYTPPPPPVYVKPAPPKVEYL 508

Query: 159 PPPPY---VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PP P    VY  PPPP  +P  KV Y  PPPP   +P  KV Y +PPPP Y
Sbjct: 509 PPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPP-PAPVQKVVY-TPPPPVY 557

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 47/104 (45%), Positives = 55/104 (52%), Gaps = 5/104 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-YVYNSPPPPYY 203
           +P P Y  P+P KV Y  P      V  PPPP  +P  KVVY  PPPP YV  +PP   Y
Sbjct: 154 APAPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEY 213

Query: 204 ---SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
              +P  KV Y +PPPP   +P  KV Y  PPPP  +P  K  Y
Sbjct: 214 LPPAPVKKVVY-TPPPPPPPAPVKKVVYTPPPPPPPAPVKKVVY 256

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 58/159 (36%), Positives = 65/159 (40%), Gaps = 47/159 (29%)
 Frame = +3

Query: 15  KVYYKSPPPPYY--SPSPKVYYKSP-PHPHVCVCPPPPPCYSPSPKVVYKSPPPP----- 170
           KV Y  PPPP Y     PKV Y  P P   V   PPPPP  +P  KVVY  PPPP     
Sbjct: 192 KVVYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPPPAPV 251

Query: 171 --YVYNSPPPP-----------------------YYSPSPKVYYK---SPPPPSYYSPSP 266
              VY  PPPP                       Y  P+P    K   +P PP Y  P+P
Sbjct: 252 KKVVYTPPPPPPAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVTPAPPVYVKPAP 311

Query: 267 -KVEYK----------SPPPPSYSPSPKTEY*ISRLPLY 350
            KVEY           +PPPP  +P  K  Y     P+Y
Sbjct: 312 PKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVY 350

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 48/103 (46%), Positives = 54/103 (52%), Gaps = 6/103 (5%)
 Frame = +3

Query: 36  PPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP---YY 203
           PP Y  P+P KV Y  P      V  PPP   +P  KVVY  PPPP VY  P PP   Y 
Sbjct: 450 PPVYVKPAPPKVEYLPPAPVKKVVYTPPPTPPAPVKKVVYTPPPPP-VYVKPAPPKVEYL 508

Query: 204 SPSP--KVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            P+P  KV Y +PPPP   +P  KV Y  PPPP  +P  K  Y
Sbjct: 509 PPAPVKKVVY-TPPPPPPPAPVKKVVYTPPPPPPPAPVQKVVY 550

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 58/169 (34%), Positives = 63/169 (37%), Gaps = 65/169 (38%)
 Frame = +3

Query: 15  KVYYKSPPPPYY-------------SPSPKVYYKSPPHP------HVCVCPPPPPCYSPS 137
           KV Y  PPPP Y             +P  KV Y  PP P       V   PPPPP  +P 
Sbjct: 339 KVVYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPPPAPV 398

Query: 138 PKVVYKSPPPP-----------YVYNSP-----------------------PPPYYSPSP 215
            KVVY  PPPP           Y Y  P                       PP Y  P+P
Sbjct: 399 KKVVYTPPPPPPAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVTPAPPVYVKPAP 458

Query: 216 -KVYYKSP---------PPPSYYSPSPKVEYKSPPPPSY--SPSPKTEY 326
            KV Y  P         PPP+  +P  KV Y  PPPP Y     PK EY
Sbjct: 459 PKVEYLPPAPVKKVVYTPPPTPPAPVKKVVYTPPPPPVYVKPAPPKVEY 507

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 49/109 (44%), Positives = 56/109 (51%), Gaps = 13/109 (11%)
 Frame = +3

Query: 15  KVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY----SPSPKVVYKSPPPP---- 170
           KV Y  PP P  +P  KV Y +PP P V V P PP       +P  KVVY  PPPP    
Sbjct: 471 KVVYTPPPTP-PAPVKKVVY-TPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAP 528

Query: 171 ---YVYNSPPPPYYSPSPKVYYKSPPPPSYYSP-SPK-VEYKSPPPPSY 302
               VY  PPPP  +P  KV Y +PPPP Y  P  PK   Y + P PS+
Sbjct: 529 VKKVVYTPPPPPPPAPVQKVVY-TPPPPVYVQPEGPKGYSYPNDPQPSF 576

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 45/130 (34%), Positives = 54/130 (41%), Gaps = 23/130 (17%)
 Frame = +3

Query: 6   ASPKVYYKSPPPP-----YYSPSPKVYYKSPPHPHVCVCPP-------------PPPCYS 131
           A P V Y++P P      Y +P  KVY  +PP        P             P   + 
Sbjct: 86  APPAVIYQAPKPTPPRPVYTAPPAKVYTPAPPAKVYTPAVPAGALKEDGYHYGQPSVKFE 145

Query: 132 PSPKVVYKSPPPPYVYNSPPPPYY---SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
              K V  +P P YV  +PP   Y   +P  KV Y  PPPP   +P  KV Y  PPPP Y
Sbjct: 146 TYEKPVETAPAPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPP--APVKKVVYTPPPPPVY 203

Query: 303 --SPSPKTEY 326
                PK EY
Sbjct: 204 VKPAPPKVEY 213

[171][TOP]
>UniRef100_C0NBD5 DNA binding/ligand-dependent nuclear receptor n=1 Tax=Ajellomyces
           capsulatus G186AR RepID=C0NBD5_AJECG
          Length = 590

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 44/117 (37%), Positives = 45/117 (38%), Gaps = 12/117 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPPY 173
           P   Y   PPP YS  P   Y   P P     PPP      PP YS  P   Y   PPP 
Sbjct: 315 PPPSYSHQPPPSYSQQPPPSYSQQPPPSYSQQPPPSYSQQPPPSYSQQPPPSYSQQPPPS 374

Query: 174 VYNSPPPPYYSPSPKVYYKSP------PPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
             N P P Y    P  Y + P       PPS YS  P   Y   PP SYS  P   Y
Sbjct: 375 YSNKPTPSYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTPSY 431

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 46/122 (37%), Positives = 48/122 (39%), Gaps = 7/122 (5%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           A P  Y   PPP Y    P  Y   PP  +      PPP YS  P   Y   PPP     
Sbjct: 298 APPPSYPHQPPPTYPQQPPPSYSHQPPPSY---SQQPPPSYSQQPPPSYSQQPPPSYSQQ 354

Query: 186 PPPPYYSPSPKVYYKSPPPPSY-------YSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           PPP  YS  P   Y   PPPSY       YS  P   Y   P PSYS  P + Y     P
Sbjct: 355 PPPS-YSQQPPPSYSQQPPPSYSNKPTPSYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTP 413

Query: 345 LY 350
            Y
Sbjct: 414 SY 415

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/99 (39%), Positives = 44/99 (44%), Gaps = 1/99 (1%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPP-HPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           PPP   +P P   ++ PP +P       PPP YS  P   Y   PPP     PPP Y   
Sbjct: 292 PPPKTTAPPPSYPHQPPPTYPQ-----QPPPSYSHQPPPSYSQQPPPSYSQQPPPSYSQQ 346

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            P  Y + PPP   YS  P   Y   PPPSYS  P   Y
Sbjct: 347 PPPSYSQQPPPS--YSQQPPPSYSQQPPPSYSNKPTPSY 383

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 45/126 (35%), Positives = 47/126 (37%), Gaps = 13/126 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPP------PCYSPSPKVVYKSPPPPY 173
           P   Y   PPP YS  P   Y   P P     PPP       P YS  P   Y   P P 
Sbjct: 339 PPPSYSQQPPPSYSQQPPPSYSQQPPPSYSQQPPPSYSNKPTPSYSQQPPSSYSQEPTP- 397

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSY-------YSPSPKVEYKSPPPPSYSPSPKTEY*I 332
            Y+  PP  YS  P   Y   PP SY       YS  P   Y   P PSYS  P + Y  
Sbjct: 398 SYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTPSYSQQPPSSYSQ 457

Query: 333 SRLPLY 350
              P Y
Sbjct: 458 EPTPSY 463

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/126 (34%), Positives = 47/126 (37%), Gaps = 13/126 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPPY 173
           P   Y + P P YS  P   Y   P P     PP      P P YS  P   Y   P P 
Sbjct: 371 PPPSYSNKPTPSYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTP- 429

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSY-------YSPSPKVEYKSPPPPSYSPSPKTEY*I 332
            Y+  PP  YS  P   Y   PP SY       YS  P   Y   P PSYS  P + Y  
Sbjct: 430 SYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTPSYSQQPPSSYPQ 489

Query: 333 SRLPLY 350
              P Y
Sbjct: 490 EPTPSY 495

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/126 (34%), Positives = 46/126 (36%), Gaps = 13/126 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPPY 173
           P   Y   P P YS  P   Y   P P     PP      P P YS  P   Y   P P 
Sbjct: 387 PPSSYSQEPTPSYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTPSYSQQPPSSYSQEPTPS 446

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSY-------YSPSPKVEYKSPPPPSYSPSPKTEY*I 332
            Y+  PP  YS  P   Y   PP SY       YS  P   Y   P PSYS  P + Y  
Sbjct: 447 -YSQQPPSSYSQEPTPSYSQQPPSSYSQEPTPSYSQQPPSSYPQEPTPSYSQQPPSSYPQ 505

Query: 333 SRLPLY 350
              P Y
Sbjct: 506 EPTPSY 511

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 41/111 (36%), Positives = 41/111 (36%), Gaps = 6/111 (5%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y   P P YS  P   Y   P P       PP  YS  P   Y S  PP  Y   P
Sbjct: 435 PPSSYSQEPTPSYSQQPPSSYSQEPTPSYS--QQPPSSYSQEPTPSY-SQQPPSSYPQEP 491

Query: 192 PPYYSPSPKVYYKSPPPPSY------YSPSPKVEYKSPPPPSYSPSPKTEY 326
            P YS  P   Y   P PSY      YS  P   Y    PPSYS  P   Y
Sbjct: 492 TPSYSQQPPSSYPQEPTPSYPQQPPSYSQEPTPSYPQ-QPPSYSQEPTPSY 541

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 36/104 (34%), Positives = 38/104 (36%), Gaps = 5/104 (4%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y   P P YS  P   Y   P P     P  PP YS  P   Y   PP Y     P
Sbjct: 483 PPSSYPQEPTPSYSQQPPSSYPQEPTPSY---PQQPPSYSQEPTPSYPQQPPSYSQEPTP 539

Query: 192 -----PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
                PP YS  P   Y   PP     P+P    + PP  SY P
Sbjct: 540 SYPQQPPSYSQEPAPSYPQQPPSYSQEPAPSYPQQPPPVTSYVP 583

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 40/122 (32%), Positives = 42/122 (34%), Gaps = 17/122 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP------PPPCYSPSPKVVYKSPPPPY 173
           P   Y   P P YS  P   Y   P P     PP      P P YS  P   Y   P P 
Sbjct: 451 PPSSYSQEPTPSYSQQPPSSYSQEPTPSYSQQPPSSYPQEPTPSYSQQPPSSYPQEPTPS 510

Query: 174 V------YNSPPPPYYSPSPKVYYKSPPP-----PSYYSPSPKVEYKSPPPPSYSPSPKT 320
                  Y+  P P Y   P  Y + P P     P  YS  P   Y    PPSYS  P  
Sbjct: 511 YPQQPPSYSQEPTPSYPQQPPSYSQEPTPSYPQQPPSYSQEPAPSYPQ-QPPSYSQEPAP 569

Query: 321 EY 326
            Y
Sbjct: 570 SY 571

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 47/120 (39%), Positives = 49/120 (40%), Gaps = 20/120 (16%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSP-PHPHVC----VCPPP---PPCYSPSPKVVYKSPPPPYVYNS-P 188
           PPP YS  P V    P P P V     V PP    PP YS SP V    P  P V +S  
Sbjct: 53  PPPSYSEPPAVTDSYPVPSPSVTDSYPVSPPSYSVPPSYSVSPSVTDSYPVSPSVTDSYS 112

Query: 189 PPPYYSPSPKVYYKSPPPPSY-----------YSPSPKVEYKSPPPPSYSPSPKTEY*IS 335
            PP YS SP V      PPSY            SPS    Y  PP  S  PS    Y +S
Sbjct: 113 VPPSYSVSPSVTDSYSVPPSYSVSPSVTDSYPVSPSVTDSYSVPPSYSVPPSVTDSYPVS 172

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 44/115 (38%), Positives = 45/115 (39%), Gaps = 11/115 (9%)
 Frame = +3

Query: 39  PPYYSPSPKVYYKSPPHPHVCVCPP--------PPPCYSPSPKVVYKSP-PPPYVYNSPP 191
           P  Y P P      PP P     PP        PPP YS  P V    P P P V +S P
Sbjct: 20  PGRYPPPPSYPVSEPPAPTDYPIPPSVTDSYPVPPPSYSEPPAVTDSYPVPSPSVTDSYP 79

Query: 192 --PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPLY 350
             PP YS  P  Y  SP     Y  SP V      PPSYS SP      S  P Y
Sbjct: 80  VSPPSYSVPPS-YSVSPSVTDSYPVSPSVTDSYSVPPSYSVSPSVTDSYSVPPSY 133

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 44/114 (38%), Positives = 45/114 (39%), Gaps = 17/114 (14%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVC----VCPPP---PPCYSPSPKVVYKSPPPPYVYN 182
           Y  PPP Y  P         P P V     V PP    PP YS SP V    P  P V +
Sbjct: 50  YPVPPPSYSEPPAVTDSYPVPSPSVTDSYPVSPPSYSVPPSYSVSPSVTDSYPVSPSVTD 109

Query: 183 S-PPPPYYSPSPKVYYKSPPPPSY---------YSPSPKVEYKSPPPPSYSPSP 314
           S   PP YS SP V      PPSY         Y  SP V      PPSYS  P
Sbjct: 110 SYSVPPSYSVSPSVTDSYSVPPSYSVSPSVTDSYPVSPSVTDSYSVPPSYSVPP 163

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 46/119 (38%), Positives = 47/119 (39%), Gaps = 17/119 (14%)
 Frame = +3

Query: 9   SPKV---YYKSPP----PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYK-SPP 164
           SP V   Y  SPP    PP YS SP V    P  P V      PP YS SP V    S P
Sbjct: 71  SPSVTDSYPVSPPSYSVPPSYSVSPSVTDSYPVSPSVTDSYSVPPSYSVSPSVTDSYSVP 130

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSY---------YSPSPKVEYKSPPPPSYSPSP 314
           P Y  +      Y  SP V      PPSY         Y  SP V      PPSYS  P
Sbjct: 131 PSYSVSPSVTDSYPVSPSVTDSYSVPPSYSVPPSVTDSYPVSPSVTDSYSVPPSYSVPP 189

[172][TOP]
>UniRef100_Q3E939 Uncharacterized protein At5g26080.1 n=1 Tax=Arabidopsis thaliana
           RepID=Q3E939_ARATH
          Length = 141

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/108 (43%), Positives = 54/108 (50%), Gaps = 13/108 (12%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHV----CVCPPPPPCYSPSPKVVYK----SPPPPYVY 179
           Y  PPPPY SP        PP P V       PPPPP YSP P  +Y     SPPPP +Y
Sbjct: 40  YSPPPPPYRSP-----VTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIY 94

Query: 180 NSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVE-----YKSPPPPSYSP 308
              PPP YSP P       PPP  + P+P+ +      +SPPPPS  P
Sbjct: 95  ---PPPIYSPPPT---PISPPPKVHHPAPQAQKAFYYRQSPPPPSGQP 136

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 34/76 (44%), Positives = 36/76 (47%), Gaps = 16/76 (21%)
 Frame = +3

Query: 147 VYKSPPPPY---VYNSPPPPYYS-----PSPKVYYKSPPPPSY----YSPSPKVEYK--- 281
           +Y  PPPPY   V   PPPP YS     P P   Y  PPPP Y    YSP P   Y    
Sbjct: 39  IYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPI 98

Query: 282 -SPPPPSYSPSPKTEY 326
            SPPP   SP PK  +
Sbjct: 99  YSPPPTPISPPPKVHH 114

[173][TOP]
>UniRef100_B9HX94 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HX94_POPTR
          Length = 174

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 52/110 (47%), Positives = 56/110 (50%), Gaps = 14/110 (12%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHP-HVCVCPPPPPCYSPSPK---VVYKSPPPP--YVYNSPP 191
           SPPPP  SP P     SPP P    +CPPPP   SP P      Y SPPPP  Y Y+SPP
Sbjct: 51  SPPPP--SPPPPA--ASPPPPATTAICPPPP---SPPPSGGGSYYYSPPPPSTYTYSSPP 103

Query: 192 PP--------YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           PP        YY P     Y +PPPP+   P     Y SPPPPS S S K
Sbjct: 104 PPQGGVVGGTYYPPPNYKNYPTPPPPNPIVPYFPFYYYSPPPPSMSASFK 153

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 38/99 (38%), Positives = 41/99 (41%), Gaps = 30/99 (30%)
 Frame = +3

Query: 108 PPPPPCYSPSPKVVYKSPPPPYVYNSPPPP-----------YYSPSP--KVYYKSPPPP- 245
           P PPP   PSP     SPPPP      PPP           YYSP P     Y SPPPP 
Sbjct: 50  PSPPP---PSPPPPAASPPPPATTAICPPPPSPPPSGGGSYYYSPPPPSTYTYSSPPPPQ 106

Query: 246 ------SYYSPSPKVEYKSPPPPS----------YSPSP 314
                 +YY P     Y +PPPP+          YSP P
Sbjct: 107 GGVVGGTYYPPPNYKNYPTPPPPNPIVPYFPFYYYSPPP 145

[174][TOP]
>UniRef100_B3XYC5 Chitin-binding lectin n=1 Tax=Solanum lycopersicum var. cerasiforme
           RepID=B3XYC5_SOLLC
          Length = 365

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 53/102 (51%), Positives = 54/102 (52%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP     SPPPP  SPSP     SPP P     P PPP   PSP     SPPPP    SP
Sbjct: 107 SPSPPPPSPPPP--SPSPPPPTPSPPPP----APSPPP---PSPPPPSPSPPPP----SP 153

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPP  SPSP     SPPPPS   PSP     SPPPP+ SP P
Sbjct: 154 PPP--SPSPPPPTPSPPPPS---PSPPPPTPSPPPPAPSPPP 190

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 51/97 (52%), Positives = 51/97 (52%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SPSP      PP P      PPPP  SP P     SPPPP    SPPPP  SP
Sbjct: 102 SPPPP--SPSPPPPSPPPPSPS-----PPPPTPSPPPPA--PSPPPP----SPPPPSPSP 148

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            P     SPPPPS   PSP     SPPPPS SP P T
Sbjct: 149 PPP----SPPPPS---PSPPPPTPSPPPPSPSPPPPT 178

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 42/81 (51%), Positives = 43/81 (53%)
 Frame = +3

Query: 78  SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYS 257
           SPP P      PPPP  SP P     SPPPP    SP PP  +PSP     SPPPPS   
Sbjct: 97  SPPPPS-----PPPPSPSPPPP----SPPPP----SPSPPPPTPSPPPPAPSPPPPSPPP 143

Query: 258 PSPKVEYKSPPPPSYSPSPKT 320
           PSP     SPPPPS SP P T
Sbjct: 144 PSPSPPPPSPPPPSPSPPPPT 164

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 43/116 (37%), Positives = 49/116 (42%), Gaps = 13/116 (11%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPY-------------YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV 146
           +SP  +  SPPPPY              +    ++         C    P  C S  P  
Sbjct: 39  SSPPPHEPSPPPPYPRCGMGGGDGKCKSNECCSIWSWCGTTESFCA---PQNCQSQCPHT 95

Query: 147 VYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
              SPPPP    SPPPP  SP P     SPPPPS   PSP     SPPPP+ SP P
Sbjct: 96  --PSPPPP----SPPPPSPSPPPP----SPPPPS---PSPPPPTPSPPPPAPSPPP 138

[175][TOP]
>UniRef100_Q43586 PAP8 product (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q43586_TOBAC
          Length = 99

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/94 (53%), Positives = 53/94 (56%), Gaps = 13/94 (13%)
 Frame = +3

Query: 12  PKVYYKSPPPPY--YSPSPKVY-----YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           P   YKSPPPP   Y PSP  Y     YKSPP P     P P P Y P+P  VY SPPPP
Sbjct: 9   PAPVYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPLKPYHPSPTP-YHPAP--VYMSPPPP 65

Query: 171 Y-VYNSPPPP---YYSPSP--KVYYKSPPPPSYY 254
             VY SPPPP   Y SP+P     Y SPPPP +Y
Sbjct: 66  TPVYKSPPPPTPVYKSPAPHHPYLYASPPPPYHY 99

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/103 (46%), Positives = 54/103 (52%), Gaps = 12/103 (11%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY-VYNSPPPPY 200
           + S PPP     P   YKSPP P     P P P Y P+P  VYKSPPPP   Y+  P PY
Sbjct: 2   FTSRPPP-----PAPVYKSPPPPKKPYHPSPTP-YHPAP--VYKSPPPPLKPYHPSPTPY 53

Query: 201 Y-------SPSPKVYYKSPPPPS--YYSPSP--KVEYKSPPPP 296
           +        P P   YKSPPPP+  Y SP+P     Y SPPPP
Sbjct: 54  HPAPVYMSPPPPTPVYKSPPPPTPVYKSPAPHHPYLYASPPPP 96

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 39/85 (45%), Positives = 42/85 (49%), Gaps = 12/85 (14%)
 Frame = +3

Query: 108 PPPPPCYS--PSPKVVYKSPPPPYVYNSPPPPYYSPSP--KVYYKSP----PPPSYYSPS 263
           PPP P Y   P PK  Y   P PY    P P Y SP P  K Y+ SP    P P Y SP 
Sbjct: 7   PPPAPVYKSPPPPKKPYHPSPTPY---HPAPVYKSPPPPLKPYHPSPTPYHPAPVYMSPP 63

Query: 264 PKVE-YKSPPPPS---YSPSPKTEY 326
           P    YKSPPPP+    SP+P   Y
Sbjct: 64  PPTPVYKSPPPPTPVYKSPAPHHPY 88

[176][TOP]
>UniRef100_Q40552 Pistil extensin like protein (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q40552_TOBAC
          Length = 393

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 48/105 (45%), Positives = 50/105 (47%), Gaps = 3/105 (2%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYY-KSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           SP V    PPP    PSP     K PP P     PPPPP    S     K PPPP     
Sbjct: 106 SPPVKPPPPPPSPCKPSPPDQSTKQPPPPPPSKQPPPPPPVKASSPSPAKQPPPP----- 160

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVE--YKSPPPPSYSPSP 314
            PPP  SPSP    +SPPPP   SPSP  +   K PPPPS   SP
Sbjct: 161 -PPPVKSPSPSPAKQSPPPPRAPSPSPATQPPIKQPPPPSAKKSP 204

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 48/108 (44%), Positives = 52/108 (48%), Gaps = 6/108 (5%)
 Frame = +3

Query: 39  PPYYSPSPKVYYKSPPHPHVCVCPPPP-PCYSPSPKVVYKSPPPPYVYNSPPPP----YY 203
           PP   P P     S P P V   PPPP PC    P    K PPPP     PPPP      
Sbjct: 95  PPVNRPKP-----SSPSPPVKPPPPPPSPCKPSPPDQSTKQPPPPPPSKQPPPPPPVKAS 149

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP-SYSPSPKTEY*ISRLP 344
           SPSP      PPPP   SPSP    +SPPPP + SPSP T+  I + P
Sbjct: 150 SPSP-AKQPPPPPPPVKSPSPSPAKQSPPPPRAPSPSPATQPPIKQPP 196

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 46/99 (46%), Positives = 51/99 (51%), Gaps = 2/99 (2%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYK-SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           PPPP   P P    K S P P     PPPPP  SPSP    +SPPPP    +P P   SP
Sbjct: 133 PPPPSKQPPPPPPVKASSPSPAKQPPPPPPPVKSPSPSPAKQSPPPP---RAPSP---SP 186

Query: 210 SPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSYSPSPKTE 323
           + +   K PPPPS   SP P V Y  PP  + SPSP  E
Sbjct: 187 ATQPPIKQPPPPSAKKSPPPPVAY--PPVMAPSPSPAAE 223

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 41/109 (37%), Positives = 45/109 (41%), Gaps = 7/109 (6%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP      PPPP  SPSP    +SPP       PP  P  SP+ +   K PPPP    SP
Sbjct: 152 SPAKQPPPPPPPVKSPSPSPAKQSPP-------PPRAPSPSPATQPPIKQPPPPSAKKSP 204

Query: 189 PPPYYSPSPKVYYKSP---PPPSYYSPSPKVEY----KSPPPPSYSPSP 314
           PPP   P       SP   PP     PSP        + P PP   P P
Sbjct: 205 PPPVAYPPVMAPSPSPAAEPPIIAPFPSPTANLPLIPRRPAPPVVKPLP 253

[177][TOP]
>UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata
           RepID=UPI0001926FBD
          Length = 268

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 41/94 (43%), Positives = 43/94 (45%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP   P P      PP P V  CPPPPPC  P P      PPPP +   PPPP   P 
Sbjct: 145 PPPPPPPPPPPPPPPPPPPPPVVFCPPPPPC-PPPPAPCPPPPPPPPMCLPPPPPPPPPP 203

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P      PPPP    P P      PPPP   P+P
Sbjct: 204 PPCPLPPPPPP---CPPPPAPCPPPPPPPACPAP 234

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 40/94 (42%), Positives = 43/94 (45%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP  +P P      PP P   VCPPPPP  +P P      PPPP     PPPP   P 
Sbjct: 113 PPPP--APCP------PPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPP 164

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P V+   PPPP    P        PPPP   P P
Sbjct: 165 PVVF--CPPPPPCPPPPAPCPPPPPPPPMCLPPP 196

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 39/94 (41%), Positives = 40/94 (42%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP   P P +    PP P     PPPPP   P P      PPPP V   PPPP   P 
Sbjct: 124 PPPPVCPPPPPMCAPPPPPP-----PPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPP 178

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P      PPPP    P P      PPPP   P P
Sbjct: 179 PAPCPPPPPPPPMCLPPP-----PPPPPPPPPCP 207

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 40/98 (40%), Positives = 42/98 (42%), Gaps = 4/98 (4%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPP----CYSPSPKVVYKSPPPPYVYNSPPPPY 200
           PPPP   P P      PP P    CPPPPP    C  P P      PPPP     PPPP 
Sbjct: 101 PPPPGCGPPPPC----PPPP--APCPPPPPPPPVCPPPPPMCAPPPPPPP----PPPPPP 150

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             P P      PPPP  + P P      PPPP+  P P
Sbjct: 151 PPPPPPPPPPPPPPPVVFCPPPP---PCPPPPAPCPPP 185

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 39/95 (41%), Positives = 42/95 (44%), Gaps = 1/95 (1%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP-CYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           K PPPP  +  P      PP P    CPPPP  C  P P      PPPP    +PPPP  
Sbjct: 90  KPPPPPQPACPPPPPGCGPPPP----CPPPPAPCPPPPPPPPVCPPPPPMC--APPPPPP 143

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P P      PPPP    P P V +  PPPP   P
Sbjct: 144 PPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPP 178

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 39/99 (39%), Positives = 41/99 (41%), Gaps = 6/99 (6%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVC------VCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP 197
           PPP   P P      PP P VC        PPPPP   P P      PPPP     PPPP
Sbjct: 108 PPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPP-----PPPPP----PPPPP 158

Query: 198 YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
              P P V +  PPPP    P+P      PPP    P P
Sbjct: 159 PPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPP 197

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 33/78 (42%), Positives = 37/78 (47%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP   P P      PP P +C+ PPPPP   P P      PPPP     PPPP   P 
Sbjct: 170 PPPPPCPPPPAPCPPPPPPPPMCLPPPPPP-PPPPPPCPLPPPPPP----CPPPPAPCPP 224

Query: 213 PKVYYKSPPPPSYYSPSP 266
           P      PPPP+  +P P
Sbjct: 225 P------PPPPACPAPMP 236

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 32/78 (41%), Positives = 32/78 (41%)
 Frame = +3

Query: 81  PPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP 260
           PP P    CPPPPP   P P      PPP      PPPP   P P      PPPP    P
Sbjct: 91  PPPPPQPACPPPPPGCGPPPPC---PPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPP 147

Query: 261 SPKVEYKSPPPPSYSPSP 314
            P      PPPP   P P
Sbjct: 148 PP------PPPPPPPPPP 159

[178][TOP]
>UniRef100_Q212G2 Peptidase C14, caspase catalytic subunit p20 n=1 Tax=Rhodopseudomonas
            palustris BisB18 RepID=Q212G2_RHOPB
          Length = 1026

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 44/105 (41%), Positives = 52/105 (49%), Gaps = 3/105 (2%)
 Frame = +3

Query: 6    ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS---PSPKVVYKSPPPPYV 176
            A+P V   +PPPP     P V    PP P V   PPPPP      P P VV+++PPPP V
Sbjct: 905  AAPPVVRPAPPPP-----PVVRQAPPPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPV 959

Query: 177  YNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
                PPP   P P V   +PPPP    P P    + PPPP   P+
Sbjct: 960  VRQAPPPPPPPPPPVVRPAPPPP---PPPPPPVMRPPPPPPPPPA 1001

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 43/102 (42%), Positives = 49/102 (48%), Gaps = 8/102 (7%)
 Frame = +3

Query: 33   PPPPYYSPSPK----VYYKSPPHPHVCVCPPPPPCY--SPSPKVVYKS--PPPPYVYNSP 188
            PPPP   P+P     V    PP P V   PPPPP    +P P  V +   PPPP V+ +P
Sbjct: 895  PPPPAARPAPAAPPVVRPAPPPPPVVRQAPPPPPVVRQAPPPPPVVRQAPPPPPVVHQAP 954

Query: 189  PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PPP     P V    PPPP    P P V   +PPPP   P P
Sbjct: 955  PPP-----PVVRQAPPPPP---PPPPPVVRPAPPPPPPPPPP 988

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 42/105 (40%), Positives = 50/105 (47%), Gaps = 6/105 (5%)
 Frame = +3

Query: 12   PKVYYKSPPPP----YYSPSPKVYYKSPPHPHVC--VCPPPPPCYSPSPKVVYKSPPPPY 173
            P V  ++PPPP       P P V +++PP P V     PPPPP     P VV  +PPPP 
Sbjct: 927  PPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPPPPPPP---PPPVVRPAPPPP- 982

Query: 174  VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
                PPPP     P V    PPPP    P P     +PPPP+  P
Sbjct: 983  ----PPPP-----PPVMRPPPPPP----PPPAAARPAPPPPAAKP 1014

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 37/97 (38%), Positives = 47/97 (48%), Gaps = 8/97 (8%)
 Frame = +3

Query: 30   SPPP---PYYSPSPKVYYKSPPHPHVC--VCPPPPPCYSPSPK---VVYKSPPPPYVYNS 185
            +PPP   P  +P+P     +P  P V     PPPPP   P+P    VV  +PPPP V   
Sbjct: 863  TPPPAAAPPATPTPPAVRPAPAPPPVVRPAPPPPPPAARPAPAAPPVVRPAPPPPPVVRQ 922

Query: 186  PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
             PPP     P V  ++PPPP        V  ++PPPP
Sbjct: 923  APPP-----PPVVRQAPPPPP-------VVRQAPPPP 947

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 32/98 (32%), Positives = 39/98 (39%), Gaps = 4/98 (4%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY---- 200
            P PP   PSP     +   P      PPP    P P      PPPP      PPP     
Sbjct: 812  PLPPAAPPSPATPPSAAKPPATVAPTPPPAAARPQPAAPAPVPPPPAAGRPTPPPAAAPP 871

Query: 201  YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             +P+P     +P PP    P+P      PPPP+  P+P
Sbjct: 872  ATPTPPAVRPAPAPPPVVRPAP-----PPPPPAARPAP 904

[179][TOP]
>UniRef100_C5YGB7 Putative uncharacterized protein Sb06g016310 n=1 Tax=Sorghum
           bicolor RepID=C5YGB7_SORBI
          Length = 283

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 54/132 (40%), Positives = 64/132 (48%), Gaps = 28/132 (21%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP----PPCYSPSPK------VVYK 155
           A+PK     P PP Y+PSPK   KSP +P     PPP    PP Y+PSPK        Y 
Sbjct: 85  ATPK-----PTPPTYTPSPKP--KSPVYP-----PPPKASTPPTYTPSPKPPATKPPTYP 132

Query: 156 SPPPPYVYNSPPPPYYSPSPK--------------VYYKSPPP----PSYYSPSPKVEYK 281
           +P PP     P PP Y+PSPK              VY  +P P    P  ++PSPK    
Sbjct: 133 TPKPP-ATKPPTPPVYTPSPKPPVTKPPTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTS 191

Query: 282 SPPPPSYSPSPK 317
            P PP Y+PSPK
Sbjct: 192 KPTPPVYTPSPK 203

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/118 (36%), Positives = 53/118 (44%), Gaps = 21/118 (17%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-----PPYVYNSPP 191
           K P PP Y+PSPK     PP P      P PP Y+P+PK     PP     P    + P 
Sbjct: 140 KPPTPPVYTPSPKPPVTKPPTPK-----PTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPT 194

Query: 192 PPYYSPSPKVYYKSPPP----------------PSYYSPSPKVEYKSPPPPSYSPSPK 317
           PP Y+PSPK    SPP                 P++  P+P      P PP+Y P+PK
Sbjct: 195 PPVYTPSPKPPKPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPIPKPTPPTYKPAPK 252

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/111 (42%), Positives = 53/111 (47%), Gaps = 16/111 (14%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPK---VVYKSPP----PPYVYNSPP 191
           P PP Y+PSPK      P P      P PP Y+PSPK    VY  PP    PP    SP 
Sbjct: 69  PTPPTYTPSPK------PTPPPATPKPTPPTYTPSPKPKSPVYPPPPKASTPPTYTPSPK 122

Query: 192 PPYYS----PSPKVYYKSPPPPSYYSPSPKVEYKSPP-----PPSYSPSPK 317
           PP       P+PK     PP P  Y+PSPK     PP     PP Y+P+PK
Sbjct: 123 PPATKPPTYPTPKPPATKPPTPPVYTPSPKPPVTKPPTPKPTPPVYTPNPK 173

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/111 (42%), Positives = 57/111 (51%), Gaps = 14/111 (12%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPP-HPHV---CVCPPPPPCYSPSPKVVYKSPPPPY----VYN 182
           K+  PP Y+PSPK     PP +P        PP PP Y+PSPK     PP P     VY 
Sbjct: 110 KASTPPTYTPSPKPPATKPPTYPTPKPPATKPPTPPVYTPSPKPPVTKPPTPKPTPPVYT 169

Query: 183 SPP------PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
             P      PP ++PSPK     P PP  Y+PSPK     P PP+Y+P+PK
Sbjct: 170 PNPKPPVTKPPTHTPSPKPPTSKPTPP-VYTPSPKP--PKPSPPTYTPTPK 217

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/105 (36%), Positives = 45/105 (42%), Gaps = 10/105 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP--------- 164
           P  +  SP PP   P+P VY  SP  P      P PP Y+P+PK     PP         
Sbjct: 179 PPTHTPSPKPPTSKPTPPVYTPSPKPPK-----PSPPTYTPTPKPPATKPPTSTPTHPKP 233

Query: 165 -PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            P      P PP Y P+PK    +P PP+Y  P        PPPP
Sbjct: 234 TPHTPIPKPTPPTYKPAPKPTPPAPTPPTYTPPVSHTPSSPPPPP 278

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 49/126 (38%), Positives = 55/126 (43%), Gaps = 30/126 (23%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPP---HPHVCVCPPP-----PPCYSPSPKVVYKSPPPPYVYNS 185
           +P PP   P P+     PP   H H    PP      PP Y+PSPK     P PP     
Sbjct: 38  TPKPPAKGPKPE----KPPTKGHGHKPEKPPKEHKPTPPTYTPSPK-----PTPPPATPK 88

Query: 186 PPPPYYSPSPK----VYYKSPPP----PSYYSPSPKVEYKSPP--------------PPS 299
           P PP Y+PSPK    VY   PPP    P  Y+PSPK     PP              PP 
Sbjct: 89  PTPPTYTPSPKPKSPVY--PPPPKASTPPTYTPSPKPPATKPPTYPTPKPPATKPPTPPV 146

Query: 300 YSPSPK 317
           Y+PSPK
Sbjct: 147 YTPSPK 152

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 35/100 (35%), Positives = 41/100 (41%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + SP  Y  +P PP   P         P PH  +  P PP Y P+PK     P PP    
Sbjct: 206 KPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPIPKPTPPTYKPAPK-----PTPP---- 256

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           +P PP Y+P       SPPPP             PPPP Y
Sbjct: 257 APTPPTYTPPVSHTPSSPPPP-------------PPPPYY 283

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 39/104 (37%), Positives = 48/104 (46%), Gaps = 13/104 (12%)
 Frame = +3

Query: 45  YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVY 224
           Y +P+PK   K P        P  PP      K     P  P   + P PP Y+PSPK  
Sbjct: 34  YPTPTPKPPAKGPK-------PEKPPTKGHGHK-----PEKPPKEHKPTPPTYTPSPK-- 79

Query: 225 YKSPPP------PSYYSPSPKVE---YKSPP----PPSYSPSPK 317
             +PPP      P  Y+PSPK +   Y  PP    PP+Y+PSPK
Sbjct: 80  -PTPPPATPKPTPPTYTPSPKPKSPVYPPPPKASTPPTYTPSPK 122

[180][TOP]
>UniRef100_P24152 Extensin n=1 Tax=Sorghum bicolor RepID=EXTN_SORBI
          Length = 283

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 54/132 (40%), Positives = 64/132 (48%), Gaps = 28/132 (21%)
 Frame = +3

Query: 6   ASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP----PPCYSPSPK------VVYK 155
           A+PK     P PP Y+PSPK   KSP +P     PPP    PP Y+PSPK        Y 
Sbjct: 85  ATPK-----PTPPTYTPSPKP--KSPVYP-----PPPKASTPPTYTPSPKPPATKPPTYP 132

Query: 156 SPPPPYVYNSPPPPYYSPSPK--------------VYYKSPPP----PSYYSPSPKVEYK 281
           +P PP     P PP Y+PSPK              VY  +P P    P  ++PSPK    
Sbjct: 133 TPKPP-ATKPPTPPVYTPSPKPPVTKPPTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTS 191

Query: 282 SPPPPSYSPSPK 317
            P PP Y+PSPK
Sbjct: 192 KPTPPVYTPSPK 203

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/117 (39%), Positives = 56/117 (47%), Gaps = 8/117 (6%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-----PPYVYNSPP 191
           K P PP Y+PSPK     PP P      P PP Y+P+PK     PP     P    + P 
Sbjct: 140 KPPTPPVYTPSPKPPVTKPPTPK-----PTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPT 194

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP---PPSYSPSPKTEY*ISRLPLYE 353
           PP Y+PSPK    SPP    Y+P+PK     PP   P    P+P T Y  +  P Y+
Sbjct: 195 PPVYTPSPKPPKPSPPT---YTPTPKPPATKPPTSTPTHPKPTPHTPYPQAHPPTYK 248

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/111 (42%), Positives = 53/111 (47%), Gaps = 16/111 (14%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPK---VVYKSPP----PPYVYNSPP 191
           P PP Y+PSPK      P P      P PP Y+PSPK    VY  PP    PP    SP 
Sbjct: 69  PTPPTYTPSPK------PTPPPATPKPTPPTYTPSPKPKSPVYPPPPKASTPPTYTPSPK 122

Query: 192 PPYYS----PSPKVYYKSPPPPSYYSPSPKVEYKSPP-----PPSYSPSPK 317
           PP       P+PK     PP P  Y+PSPK     PP     PP Y+P+PK
Sbjct: 123 PPATKPPTYPTPKPPATKPPTPPVYTPSPKPPVTKPPTPKPTPPVYTPNPK 173

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/111 (42%), Positives = 57/111 (51%), Gaps = 14/111 (12%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPP-HPHV---CVCPPPPPCYSPSPKVVYKSPPPPY----VYN 182
           K+  PP Y+PSPK     PP +P        PP PP Y+PSPK     PP P     VY 
Sbjct: 110 KASTPPTYTPSPKPPATKPPTYPTPKPPATKPPTPPVYTPSPKPPVTKPPTPKPTPPVYT 169

Query: 183 SPP------PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
             P      PP ++PSPK     P PP  Y+PSPK     P PP+Y+P+PK
Sbjct: 170 PNPKPPVTKPPTHTPSPKPPTSKPTPP-VYTPSPKP--PKPSPPTYTPTPK 217

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 43/114 (37%), Positives = 53/114 (46%), Gaps = 11/114 (9%)
 Frame = +3

Query: 9   SPKVYYKSPP-----PPYYSPSPKVYYKSPP----HPHVCVCPPPPPCYSPSPKVVYKSP 161
           SPK     PP     PP Y+P+PK     PP     P      P PP Y+PSPK     P
Sbjct: 150 SPKPPVTKPPTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPK-----P 204

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPP--PPSYYSPSPKVEYKSPPPPSYSPSPK 317
           P       P PP Y+P+PK     PP   P++  P+P   Y    PP+Y P+PK
Sbjct: 205 P------KPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPYPQAHPPTYKPAPK 252

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 38/105 (36%), Positives = 45/105 (42%), Gaps = 10/105 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP--------- 164
           P  +  SP PP   P+P VY  SP  P      P PP Y+P+PK     PP         
Sbjct: 179 PPTHTPSPKPPTSKPTPPVYTPSPKPPK-----PSPPTYTPTPKPPATKPPTSTPTHPKP 233

Query: 165 -PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            P   Y    PP Y P+PK    +P PP+Y  P        PPPP
Sbjct: 234 TPHTPYPQAHPPTYKPAPKPSPPAPTPPTYTPPVSHTPSSPPPPP 278

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 49/126 (38%), Positives = 55/126 (43%), Gaps = 30/126 (23%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPP---HPHVCVCPPP-----PPCYSPSPKVVYKSPPPPYVYNS 185
           +P PP   P P+     PP   H H    PP      PP Y+PSPK     P PP     
Sbjct: 38  TPKPPAKGPKPE----KPPTKGHGHKPEKPPKEHKPTPPTYTPSPK-----PTPPPATPK 88

Query: 186 PPPPYYSPSPK----VYYKSPPP----PSYYSPSPKVEYKSPP--------------PPS 299
           P PP Y+PSPK    VY   PPP    P  Y+PSPK     PP              PP 
Sbjct: 89  PTPPTYTPSPKPKSPVY--PPPPKASTPPTYTPSPKPPATKPPTYPTPKPPATKPPTPPV 146

Query: 300 YSPSPK 317
           Y+PSPK
Sbjct: 147 YTPSPK 152

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 34/100 (34%), Positives = 39/100 (39%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + SP  Y  +P PP   P         P PH       PP Y P+PK     P PP    
Sbjct: 206 KPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPYPQAHPPTYKPAPK-----PSPP---- 256

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           +P PP Y+P       SPPPP             PPPP Y
Sbjct: 257 APTPPTYTPPVSHTPSSPPPP-------------PPPPYY 283

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 39/104 (37%), Positives = 48/104 (46%), Gaps = 13/104 (12%)
 Frame = +3

Query: 45  YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVY 224
           Y +P+PK   K P        P  PP      K     P  P   + P PP Y+PSPK  
Sbjct: 34  YPTPTPKPPAKGPK-------PEKPPTKGHGHK-----PEKPPKEHKPTPPTYTPSPK-- 79

Query: 225 YKSPPP------PSYYSPSPKVE---YKSPP----PPSYSPSPK 317
             +PPP      P  Y+PSPK +   Y  PP    PP+Y+PSPK
Sbjct: 80  -PTPPPATPKPTPPTYTPSPKPKSPVYPPPPKASTPPTYTPSPK 122

[181][TOP]
>UniRef100_A9S7U4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9S7U4_PHYPA
          Length = 296

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 50/83 (60%), Positives = 52/83 (62%), Gaps = 8/83 (9%)
 Frame = +3

Query: 90  PHVCVCPPPP--PCY-SP---SPKVVYKSPP--PPYVYNSPPPPYYSPSPKVYYKSPPPP 245
           P +  CPPPP  P Y SP   SP  VY+SPP  P  VY SPP P YSPSP   YKSP   
Sbjct: 212 PTLPSCPPPPESPVYESPPYASPSPVYESPPYSPSPVYESPPSPTYSPSP--VYKSPT-- 267

Query: 246 SYYSPSPKVEYKSPPPPSYSPSP 314
             YSPSP   YKSPP PSYSPSP
Sbjct: 268 --YSPSP--VYKSPPSPSYSPSP 286

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/74 (58%), Positives = 45/74 (60%), Gaps = 3/74 (4%)
 Frame = +3

Query: 39  PPYYSPSPKVYYKSPPH-PHVCVCPPPPPCYSPSPKVVYKSPP--PPYVYNSPPPPYYSP 209
           PPY SPSP   Y+SPP+ P      PP P YSPSP  VYKSP   P  VY SPP P YSP
Sbjct: 229 PPYASPSP--VYESPPYSPSPVYESPPSPTYSPSP--VYKSPTYSPSPVYKSPPSPSYSP 284

Query: 210 SPKVYYKSPPPPSY 251
           SP   YKSPP   Y
Sbjct: 285 SP--VYKSPPAGGY 296

[182][TOP]
>UniRef100_B4H1U4 GL17948 n=1 Tax=Drosophila persimilis RepID=B4H1U4_DROPE
          Length = 415

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 51/116 (43%), Positives = 57/116 (49%), Gaps = 14/116 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPP---YYSPSP--KVYYKSPPHP-----HVCVCPPPPPCY-SPSPKVVYK 155
           +P   Y  P PP   Y  P+P  KV Y  PP P      V   PPPPP Y  P+P  V  
Sbjct: 154 APAPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEY 213

Query: 156 SPPPPY---VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP P    VY  PPPP  +P  KV Y  PPPP   +P  KV Y  PPPP   P+P
Sbjct: 214 LPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPP-PAPVKKVVYTPPPPP---PAP 265

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 47/104 (45%), Positives = 55/104 (52%), Gaps = 5/104 (4%)
 Frame = +3

Query: 30  SPPPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-YVYNSPPPPYY 203
           +P P Y  P+P KV Y  P      V  PPPP  +P  KVVY  PPPP YV  +PP   Y
Sbjct: 154 APAPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEY 213

Query: 204 ---SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
              +P  KV Y +PPPP   +P  KV Y  PPPP  +P  K  Y
Sbjct: 214 LPPAPVKKVVY-TPPPPPPPAPVKKVVYTPPPPPPPAPVKKVVY 256

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 58/159 (36%), Positives = 65/159 (40%), Gaps = 47/159 (29%)
 Frame = +3

Query: 15  KVYYKSPPPPYY--SPSPKVYYKSP-PHPHVCVCPPPPPCYSPSPKVVYKSPPPP----- 170
           KV Y  PPPP Y     PKV Y  P P   V   PPPPP  +P  KVVY  PPPP     
Sbjct: 192 KVVYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPPPAPV 251

Query: 171 --YVYNSPPPP-----------------------YYSPSPKVYYK---SPPPPSYYSPSP 266
              VY  PPPP                       Y  P+P    K   +P PP Y  P+P
Sbjct: 252 KKVVYTPPPPPPAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVTPAPPVYVKPAP 311

Query: 267 -KVEYK----------SPPPPSYSPSPKTEY*ISRLPLY 350
            KVEY           +PPPP  +P  K  Y     P+Y
Sbjct: 312 PKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVY 350

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 47/95 (49%), Positives = 53/95 (55%), Gaps = 6/95 (6%)
 Frame = +3

Query: 36  PPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP---YY 203
           PP Y  P+P KV Y  P      V  PPPP  +P  KVVY  PPPP VY  P PP   Y 
Sbjct: 303 PPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPP-VYVKPAPPKVEYL 361

Query: 204 SPSP--KVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
            P+P  KV Y +PPPP   +P  KV Y +PPPP Y
Sbjct: 362 PPAPVKKVVY-TPPPPPPPAPVQKVGY-TPPPPVY 394

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 50/121 (41%), Positives = 59/121 (48%), Gaps = 15/121 (12%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSP--KVYYKSPPHP-----HVCVCPPPPPCY-SPSPKVVYKS 158
           +P VY K  PP   Y  P+P  KV Y  PP P      V   PPPPP Y  P+P  V   
Sbjct: 302 APPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEYL 361

Query: 159 PPPPY---VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY--SPSPKTE 323
           PP P    VY  PPPP  +P  KV Y +PPPP Y      V+++ P   SY   P P  +
Sbjct: 362 PPAPVKKVVYTPPPPPPPAPVQKVGY-TPPPPVY------VQHEGPKSYSYPNDPQPSFD 414

Query: 324 Y 326
           Y
Sbjct: 415 Y 415

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 52/135 (38%), Positives = 57/135 (42%), Gaps = 31/135 (22%)
 Frame = +3

Query: 15  KVYYKSPPPP-------------YYSPSPKVY-YKSPPHPHVC---VCPPPPPCYSPSPK 143
           KV Y  PPPP             Y  PS K   Y+ P  P V    V P PP    P+P 
Sbjct: 253 KVVYTPPPPPPAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVTPAPPVYVKPAPP 312

Query: 144 VVYKSPPPPY---VYNSPPPP--------YYSPSPKVYYK-SPPPPSYYSPSP--KVEYK 281
            V   PP P    VY  PPPP        Y  P P VY K +PP   Y  P+P  KV Y 
Sbjct: 313 KVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYT 372

Query: 282 SPPPPSYSPSPKTEY 326
            PPPP  +P  K  Y
Sbjct: 373 PPPPPPPAPVQKVGY 387

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 45/130 (34%), Positives = 54/130 (41%), Gaps = 23/130 (17%)
 Frame = +3

Query: 6   ASPKVYYKSPPPP-----YYSPSPKVYYKSPPHPHVCVCPP-------------PPPCYS 131
           A P V Y++P P      Y +P  KVY  +PP        P             P   + 
Sbjct: 86  APPAVIYQAPKPTPPRPVYTAPPAKVYTPAPPAKVYTPAVPAGALKEDGYHYGQPSVKFE 145

Query: 132 PSPKVVYKSPPPPYVYNSPPPPYY---SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
              K V  +P P YV  +PP   Y   +P  KV Y  PPPP   +P  KV Y  PPPP Y
Sbjct: 146 TYEKPVETAPAPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPP--APVKKVVYTPPPPPVY 203

Query: 303 --SPSPKTEY 326
                PK EY
Sbjct: 204 VKPAPPKVEY 213

[183][TOP]
>UniRef100_Q018S3 Oxalate/formate antiporter (ISS) (Fragment) n=1 Tax=Ostreococcus
           tauri RepID=Q018S3_OSTTA
          Length = 818

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 43/111 (38%), Positives = 58/111 (52%), Gaps = 6/111 (5%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYY--SPSPKVYYKSPPHPHVCVCPP----PPPCYSPSPKVVYKSPP 164
           R SP  +++ PPPP    SP P+ +  SPPH H    PP    PPP +   P  +    P
Sbjct: 640 RRSPPRHHRGPPPPRRRGSPPPRHHRGSPPH-HQHGPPPDHGGPPPHHHHGPPPLDHRGP 698

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           PP+ ++ PPPP++   P   +  PPPPSY    P   Y S P P Y+P P+
Sbjct: 699 PPH-HHGPPPPHHHGPPPHQHGPPPPPSYEQMVPPTAYPSSPYPMYAPPPE 748

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/106 (33%), Positives = 49/106 (46%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           R SP  +   PPP +  P P  ++  PP  H     PPP  +          PPPP+ ++
Sbjct: 665 RGSPPHHQHGPPPDHGGPPPHHHHGPPPLDHR---GPPPHHH---------GPPPPH-HH 711

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
            PPP  + P P   Y+   PP+ Y  SP   Y  PP P  +P P++
Sbjct: 712 GPPPHQHGPPPPPSYEQMVPPTAYPSSPYPMYAPPPEPPRAPPPES 757

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 30/80 (37%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPS-PKVVYKSPPPPYVYNSP 188
           P + ++ PPP ++ P P  ++  PPH H    PPPPP Y    P   Y  P  PY   +P
Sbjct: 691 PPLDHRGPPPHHHGPPPPHHHGPPPHQHG---PPPPPSYEQMVPPTAY--PSSPYPMYAP 745

Query: 189 PP-PYYSPSPKVYYKSPPPP 245
           PP P  +P P+      PPP
Sbjct: 746 PPEPPRAPPPESPRSMAPPP 765

[184][TOP]
>UniRef100_B8A7W6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A7W6_ORYSI
          Length = 512

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/96 (42%), Positives = 46/96 (47%), Gaps = 5/96 (5%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP-----PPYVYNSPPPPY 200
           P P   P+P+    SPP P     PPP P  SP P     SPP     PP  ++ PPPP 
Sbjct: 400 PAPAKKPAPESSKHSPPPP-----PPPAPVQSPPPPAPVVSPPSPVFSPPPAFSPPPPPK 454

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            SP P V    PPPP  +SP P     SPPPP   P
Sbjct: 455 TSPPPPVSSPPPPPPPAFSPPPPPPTMSPPPPIQEP 490

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 42/117 (35%), Positives = 52/117 (44%), Gaps = 17/117 (14%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP-----PPPCYSPSPKVVYKSPPP 167
           + +P+    SPPPP     P    +SPP P   V PP     PPP +SP P      PPP
Sbjct: 405 KPAPESSKHSPPPP----PPPAPVQSPPPPAPVVSPPSPVFSPPPAFSPPPPPKTSPPPP 460

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVE------------YKSPPPPSY 302
                 PPPP +SP        PPPP   SP P ++            Y+SPPPP +
Sbjct: 461 VSSPPPPPPPAFSP--------PPPPPTMSPPPPIQEPVILPPILSAKYQSPPPPFF 509

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 35/90 (38%), Positives = 40/90 (44%), Gaps = 14/90 (15%)
 Frame = +3

Query: 87  HPHVCV----CPPPPPCYSPSPKVVYKSPPPP---YVYNSPPP--PYYSP-----SPKVY 224
           HP  C     C  P P   P+P+    SPPPP       SPPP  P  SP     SP   
Sbjct: 387 HPVDCSKTKPCGWPAPAKKPAPESSKHSPPPPPPPAPVQSPPPPAPVVSPPSPVFSPPPA 446

Query: 225 YKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           +  PPPP    P P      PPPP++SP P
Sbjct: 447 FSPPPPPKTSPPPPVSSPPPPPPPAFSPPP 476

[185][TOP]
>UniRef100_Q9VZC0 CG11345 n=1 Tax=Drosophila melanogaster RepID=Q9VZC0_DROME
          Length = 242

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 40/96 (41%), Positives = 49/96 (51%), Gaps = 2/96 (2%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSP-KVVYKSPPPPYVYNSPPPPYY 203
           ++P P Y  P P V   +PP P     PPPPP    +P K  Y  PPPP V  +PP P Y
Sbjct: 87  RTPKPAYLPPPPPVIKVNPPKP--AYLPPPPPVVKVNPPKPAYLPPPPPVVKVNPPKPSY 144

Query: 204 SPSPKVYYK-SPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P P    K +PP P+Y  P P     +PP P+Y P
Sbjct: 145 LPPPPPVVKVNPPKPAYVPPPPPAVKVNPPKPAYLP 180

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 42/97 (43%), Positives = 48/97 (49%), Gaps = 4/97 (4%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPP--HPHVCVCPPPPPCYSPSP-KVVYKSPPPPYVYNSPPPPYYS 206
           PPP Y P   V  + P    P     PPPPP    +P K  Y  PPPP V  +PP P Y 
Sbjct: 69  PPPVYLPPATVKPEIPVVRTPKPAYLPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYL 128

Query: 207 PSPKVYYK-SPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P P    K +PP PSY  P P V   +PP P+Y P P
Sbjct: 129 PPPPPVVKVNPPKPSYLPPPPPVVKVNPPKPAYVPPP 165

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/125 (39%), Positives = 57/125 (45%), Gaps = 10/125 (8%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSP-KVYYKSPPHPHVCVCPPPPPCYSPSPKVV--------YKSP 161
           +PK  Y  PPPP    +P K  Y  PP P V V PP P    P P VV        Y  P
Sbjct: 88  TPKPAYLPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYLPPPPPVVKVNPPKPSYLPP 147

Query: 162 PPPYVYNSPPPPYYSPSPKVYYK-SPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISR 338
           PPP V  +PP P Y P P    K +PP P+Y  P+P VE      P+  P+ K       
Sbjct: 148 PPPVVKVNPPKPAYVPPPPPAVKVNPPKPAYLPPAPVVEQPRYVAPAVVPAFKIPIPSYA 207

Query: 339 LPLYE 353
            PL E
Sbjct: 208 APLEE 212

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 43/116 (37%), Positives = 51/116 (43%), Gaps = 15/116 (12%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP--PPPCYSP------------SPKVV 149
           P   Y  P  P+  P+P   Y  P    V   P   PPP Y P            +PK  
Sbjct: 33  PGYNYDPPSIPFELPTPAPAYLPPEPVTVREAPVTVPPPVYLPPATVKPEIPVVRTPKPA 92

Query: 150 YKSPPPPYVYNSPPPPYYSPSPKVYYK-SPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           Y  PPPP +  +PP P Y P P    K +PP P+Y  P P V   +PP PSY P P
Sbjct: 93  YLPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYLPPPPPVVKVNPPKPSYLPPP 148

[186][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 45/95 (47%), Positives = 45/95 (47%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP  SP P     SPPPP      PPP   P
Sbjct: 287 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 345

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPPS   PSP      PPPPS  PSP
Sbjct: 346 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSP 380

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/96 (47%), Positives = 46/96 (47%), Gaps = 1/96 (1%)
 Frame = +3

Query: 30  SPPPPYYSP-SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP   P SP      PP P     PPPPP  SP P     SPPPP      PPP   
Sbjct: 233 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPP----SPPPPSPPPPSPPPPSP 288

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P P     SPPPPS   PSP      PPPPS  PSP
Sbjct: 289 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSP 324

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 46/93 (49%), Positives = 46/93 (49%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P     SPP P      PPPP   P P     SPPPP    SPPPP   P
Sbjct: 368 SPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPP----SPPPPPSPP 422

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     SPPPPS  SP P     SPPPPS  P
Sbjct: 423 PPSPPPPSPPPPSPPSPPP----PSPPPPSPPP 451

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/109 (44%), Positives = 51/109 (46%), Gaps = 2/109 (1%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPP--PPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           SPPPP   PSP      PP P     PPP  PP   P P     SPPPP      PPP  
Sbjct: 430 SPPPPS-PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 488

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLPLY 350
            P P     SPPPPS   PSP     SPPPPS  PSP   +  S  P++
Sbjct: 489 PPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPSPPPSHPPSHPPMH 535

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/95 (48%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPP--PPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           SPPPP   PSP      PP P     PPP  PP   P P     SPPPP    SPPPP  
Sbjct: 258 SPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSP 313

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P P     SPPPPS   PSP     SPPPPS  P
Sbjct: 314 PPPPPSPPPSPPPPSPPPPSPPP--PSPPPPSPPP 346

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 47/102 (46%), Positives = 47/102 (46%), Gaps = 2/102 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP--PPPCYSPSPKVVYKSPPPPYVYN 182
           SP      PPPP   PSP      PP P     PP  PPP   P P     SPPPP    
Sbjct: 307 SPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---- 362

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           SPPPP   P P     SPPPPS   PSP     SPPPPS  P
Sbjct: 363 SPPPPSPPPPPPSPPPSPPPPSPPPPSPPP--PSPPPPSPPP 402

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 48/102 (47%), Positives = 48/102 (47%), Gaps = 2/102 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP--PPCYSPSPKVVYKSPPPPYVYN 182
           SP     SPPP    PSP      PP P     PPP  PP   P P     SPPPP    
Sbjct: 312 SPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---- 367

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           SPPPP  SP P     SPPPPS   PSP     SPPPPS  P
Sbjct: 368 SPPPPPPSPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 407

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 45/95 (47%), Positives = 45/95 (47%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP  SP P     SPPPP    SPPPP   P
Sbjct: 343 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPP----SPPPPS-PP 396

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPPS   PSP      PPP    PSP
Sbjct: 397 PPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSP 431

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 46/95 (48%), Positives = 46/95 (48%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P     PPPP    PSP      PPPP    SPPPP   P
Sbjct: 333 SPPPPS-PPPPSPPPPSPPPPS----PPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS-PP 386

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPPS   PSP     SPPPPS  P P
Sbjct: 387 PPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPP 419

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/95 (46%), Positives = 44/95 (46%), Gaps = 2/95 (2%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPP--PPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           SPPPP   PSP      PP P     PPP  PP   P P     SPPPP      PPP  
Sbjct: 154 SPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 213

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P P     SPPPPS   PSP     SPPPPS  P
Sbjct: 214 PPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 246

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 43/95 (45%), Positives = 43/95 (45%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP   P P     SPPPP      PPP   P
Sbjct: 178 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPP 235

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPPS   PSP      PPPP  SP P
Sbjct: 236 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPP 270

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 43/93 (46%), Positives = 43/93 (46%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P     PPP P   P P     SPPPP      PPP   P
Sbjct: 409 SPPPPSPPPPPSPPPPSPPPPSP---PPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 465

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     SPPPPS   PSP     SPPPPS  P
Sbjct: 466 PPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 496

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 49/105 (46%), Positives = 49/105 (46%), Gaps = 5/105 (4%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYS---PSPKVYYKSPPHPHVCVCPP--PPPCYSPSPKVVYKSPPPPY 173
           SP      PPPP  S   PSP      PP P     PP  PPP   P P     SPPPP 
Sbjct: 253 SPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP- 311

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
              SPPPP  SP P     SPPPPS   PSP     SPPPPS  P
Sbjct: 312 ---SPPPPPPSPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 351

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 43/93 (46%), Positives = 43/93 (46%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P       P P     PPPPP   P P     SPPPP      PPP   P
Sbjct: 133 SPPPP--SPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 190

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     SPPPPS   PSP     SPPPPS  P
Sbjct: 191 PPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 221

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 46/96 (47%), Positives = 46/96 (47%), Gaps = 3/96 (3%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPS---PKVVYKSPPPPYVYNSPPPPY 200
           SPPPP   P P     SPP P     PPPP    PS   P     SPPPP    SPPPP 
Sbjct: 363 SPPPPSPPPPPPSPPPSPPPPS----PPPPSPPPPSPPPPSPPPPSPPPP----SPPPPS 414

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
             P P     SPPPPS   PSP     SPPPPS  P
Sbjct: 415 PPPPPSPPPPSPPPPSPPPPSP----PSPPPPSPPP 446

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/95 (46%), Positives = 44/95 (46%), Gaps = 2/95 (2%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPP--PPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           SPPP    PSP      PP P     PPP  PP  SP P     SPPPP      PPP  
Sbjct: 119 SPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPS 178

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P P     SPPPPS   PSP     SPPPPS  P
Sbjct: 179 PPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 211

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 43/93 (46%), Positives = 43/93 (46%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P      PP P     P PPP   P P     SPPPP      PPP   P
Sbjct: 143 SPPPP--SPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 200

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     SPPPPS   PSP     SPPPPS  P
Sbjct: 201 PPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 231

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/93 (47%), Positives = 45/93 (48%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP   P P     SPPPP   + PPP    P
Sbjct: 389 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPP 447

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           SP     SPPPPS   PSP     SPPPPS  P
Sbjct: 448 SPPP--PSPPPPSPPPPSPPP--PSPPPPSPPP 476

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 44/95 (46%), Positives = 44/95 (46%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP   P P     SPPPP      PPP   P
Sbjct: 173 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPP 230

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPPS   PSP     SPPPPS  P P
Sbjct: 231 PPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPP 263

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 46/93 (49%), Positives = 46/93 (49%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP   P P     SPPPP    SPPPP   P
Sbjct: 384 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPP----SPPPP-SPP 437

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           SP     SPPPPS   PSP     SPPPPS  P
Sbjct: 438 SPPP--PSPPPPSPPPPSPPP--PSPPPPSPPP 466

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/93 (47%), Positives = 44/93 (47%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P     SPP P      PPPP   P P     SPPPP      PPP   P
Sbjct: 148 SPPPPP-SPPPPPPPPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPP 205

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     SPPPPS   PSP     SPPPPS  P
Sbjct: 206 PPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 236

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/93 (49%), Positives = 46/93 (49%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP   P P     SPPPP    SPPPP  SP
Sbjct: 208 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPP----SPPPP--SP 259

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     SPPPPS   PSP     SPPPPS  P
Sbjct: 260 PPPPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 290

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/93 (49%), Positives = 46/93 (49%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP   P P     SPPPP    SPPPP   P
Sbjct: 213 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPP----SPPPPPPPP 266

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           SP     SPPPPS   PSP     SPPPPS  P
Sbjct: 267 SPPP--PSPPPPSPPPPSPPP--PSPPPPSPPP 295

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 44/95 (46%), Positives = 44/95 (46%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y  P  P  SP P     SPP P     PPPP    PSP     SPPPP     PPPP  
Sbjct: 110 YIPPTTPPPSPPPSQPPPSPPPPS----PPPPSPPPPSPPP--PSPPPPPSPPPPPPPPS 163

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P P     SPPPPS   PSP     SPPPPS  P
Sbjct: 164 PPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 196

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 43/93 (46%), Positives = 43/93 (46%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P     P PPP   P P     SPPPP      PPP   P
Sbjct: 399 SPPPPS-PPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSP--PSPPPPSPPPPSPPPPSPP 455

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     SPPPPS   PSP     SPPPPS  P
Sbjct: 456 PPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 486

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 46/96 (47%), Positives = 46/96 (47%), Gaps = 3/96 (3%)
 Frame = +3

Query: 30  SPPPPYYSP-SPKVYYKSPPHPHVCVCPPP--PPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           SPPPP   P SP      PP P     PPP  PP   P P     SPPPP    SPPPP 
Sbjct: 198 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP- 252

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            SP P      PPPPS   PSP     SPPPPS  P
Sbjct: 253 -SPPPPSPPPPPPPPSPPPPSPPP--PSPPPPSPPP 285

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/70 (48%), Positives = 34/70 (48%)
 Frame = +3

Query: 99  CVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEY 278
           C  PP  P  SP P     SPPPP    SPPPP   P P     SPPPP   SP P    
Sbjct: 109 CYIPPTTPPPSPPPSQPPPSPPPP----SPPPP-SPPPPSPPPPSPPPPP--SPPPPPPP 161

Query: 279 KSPPPPSYSP 308
            SPPPPS  P
Sbjct: 162 PSPPPPSPPP 171

[187][TOP]
>UniRef100_Q94ES2 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES2_PEA
          Length = 88

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 42/85 (49%), Positives = 46/85 (54%), Gaps = 14/85 (16%)
 Frame = +3

Query: 84  PH--PHVCVCPPPPPCYS-PSPKVVYKSPPPP-------YVYNSPPPP----YYSPSPKV 221
           PH  P+    PPPPP ++ P P  VY SPPPP       Y Y SPPPP    Y    P  
Sbjct: 1   PHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTP 60

Query: 222 YYKSPPPPSYYSPSPKVEYKSPPPP 296
            Y SPPPP+Y  P P   YKSPPPP
Sbjct: 61  VYHSPPPPAYSPPPPAYYYKSPPPP 85

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/90 (44%), Positives = 48/90 (53%), Gaps = 9/90 (10%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS-PSPKVYYKSPP-------HPHVCVCPPPPPCYSPSPKVVYKSPPP 167
           P  Y   PPPP ++ P P   Y SPP        P+    PPPPP ++  P V      P
Sbjct: 5   PYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHV------P 58

Query: 168 PYVYNSPPPPYYSPSPKV-YYKSPPPPSYY 254
             VY+SPPPP YSP P   YYKSPPPP ++
Sbjct: 59  TPVYHSPPPPAYSPPPPAYYYKSPPPPYHH 88

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/80 (47%), Positives = 43/80 (53%), Gaps = 13/80 (16%)
 Frame = +3

Query: 150 YKSPPPP---------YVYNSPPPPYYSPSPKVY-YKSPPPPSYYSPSPKVE---YKSPP 290
           Y SPPPP          VY+SPPPP  +P  K Y Y SPPPP  ++  P V    Y SPP
Sbjct: 8   YPSPPPPPVHTYPHPHPVYHSPPPP-PTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPP 66

Query: 291 PPSYSPSPKTEY*ISRLPLY 350
           PP+YSP P   Y  S  P Y
Sbjct: 67  PPAYSPPPPAYYYKSPPPPY 86

[188][TOP]
>UniRef100_B9G524 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9G524_ORYSJ
          Length = 536

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 48/113 (42%), Positives = 54/113 (47%), Gaps = 16/113 (14%)
 Frame = +3

Query: 24  YKSPP-----PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           Y SPP     PP Y PSP  Y  SPP        P PP Y+P P  ++ SPP      SP
Sbjct: 329 YPSPPDIVPSPPSYEPSPPSYEPSPPE-----YAPEPPVYAPYPPGIFPSPPE----YSP 379

Query: 189 PPPYYSPSPKVYYKSPPPPSY------YSPSPKVEYKSPP-----PPSYSPSP 314
            PP Y PSP  Y  +P PPSY      Y+P P V    PP     PP Y+P P
Sbjct: 380 EPPSYVPSPPQY--APQPPSYVPSPPEYAPEPPVYAPYPPGITPSPPEYAPEP 430

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/108 (42%), Positives = 54/108 (50%), Gaps = 10/108 (9%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYK---SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           Y+ S   PYYS      Y    SPP+P     PPPPP  SPS  +    P P + Y+SPP
Sbjct: 43  YHSSSSDPYYSTPILPPYGDAFSPPNP-----PPPPPPMSPSCLLPPIIPAPTFTYSSPP 97

Query: 192 PP--YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP-----PPSYSPSP 314
           PP  YY P P +   SP PP   +P P V Y SPP     PP  +P P
Sbjct: 98  PPPLYYPPPPDI---SPSPPPSVTPLPPVVYPSPPEVTPSPPEIAPYP 142

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 43/107 (40%), Positives = 51/107 (47%), Gaps = 5/107 (4%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP      P PP  +PSP      P  P +    P PP Y PSP   Y+  PP Y   +P
Sbjct: 306 SPPKITPYPSPPEVTPSPPEITPYPSPPDIV---PSPPSYEPSPPS-YEPSPPEY---AP 358

Query: 189 PPPYYSPSPKVYYKSPP-----PPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP Y+P P   + SPP     PPSY    P+    +P PPSY PSP
Sbjct: 359 EPPVYAPYPPGIFPSPPEYSPEPPSYVPSPPQY---APQPPSYVPSP 402

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 47/103 (45%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +3

Query: 9   SPKVYYKSPP-----PPYYSPSPKVYYKSPP--HPHVCVCPPPPPCYSPSPKVVYKSPPP 167
           SP  Y  SPP     PP Y+P P VY   PP   P      P PP Y PSP   Y   PP
Sbjct: 338 SPPSYEPSPPSYEPSPPEYAPEPPVYAPYPPGIFPSPPEYSPEPPSYVPSPPQ-YAPQPP 396

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            YV   P PP Y+P P VY  +P PP   +PSP  EY   PPP
Sbjct: 397 SYV---PSPPEYAPEPPVY--APYPPG-ITPSPP-EYAPEPPP 432

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 51/131 (38%), Positives = 57/131 (43%), Gaps = 29/131 (22%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPK--VYYKSPPH-----PHVCVCPPPPPCYSPSPKVV-YKSPP 164
           SP      P PP  +P P     Y SPP      P +   P PP      PK+  Y SPP
Sbjct: 258 SPPEITPYPSPPEVTPGPPEITPYPSPPEITPSPPEITPYPSPPEVVPSPPKITPYPSPP 317

Query: 165 -----PPYV--YNSPP-----PPYYSPSPKVYYKSP----PPPSYYSPSPKVEYKSPP-- 290
                PP +  Y SPP     PP Y PSP  Y  SP    P P  Y+P P   + SPP  
Sbjct: 318 EVTPSPPEITPYPSPPDIVPSPPSYEPSPPSYEPSPPEYAPEPPVYAPYPPGIFPSPPEY 377

Query: 291 ---PPSYSPSP 314
              PPSY PSP
Sbjct: 378 SPEPPSYVPSP 388

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 44/107 (41%), Positives = 50/107 (46%), Gaps = 5/107 (4%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP      P PP   PSP  Y  SPP        P PP Y+P P V   +P PP ++  P
Sbjct: 322 SPPEITPYPSPPDIVPSPPSYEPSPPSYE-----PSPPEYAPEPPVY--APYPPGIF--P 372

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPP-----PPSYSPSP 314
            PP YSP P  Y  SPP    Y+P P     SPP     PP Y+P P
Sbjct: 373 SPPEYSPEPPSYVPSPPQ---YAPQPPSYVPSPPEYAPEPPVYAPYP 416

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/119 (36%), Positives = 52/119 (43%), Gaps = 17/119 (14%)
 Frame = +3

Query: 9   SPKVYYKSPPPP--YYSPSPKVYYKSPPH--PHVCVCPPPPPCYSPSPKVVYKSPPPPYV 176
           +P   Y SPPPP  YY P P +    PP   P   V  P PP  +PSP  +   P PP +
Sbjct: 88  APTFTYSSPPPPPLYYPPPPDISPSPPPSVTPLPPVVYPSPPEVTPSPPEIAPYPSPPEI 147

Query: 177 YNSPP-------PPYYSPSPKVYYKSPPPPSYYSPSPKVE-YKSPP-----PPSYSPSP 314
             SPP       PP   PSP      P PP      P++  Y SPP     PP  +P P
Sbjct: 148 VPSPPEITPYPSPPEIVPSPPEITPYPSPPEVVPGPPEINPYPSPPEIVPSPPEITPYP 206

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 41/112 (36%), Positives = 49/112 (43%), Gaps = 17/112 (15%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPH----PHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP-- 191
           +P PP  +P P + Y SPP     P      P PP  +P P  +   P PP +  SPP  
Sbjct: 235 APSPPIVTPMPPIIYPSPPEVTPSPPEITPYPSPPEVTPGPPEITPYPSPPEITPSPPEI 294

Query: 192 -----PPYYSPSPKVYYKSPPPPSYYSPSPKV-EYKSPP-----PPSYSPSP 314
                PP   PSP      P PP      P++  Y SPP     PPSY PSP
Sbjct: 295 TPYPSPPEVVPSPPKITPYPSPPEVTPSPPEITPYPSPPDIVPSPPSYEPSP 346

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 43/112 (38%), Positives = 47/112 (41%), Gaps = 11/112 (9%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPH----PHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           P + Y SPP    SP     Y SPP     P      P PP  +PSP  +   P PP V 
Sbjct: 245 PPIIYPSPPEVTPSPPEITPYPSPPEVTPGPPEITPYPSPPEITPSPPEITPYPSPPEVV 304

Query: 180 NSPP-------PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SPP       PP  +PSP      P PP      P  E   P PPSY PSP
Sbjct: 305 PSPPKITPYPSPPEVTPSPPEITPYPSPPDIVPSPPSYE---PSPPSYEPSP 353

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 41/100 (41%), Positives = 44/100 (44%), Gaps = 6/100 (6%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP------PYVYNSPPP 194
           PPPP  SPS  +    P        PPPPP Y P P  +  SPPP      P VY  P P
Sbjct: 71  PPPPPMSPSCLLPPIIPAPTFTYSSPPPPPLYYPPPPDISPSPPPSVTPLPPVVY--PSP 128

Query: 195 PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P  +PSP      P PP    PSP      P PP   PSP
Sbjct: 129 PEVTPSPPEIAPYPSPPEIV-PSPPEITPYPSPPEIVPSP 167

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/119 (36%), Positives = 48/119 (40%), Gaps = 18/119 (15%)
 Frame = +3

Query: 12  PKVYYKSPP------PPYYSPSPKVYYKSPPH-----PHVCVCPPPPPCYSPSPKVVYKS 158
           P +YY  PP      PP  +P P V Y SPP      P +   P PP    PSP  +   
Sbjct: 99  PPLYYPPPPDISPSPPPSVTPLPPVVYPSPPEVTPSPPEIAPYPSPPEIV-PSPPEITPY 157

Query: 159 PPPPYVYNSPP-------PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P PP +  SPP       PP   P P      P PP    PSP      P PP   PSP
Sbjct: 158 PSPPEIVPSPPEITPYPSPPEVVPGPPEINPYPSPPEIV-PSPPEITPYPSPPEIVPSP 215

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 45/128 (35%), Positives = 55/128 (42%), Gaps = 18/128 (14%)
 Frame = +3

Query: 24  YKSPP-----PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVV--YKSPP-----P 167
           Y SPP     PP  +PSP +    PP     +  P PP  +PSP  +  Y SPP     P
Sbjct: 221 YPSPPEIVPSPPEIAPSPPIVTPMPP-----IIYPSPPEVTPSPPEITPYPSPPEVTPGP 275

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKV-EYKSPP-----PPSYSPSPKTEY* 329
           P +   P PP  +PSP      P PP      PK+  Y SPP     PP  +P P     
Sbjct: 276 PEITPYPSPPEITPSPPEITPYPSPPEVVPSPPKITPYPSPPEVTPSPPEITPYPSPPDI 335

Query: 330 ISRLPLYE 353
           +   P YE
Sbjct: 336 VPSPPSYE 343

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 42/119 (35%), Positives = 47/119 (39%), Gaps = 13/119 (10%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYSPSPKVVYKSPPPP 170
           SP      P PP   PSP      P  P V   PP       PP   PSP  +   P PP
Sbjct: 150 SPPEITPYPSPPEIVPSPPEITPYPSPPEVVPGPPEINPYPSPPEIVPSPPEITPYPSPP 209

Query: 171 YVYNSPP-------PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            +  SPP       PP   PSP     SPP     +P P + Y SPP  + SP   T Y
Sbjct: 210 EIVPSPPEITPYPSPPEIVPSPPEIAPSPP---IVTPMPPIIYPSPPEVTPSPPEITPY 265

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 39/121 (32%), Positives = 46/121 (38%), Gaps = 20/121 (16%)
 Frame = +3

Query: 12  PKVYYKSPP--------------PPYYSPSPKVYYKSPPHPHVCVCPPP------PPCYS 131
           P V Y SPP              PP   PSP      P  P +   PP       PP   
Sbjct: 121 PPVVYPSPPEVTPSPPEIAPYPSPPEIVPSPPEITPYPSPPEIVPSPPEITPYPSPPEVV 180

Query: 132 PSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
           P P  +   P PP +  SPP     PSP     SPP  + Y   P++    P PP  +PS
Sbjct: 181 PGPPEINPYPSPPEIVPSPPEITPYPSPPEIVPSPPEITPYPSPPEI---VPSPPEIAPS 237

Query: 312 P 314
           P
Sbjct: 238 P 238

[189][TOP]
>UniRef100_A5B4T6 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5B4T6_VITVI
          Length = 358

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 40/105 (38%), Positives = 50/105 (47%), Gaps = 13/105 (12%)
 Frame = -2

Query: 296 WWRWRFVFNLWRGRIIRWWWRRLVVNFWRR------*VVWWWWGIVDI----WWWRRLVH 147
           WW WR V     GR   W W  LV+  WRR       V WWWW +V +    WWW R+VH
Sbjct: 167 WWWWRVVLVWLLGR---WRWWGLVLVDWRRRWWRLVFVWWWWWRVVHVWLLRWWWWRVVH 223

Query: 146 NLRGWRITWRWWWTNTYM---RMWWGFVVYLRGR*VIRWWWRLVV 21
               W + W WWW    +   R WW  V+      +  WWWRL++
Sbjct: 224 ---VWLLGW-WWWGLVLVDRRRWWWRLVL------IWWWWWRLIL 258

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 31/78 (39%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = -2

Query: 245 WWWRRLVVNFWRR*VVWWWWGIVDIWWWRRLVHNLRGWRITWRWWWTNTYMRMWWGFV-V 69
           WWWR ++V    R   W WWG+V + W RR       WR+ + WWW       WW  V V
Sbjct: 168 WWWRVVLVWLLGR---WRWWGLVLVDWRRRW------WRLVFVWWW-------WWRVVHV 211

Query: 68  YLRGR*VIRWWWRLVVHL 15
           +L     +RWWW  VVH+
Sbjct: 212 WL-----LRWWWWRVVHV 224

[190][TOP]
>UniRef100_Q41400 Root nodule extensin (Fragment) n=1 Tax=Sesbania rostrata
           RepID=Q41400_SESRO
          Length = 91

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 44/89 (49%), Positives = 47/89 (52%), Gaps = 8/89 (8%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPS-PKVVYKSPPPP------ 170
           P   Y SPPPPY  P     Y SPP        PP   Y P  P  VY SPPPP      
Sbjct: 13  PHPVYHSPPPPYKKPYK---YHSPP--------PPVHTYPPHIPHPVYHSPPPPTPYKKP 61

Query: 171 YVYNSPPPPYYSPSPK-VYYKSPPPPSYY 254
           Y Y+SPPPP +SP P   YYKSPPPP Y+
Sbjct: 62  YKYHSPPPPVHSPPPPHYYYKSPPPPPYH 90

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 45/100 (45%), Positives = 49/100 (49%), Gaps = 11/100 (11%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY----------VYNS 185
           PP +  P P       PHPH     PPPP   P     Y SPPPP           VY+S
Sbjct: 1   PPVHKYPHPH------PHPHPVYHSPPPPYKKPYK---YHSPPPPVHTYPPHIPHPVYHS 51

Query: 186 PPPPYYSPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPPSY 302
           PPPP  +P  K Y Y SPPPP +  P P   YKSPPPP Y
Sbjct: 52  PPPP--TPYKKPYKYHSPPPPVHSPPPPHYYYKSPPPPPY 89

[191][TOP]
>UniRef100_Q40692 Hydroxyproline-rich glycoprotein n=1 Tax=Oryza sativa
           RepID=Q40692_ORYSA
          Length = 369

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 45/114 (39%), Positives = 54/114 (47%), Gaps = 9/114 (7%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVY----YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           + +P  Y  +P PP Y P PK      YK  P P      P PP Y P PK    +PPP 
Sbjct: 171 KPTPPPYTPTPAPPTYKPQPKPNPPPTYKPAPKPTPTPYQPAPPTYKPQPK---PNPPPT 227

Query: 171 YVYNSPP--PPYYSPSPKVYYKSPPPPSYYSPSP---KVEYKSPPPPSYSPSPK 317
           Y     P  PP Y P+PK      P P+ Y P+P   K + K  PPP+Y P PK
Sbjct: 228 YKPQPKPNPPPTYKPAPK------PTPTPYKPAPPTYKPQPKPNPPPTYKPQPK 275

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 44/108 (40%), Positives = 52/108 (48%), Gaps = 3/108 (2%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y  +P PP Y P PK      P P+     P PP Y P P    K  PPPY   
Sbjct: 131 KPTPAPYTPTPTPPMYKPQPK----PTPAPYTPT--PTPPTYKPQP----KPTPPPYT-P 179

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPK---VEYKSPPPPSYSPSPK 317
           +P PP Y P PK     P PP  Y P+PK     Y+ P PP+Y P PK
Sbjct: 180 TPAPPTYKPQPK-----PNPPPTYKPAPKPTPTPYQ-PAPPTYKPQPK 221

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 42/108 (38%), Positives = 49/108 (45%), Gaps = 3/108 (2%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV-Y 179
           + +P  Y  +P PP Y P PK      P P      P PP Y P PK    +PPP Y   
Sbjct: 151 KPTPAPYTPTPTPPTYKPQPK------PTPPPYTPTPAPPTYKPQPK---PNPPPTYKPA 201

Query: 180 NSPPPPYYSPSPKVYYKSPPP--PSYYSPSPKVEYKSPPPPSYSPSPK 317
             P P  Y P+P  Y   P P  P  Y P PK      PPP+Y P+PK
Sbjct: 202 PKPTPTPYQPAPPTYKPQPKPNPPPTYKPQPKPN----PPPTYKPAPK 245

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 42/113 (37%), Positives = 53/113 (46%), Gaps = 8/113 (7%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P  Y   P PP ++P+P  Y  +P  P      P PP Y P PK      P PY   
Sbjct: 90  KPTPPPYTPKPTPPAHTPTPPTYTPTPTPPK-----PTPPTYKPQPKPT----PAPYT-P 139

Query: 183 SPPPPYYSPSPKV----YYKSPPPPSYYSPSPKVE----YKSPPPPSYSPSPK 317
           +P PP Y P PK     Y  +P PP+Y  P PK        +P PP+Y P PK
Sbjct: 140 TPTPPMYKPQPKPTPAPYTPTPTPPTY-KPQPKPTPPPYTPTPAPPTYKPQPK 191

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/114 (38%), Positives = 50/114 (43%), Gaps = 11/114 (9%)
 Frame = +3

Query: 9   SPKVYYKSP---PPPYYSPSPKVY----YKSPPHPHVCVCPPPPPCYSPSPKV----VYK 155
           +P  Y   P   PPP Y P PK      YK  P P      P PP Y P PK      YK
Sbjct: 212 APPTYKPQPKPNPPPTYKPQPKPNPPPTYKPAPKPTPTPYKPAPPTYKPQPKPNPPPTYK 271

Query: 156 SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
             P P      P PY  P+ K   K  P P+ Y+P+PK      PPP+Y P PK
Sbjct: 272 PQPKP-----TPTPYTPPTYKPQPKPTPTPTPYTPTPKPN----PPPTYKPQPK 316

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/103 (36%), Positives = 47/103 (45%), Gaps = 7/103 (6%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           +P PP Y+P+PK      P P      P PP ++P+P     +P PP     P PP Y P
Sbjct: 79  TPTPPTYTPTPK------PTPPPYTPKPTPPAHTPTPPTYTPTPTPP----KPTPPTYKP 128

Query: 210 SPK---VYYKSPPPPSYYSPSPKVE----YKSPPPPSYSPSPK 317
            PK     Y   P P  Y P PK        +P PP+Y P PK
Sbjct: 129 QPKPTPAPYTPTPTPPMYKPQPKPTPAPYTPTPTPPTYKPQPK 171

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/133 (35%), Positives = 55/133 (41%), Gaps = 28/133 (21%)
 Frame = +3

Query: 12  PKVYYKSP---PPPYYSPSPKV----YYKSPPHPHVCVCPPPPPCYSPSPKVV------- 149
           P  Y   P   PPP Y P+PK     Y  +PP       P PPP Y P PK         
Sbjct: 225 PPTYKPQPKPNPPPTYKPAPKPTPTPYKPAPPTYKPQPKPNPPPTYKPQPKPTPTPYTPP 284

Query: 150 -YKSPPPPYVYNSP--------PPPYYSPSPK-----VYYKSPPPPSYYSPSPKVEYKSP 287
            YK  P P    +P        PPP Y P PK       YK  P P   +PSP     +P
Sbjct: 285 TYKPQPKPTPTPTPYTPTPKPNPPPTYKPQPKPTPTPTPYKPQPKP---TPSPYTPKPTP 341

Query: 288 PPPSYSPSPKTEY 326
            PP+Y+P+P   Y
Sbjct: 342 TPPTYTPTPTPPY 354

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 39/109 (35%), Positives = 50/109 (45%), Gaps = 15/109 (13%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYK-------SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP 194
           PP ++ P P+   K       +PP P      P PP Y+P+PK      PPPY    P P
Sbjct: 53  PPHHHEPKPEKPPKEHKPPAYTPPKP-----TPTPPTYTPTPKPT----PPPYT-PKPTP 102

Query: 195 PYYSPSPKVYYKSPPPPS----YYSPSPKVE----YKSPPPPSYSPSPK 317
           P ++P+P  Y  +P PP      Y P PK        +P PP Y P PK
Sbjct: 103 PAHTPTPPTYTPTPTPPKPTPPTYKPQPKPTPAPYTPTPTPPMYKPQPK 151

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 42/116 (36%), Positives = 51/116 (43%), Gaps = 8/116 (6%)
 Frame = +3

Query: 3   RASPKVYYKSPP--------PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 158
           + +P   YK  P        PP Y P PK      P+      P PPP Y P P    K 
Sbjct: 263 KPNPPPTYKPQPKPTPTPYTPPTYKPQPKPTPTPTPYTPT-PKPNPPPTYKPQP----KP 317

Query: 159 PPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
            P P  Y   P P  +PSP     +P PP+ Y+P+P   Y   PPPSY+P P   Y
Sbjct: 318 TPTPTPYKPQPKP--TPSPYTPKPTPTPPT-YTPTPTPPYHK-PPPSYTPGPPPPY 369

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/104 (34%), Positives = 46/104 (44%), Gaps = 5/104 (4%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKS--PPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN---S 185
           Y  +P P   +P P+   K   PPH H      PP  + P      K  P P  Y     
Sbjct: 31  YTPTPTPVKPAPKPEKPPKEHKPPHHHEPKPEKPPKEHKPPAYTPPKPTPTPPTYTPTPK 90

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           P PP Y+P P     +P PP+ Y+P+P      P PP+Y P PK
Sbjct: 91  PTPPPYTPKPTPPAHTPTPPT-YTPTPTP--PKPTPPTYKPQPK 131

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 42/125 (33%), Positives = 48/125 (38%), Gaps = 28/125 (22%)
 Frame = +3

Query: 3   RASPKVYYKSP---PPPYYSPSPKVY--------YKSPPHPHVCVCP-------PPPPCY 128
           + +P  Y   P   PPP Y P PK          YK  P P     P        PPP Y
Sbjct: 252 KPAPPTYKPQPKPNPPPTYKPQPKPTPTPYTPPTYKPQPKPTPTPTPYTPTPKPNPPPTY 311

Query: 129 SPSPKVVY---------KSPPPPYVYN-SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEY 278
            P PK            K  P PY    +P PP Y+P+P   Y  PPP   Y+P P    
Sbjct: 312 KPQPKPTPTPTPYKPQPKPTPSPYTPKPTPTPPTYTPTPTPPYHKPPPS--YTPGP---- 365

Query: 279 KSPPP 293
             PPP
Sbjct: 366 --PPP 368

[192][TOP]
>UniRef100_Q1PE26 Leucine-rich repeat family protein/extensin family protein n=1
           Tax=Arabidopsis thaliana RepID=Q1PE26_ARATH
          Length = 218

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 47/113 (41%), Positives = 57/113 (50%), Gaps = 21/113 (18%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP---PPYVYNSPP--- 191
           SPPPP +SP P     SPP P V   PPPPP YSP P  V+  PP   PP VY+ PP   
Sbjct: 107 SPPPPVHSPPPPAPVHSPP-PPVHSPPPPPPVYSPPPP-VFSPPPSQSPPVVYSPPPRPP 164

Query: 192 ----PPYYSPSPKVYYKSPPPPSYYSPSPK-----------VEYKSPPPPSYS 305
               PP  SP P    K   PP+ ++P+P             +Y SPPPP ++
Sbjct: 165 KINSPPVQSPPPAPVEKKETPPA-HAPAPSDDEFIIPPFIGHQYASPPPPMFA 216

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 43/104 (41%), Positives = 52/104 (50%), Gaps = 10/104 (9%)
 Frame = +3

Query: 42  PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP---- 209
           P +SP P V+   PP P   V  PPPP +SP        PPPP VY SPPPP +SP    
Sbjct: 104 PVHSPPPPVHSPPPPAP---VHSPPPPVHSP--------PPPPPVY-SPPPPVFSPPPSQ 151

Query: 210 SPKVYYKSPP------PPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           SP V Y  PP       P   SP P    K   PP+++P+P  +
Sbjct: 152 SPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAPAPSDD 195

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 39/89 (43%), Positives = 45/89 (50%), Gaps = 5/89 (5%)
 Frame = +3

Query: 63  KVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPP- 239
           K  +  P H       PPPP +SP P     SPPPP     PPPP YSP P V+  SPP 
Sbjct: 98  KAIFSDPVHS------PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVF--SPPP 149

Query: 240 ---PPSYYSPSPK-VEYKSPPPPSYSPSP 314
              PP  YSP P+  +  SPP  S  P+P
Sbjct: 150 SQSPPVVYSPPPRPPKINSPPVQSPPPAP 178

[193][TOP]
>UniRef100_B4QQM0 GD13257 n=1 Tax=Drosophila simulans RepID=B4QQM0_DROSI
          Length = 400

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/128 (39%), Positives = 58/128 (45%), Gaps = 14/128 (10%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-----Y 173
           S K    +PPP      PKV Y  PP   V + PPP     P+ KVVY  PPPP      
Sbjct: 123 SVKFEVSAPPP------PKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVV 176

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPP-------SYYSPSPKVEYKSPPPP--SYSPSPKTEY 326
           VY  PPPP   P  KV Y  PP          Y  PS K E  +PPPP   Y P P  + 
Sbjct: 177 VYTPPPPP---PPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPPPKVEYLPPPTKKV 233

Query: 327 *ISRLPLY 350
            I+  P+Y
Sbjct: 234 IIAPPPVY 241

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 47/115 (40%), Positives = 51/115 (44%), Gaps = 14/115 (12%)
 Frame = +3

Query: 12  PKVYYKSPP--------PPYYSPSP--KVYYKSPPHP---HVCVCPPPPPCYSPSPKVVY 152
           PKV Y  PP        PP Y P P  KV Y  PP P    V V  PPPP   P PK V 
Sbjct: 134 PKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVVVYTPPPP---PPPKKVV 190

Query: 153 KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSY-YSPSPKVEYKSPPPPSYSPSP 314
            +PPP  +       Y  PS K    +PPPP   Y P P  +    PPP Y P P
Sbjct: 191 YTPPPTGILKDDGYHYGQPSVKFEVSAPPPPKVEYLPPPTKKVIIAPPPVYVPPP 245

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 58/163 (35%), Positives = 61/163 (37%), Gaps = 58/163 (35%)
 Frame = +3

Query: 12  PKVYYKSPP--------PPYYSPSP--KVYYKSPPHP---HVCVCPPPPPCYSPSPKVVY 152
           PKV Y  PP        PP Y P P  KV Y  PP P    V V  PPPP   P PK V 
Sbjct: 221 PKVEYLPPPTKKVIIAPPPVYVPPPTKKVVYTPPPPPPTKKVVVYTPPPP---PPPKKVV 277

Query: 153 KSPP-------------------------PPYVYNSPP---------PPYYSPSPK---- 218
            +PP                         PP V   PP         PP Y P P     
Sbjct: 278 YTPPPTGILKDDGYHYGQPSVKFEVSAPAPPKVEYLPPPPTKKVYVAPPVYVPPPTKKVV 337

Query: 219 VYYKSPPPPSYYSPSPK---VEYKSPPPPSYSP----SPKTEY 326
           VY   PPPP  Y P P    V Y  PPPP  +     +PK EY
Sbjct: 338 VYTPPPPPPPVYIPPPTKKVVVYTPPPPPPPTKKVYVTPKVEY 380

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 47/123 (38%), Positives = 51/123 (41%), Gaps = 25/123 (20%)
 Frame = +3

Query: 12  PKVYYKSPPPP---------YYSPSPKVYYKSPPHPHVCVCPPPP--------PCYSPSP 140
           PK    +PPP          Y  PS K    +P  P V   PPPP        P Y P P
Sbjct: 273 PKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPAPPKVEYLPPPPTKKVYVAPPVYVPPP 332

Query: 141 --KVVYKSPPPPYVYNSPPPPYYSPSPK---VYYKSPPPP---SYYSPSPKVEYKSPPPP 296
             KVV  +PPP      PPPP Y P P    V Y  PPPP        +PKVEY  P   
Sbjct: 333 TKKVVVYTPPP------PPPPVYIPPPTKKVVVYTPPPPPPPTKKVYVTPKVEYLPPVQK 386

Query: 297 SYS 305
            YS
Sbjct: 387 GYS 389

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 46/143 (32%), Positives = 54/143 (37%), Gaps = 30/143 (20%)
 Frame = +3

Query: 12  PKVYYKSPPPP---------YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPP 164
           PK    +PPP          Y  PS K    +PP P V   PPP      +P  VY  PP
Sbjct: 186 PKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPPPKVEYLPPPTKKVIIAPPPVYVPPP 245

Query: 165 PPYVYNSPPPPYYSPSPKVYYKSPPPP-------------------SYYSPSPKVEYKSP 287
              V  +PPPP  +    VY   PPPP                    Y  PS K E  +P
Sbjct: 246 TKKVVYTPPPPPPTKKVVVYTPPPPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAP 305

Query: 288 PPP--SYSPSPKTEY*ISRLPLY 350
            PP   Y P P T+      P+Y
Sbjct: 306 APPKVEYLPPPPTKKVYVAPPVY 328

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 41/100 (41%), Positives = 46/100 (46%), Gaps = 18/100 (18%)
 Frame = +3

Query: 6   ASPKVYYKSPP--------PPYYSPSP--KVYYKSPPHPHVCVCPPPPPCYSPSPK---V 146
           A PKV Y  PP        PP Y P P  KV   +PP       PPPPP Y P P    V
Sbjct: 306 APPKVEYLPPPPTKKVYVAPPVYVPPPTKKVVVYTPP-------PPPPPVYIPPPTKKVV 358

Query: 147 VYKSPPPP----YVYNSPPPPYYSPSPKVY-YKSPPPPSY 251
           VY  PPPP     VY +P   Y  P  K Y Y + P P++
Sbjct: 359 VYTPPPPPPPTKKVYVTPKVEYLPPVQKGYSYPNDPQPAF 398

[194][TOP]
>UniRef100_UPI0000223553 Hypothetical protein CBG15933 n=1 Tax=Caenorhabditis briggsae AF16
           RepID=UPI0000223553
          Length = 568

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/107 (43%), Positives = 59/107 (55%), Gaps = 5/107 (4%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP---- 170
           R SP+V   +PPPP   PSP+V+  +PP P      P P    PSP+V   +PPPP    
Sbjct: 212 RPSPRVPRLNPPPP--RPSPRVHRLNPPPPR-----PSPQVPRPSPRVPRLNPPPPRPSP 264

Query: 171 -YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
                +PPPP   PSP+V   +PPPP    PSP+V   +PPPP  SP
Sbjct: 265 RVPRLNPPPP--RPSPRVPRLNPPPP---RPSPRVPRLNPPPPRPSP 306

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 52/124 (41%), Positives = 66/124 (53%), Gaps = 19/124 (15%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSP-----SPKVYYKSPP----HPHVCVCPPPPPCYSPSPKVVYK 155
           R SP+V+  +PPPP  SP     SP+V   +PP     P V    PPPP   PSP+V   
Sbjct: 226 RPSPRVHRLNPPPPRPSPQVPRPSPRVPRLNPPPPRPSPRVPRLNPPPP--RPSPRVPRL 283

Query: 156 SPPPPYVYN-----SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP-----PPPSYS 305
           +PPPP         +PPPP   PSP+V+  +PPPP    PSP+V   SP      PP + 
Sbjct: 284 NPPPPRPSPRVPRLNPPPPR--PSPRVHRLNPPPP---RPSPQVPRPSPRVPRLNPPPHR 338

Query: 306 PSPK 317
           PSP+
Sbjct: 339 PSPR 342

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 47/107 (43%), Positives = 59/107 (55%), Gaps = 5/107 (4%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP----P 170
           R SP+V   +PPPP   PSP+V+  +PP P      P P    PSP+V   +PPP    P
Sbjct: 289 RPSPRVPRLNPPPP--RPSPRVHRLNPPPPR-----PSPQVPRPSPRVPRLNPPPHRPSP 341

Query: 171 YVYN-SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            V   +PPPP   PS +V   +PPPP    PSP+V   +PPPP  SP
Sbjct: 342 RVLRLNPPPP--RPSQRVPQLNPPPP---RPSPRVPRLNPPPPRPSP 383

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 51/121 (42%), Positives = 60/121 (49%), Gaps = 19/121 (15%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSP----PHPHVCVCPPPPPCYS-----PSPKVVYK 155
           R SP V+  +PPPP   PSP+V   +P    P P V    PPPP  S     PSP+V   
Sbjct: 408 RPSPPVHRLNPPPP--RPSPRVPRLNPPPPRPSPQVPRLNPPPPRPSRRVPRPSPRVPRL 465

Query: 156 SPPPPYV------YNSPP----PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
           +PPPP         N PP    PP   PSP+    +PPPP    PSP V   +PPPP  S
Sbjct: 466 NPPPPRPSPRVPRLNPPPHRPSPPVPRPSPREQRLNPPPP---RPSPPVHRLNPPPPRPS 522

Query: 306 P 308
           P
Sbjct: 523 P 523

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/116 (41%), Positives = 59/116 (50%), Gaps = 14/116 (12%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSP----PHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           R SP+V   +PPPP   PSP+V   +P    P P V    PPPP   PSP+V   +PPPP
Sbjct: 261 RPSPRVPRLNPPPP--RPSPRVPRLNPPPPRPSPRVPRLNPPPP--RPSPRVHRLNPPPP 316

Query: 171 YVYNSPP----------PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
                 P          PP + PSP+V   +PPPP    PS +V   +PPPP  SP
Sbjct: 317 RPSPQVPRPSPRVPRLNPPPHRPSPRVLRLNPPPP---RPSQRVPQLNPPPPRPSP 369

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 50/123 (40%), Positives = 62/123 (50%), Gaps = 21/123 (17%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPH----VCVCPPPPPCYSPSPKVVYKSPPPP 170
           R SP+V   +PPP  + PSP+V   +PP P     V    PPPP   PSP+V   +PPPP
Sbjct: 324 RPSPRVPRLNPPP--HRPSPRVLRLNPPPPRPSQRVPQLNPPPP--RPSPRVPRLNPPPP 379

Query: 171 YVYN------------SPPPPYYS-----PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
                           +PPPP  S     PSP V+  +PPPP    PSP+V   +PPPP 
Sbjct: 380 RPSPQVPRPNQRAPRLNPPPPRPSPQVPRPSPPVHRLNPPPP---RPSPRVPRLNPPPPR 436

Query: 300 YSP 308
            SP
Sbjct: 437 PSP 439

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 47/114 (41%), Positives = 61/114 (53%), Gaps = 12/114 (10%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           R SP+V+  +PPPP   PSP+V   SP  P +      PP + PSP+V+  +PPPP    
Sbjct: 303 RPSPRVHRLNPPPP--RPSPQVPRPSPRVPRL-----NPPPHRPSPRVLRLNPPPPRPSQ 355

Query: 183 -----SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYK-------SPPPPSYSP 308
                +PPPP   PSP+V   +PPPP    PSP+V          +PPPP  SP
Sbjct: 356 RVPQLNPPPP--RPSPRVPRLNPPPP---RPSPQVPRPNQRAPRLNPPPPRPSP 404

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 49/116 (42%), Positives = 62/116 (53%), Gaps = 14/116 (12%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCV----CPPPPPCYSPSPKVVYKSPPP- 167
           R SP+V   +PP P   PS +V   +PP P   +      PPPP   PSP+V   +PPP 
Sbjct: 170 RLSPRVPRLNPPLP--RPSQRVPRLNPPPPRPSLRVPRLNPPPP--RPSPRVPRLNPPPP 225

Query: 168 ---PYVYN-SPPPPYYS-----PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
              P V+  +PPPP  S     PSP+V   +PPPP    PSP+V   +PPPP  SP
Sbjct: 226 RPSPRVHRLNPPPPRPSPQVPRPSPRVPRLNPPPP---RPSPRVPRLNPPPPRPSP 278

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 48/110 (43%), Positives = 60/110 (54%), Gaps = 5/110 (4%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           R SP+V   +PPPP   PSP+V   +   P +    PPPP   PSP+V    P PP    
Sbjct: 366 RPSPRVPRLNPPPP--RPSPQVPRPNQRAPRL---NPPPP--RPSPQV--PRPSPPVHRL 416

Query: 183 SPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS-----PSPK 317
           +PPPP   PSP+V   +PPPP    PSP+V   +PPPP  S     PSP+
Sbjct: 417 NPPPP--RPSPRVPRLNPPPP---RPSPQVPRLNPPPPRPSRRVPRPSPR 461

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 47/111 (42%), Positives = 58/111 (52%), Gaps = 7/111 (6%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY--- 173
           R SP+V   +PPPP   PSP+V   +PP PH     P PP   PSP+    +PPPP    
Sbjct: 457 RPSPRVPRLNPPPP--RPSPRVPRLNPP-PH----RPSPPVPRPSPREQRLNPPPPRPSP 509

Query: 174 -VYN-SPPPPYYSPSPKVYYKSPPP--PSYYSPSPKVEYKSPPPPSYSPSP 314
            V+  +PPPP   PSP+V   +PPP  PS   P P        PP + PSP
Sbjct: 510 PVHRLNPPPP--RPSPRVPRLNPPPHRPSQRVPRPSPRVPRLNPPPHRPSP 558

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 48/113 (42%), Positives = 59/113 (52%), Gaps = 15/113 (13%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN-----SPPP 194
           +PPPP   PSP+V   SPP   V    PPPP   PSP+V   +PPPP         +PPP
Sbjct: 396 NPPPP--RPSPQVPRPSPP---VHRLNPPPP--RPSPRVPRLNPPPPRPSPQVPRLNPPP 448

Query: 195 PYYS-----PSPKVYYKSPPPPSYYSPSPKVEYKSPPP-----PSYSPSPKTE 323
           P  S     PSP+V   +PPPP    PSP+V   +PPP     P   PSP+ +
Sbjct: 449 PRPSRRVPRPSPRVPRLNPPPPR---PSPRVPRLNPPPHRPSPPVPRPSPREQ 498

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 48/121 (39%), Positives = 62/121 (51%), Gaps = 7/121 (5%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYS-----PSPKVYYKSPPHPHVCVCPPP--PPCYSPSPKVVYKSP 161
           R SP+V   +PPPP  S     PSP+V   +PP P      P   PP + PSP V   SP
Sbjct: 436 RPSPQVPRLNPPPPRPSRRVPRPSPRVPRLNPPPPRPSPRVPRLNPPPHRPSPPVPRPSP 495

Query: 162 PPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRL 341
               +  +PPPP   PSP V+  +PPPP    PSP+V   +PPP  + PS +      R+
Sbjct: 496 REQRL--NPPPPR--PSPPVHRLNPPPP---RPSPRVPRLNPPP--HRPSQRVPRPSPRV 546

Query: 342 P 344
           P
Sbjct: 547 P 547

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 42/105 (40%), Positives = 52/105 (49%), Gaps = 13/105 (12%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPH----VCVCPPPPPCYSPSPKVVYKSPPPP-----YVYNS 185
           P P     SP+V   +PP P     V    PPPP   PS +V   +PPPP         +
Sbjct: 164 PSPLVPRLSPRVPRLNPPLPRPSQRVPRLNPPPP--RPSLRVPRLNPPPPRPSPRVPRLN 221

Query: 186 PPPPYYSPSPKVYYKSPPP----PSYYSPSPKVEYKSPPPPSYSP 308
           PPPP   PSP+V+  +PPP    P    PSP+V   +PPPP  SP
Sbjct: 222 PPPP--RPSPRVHRLNPPPPRPSPQVPRPSPRVPRLNPPPPRPSP 264

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 41/102 (40%), Positives = 51/102 (50%), Gaps = 5/102 (4%)
 Frame = +3

Query: 54  PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-----YVYNSPPPPYYSPSPK 218
           PSP V   SP  P +      PP   PS +V   +PPPP         +PPPP   PSP+
Sbjct: 164 PSPLVPRLSPRVPRL-----NPPLPRPSQRVPRLNPPPPRPSLRVPRLNPPPP--RPSPR 216

Query: 219 VYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY*ISRLP 344
           V   +PPPP    PSP+V   +PPPP   PSP+      R+P
Sbjct: 217 VPRLNPPPP---RPSPRVHRLNPPPP--RPSPQVPRPSPRVP 253

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 40/104 (38%), Positives = 50/104 (48%), Gaps = 9/104 (8%)
 Frame = +3

Query: 3   RASPKVYYKSPPP-----PYYSPSPKVYYKSPPHPH----VCVCPPPPPCYSPSPKVVYK 155
           R SP+V   +PPP     P   PSP+    +PP P     V    PPPP   PSP+V   
Sbjct: 471 RPSPRVPRLNPPPHRPSPPVPRPSPREQRLNPPPPRPSPPVHRLNPPPP--RPSPRVPRL 528

Query: 156 SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP 287
           +PPP    + P      PSP+V   +PPP   + PSP V   SP
Sbjct: 529 NPPP----HRPSQRVPRPSPRVPRLNPPP---HRPSPPVPRPSP 565

[195][TOP]
>UniRef100_B9SMV7 Vegetative cell wall protein gp1, putative n=1 Tax=Ricinus communis
           RepID=B9SMV7_RICCO
          Length = 479

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 46/103 (44%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPP-----PPCYSPSPKVVYKSPPPPYVYNSPPP 194
           SPPP   SP P     SPP P V   PPP     PP  +  P V   SPPPP +  SPPP
Sbjct: 139 SPPPIVPSPPPIPLVPSPPPPIVQPSPPPIIPSPPPLVTSPPPVTVPSPPPPVIVPSPPP 198

Query: 195 PYYSPSPKVYYKSPPPPSYYSPSPKVE--YKSPPPPSYSPSPK 317
           P   P P     SPPPPS   PSP       SPPPP +  +P+
Sbjct: 199 PS-PPPPCPPPPSPPPPSPPPPSPPPPPLVPSPPPPLFPSTPE 240

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 47/107 (43%), Positives = 53/107 (49%), Gaps = 2/107 (1%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P V   SPPPP   PSP     SPP P    CPPPP    PSP     SPPPP +  SPP
Sbjct: 180 PPVTVPSPPPPVIVPSPPP--PSPPPP----CPPPPSPPPPSPPP--PSPPPPPLVPSPP 231

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP--SPKTEY 326
           PP +  +P++     PPP  +   P V   SPPPP   P  SP   Y
Sbjct: 232 PPLFPSTPEI-----PPPIIFPAPPLV--PSPPPPEIIPWLSPPDGY 271

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/111 (39%), Positives = 47/111 (42%), Gaps = 14/111 (12%)
 Frame = +3

Query: 24  YKSPPPPYYS---PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP 194
           Y SP  P+     PSP    + PP P   V  PPP    PSP      P PP +  SPPP
Sbjct: 115 YPSPDNPFNPTPRPSPPPRRRPPPSPPPIVPSPPPIPLVPSPPPPIVQPSPPPIIPSPPP 174

Query: 195 PYY--------SPSPKVYYKSPPPPS---YYSPSPKVEYKSPPPPSYSPSP 314
                      SP P V   SPPPPS      P P     SPPPPS  P P
Sbjct: 175 LVTSPPPVTVPSPPPPVIVPSPPPPSPPPPCPPPPSPPPPSPPPPSPPPPP 225

[196][TOP]
>UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4IYP5_MAIZE
          Length = 441

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/102 (45%), Positives = 52/102 (50%), Gaps = 7/102 (6%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPH---VCVCPPPPPCYSPSPKVVYKSPPPPYVY-NSPPPP 197
           SPPPP  SP P     SPP P      + PPPP  +SP P +    PPPP    +SPPPP
Sbjct: 268 SPPPPLMSPPP----PSPPPPSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPHSPPPP 323

Query: 198 YYSPSPK---VYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
             SP P        SPPPP    P P     SPPPPS +P+P
Sbjct: 324 LSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPPPSPAPAP 365

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 50/122 (40%), Positives = 54/122 (44%), Gaps = 26/122 (21%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSP---SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           SP     SPPPP   P   SP     SPP P      PPPP  SP+P  VY  PPPP   
Sbjct: 319 SPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPPP--SPAPAPVYHPPPPPQCP 376

Query: 180 N----------------SPPPPYY----SPSPKVYYKSPPPPSYYSPSP---KVEYKSPP 290
                             PPPPYY     P+  V Y SPPPP  + P P    V+Y SPP
Sbjct: 377 PCPVLPPPLPCTPTHPWPPPPPYYPGPFPPTDPVRYASPPPPQQHHPWPPVYPVQYGSPP 436

Query: 291 PP 296
           PP
Sbjct: 437 PP 438

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 44/107 (41%), Positives = 53/107 (49%), Gaps = 12/107 (11%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSP--PHPHVCVCPPPPPCYSP--SPKVVYKSPPPPYVYNSPPPP 197
           SPPPP  SP P      P  P P +   PPPPP   P   P  +   PPPP + +SPPPP
Sbjct: 300 SPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPPP 359

Query: 198 YYSPSPKVYYKSPPPPSYYSPSPKV--------EYKSPPPPSYSPSP 314
             +P+P VY+  PPPP    P P +         +  PPPP Y P P
Sbjct: 360 SPAPAP-VYH--PPPPPQCPPCPVLPPPLPCTPTHPWPPPPPYYPGP 403

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 41/94 (43%), Positives = 45/94 (47%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPP   SP P     SPP P      PPPP  SP P     SPPPP   + PPPP   P 
Sbjct: 248 PPPRLPSPPPSPPPPSPPPPS-----PPPPLMSPPP----PSPPPP---SPPPPPLLPPP 295

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P+ +   PP  S   P P  +  SPPPP  SP P
Sbjct: 296 PQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPP 329

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 46/100 (46%), Positives = 50/100 (50%), Gaps = 5/100 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P     SPP P +   PP PP  SP P  +   PP P+   SPPPP  SP
Sbjct: 258 SPPPP--SPPPP----SPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPH---SPPPPLSSP 308

Query: 210 SPK---VYYKSPPPP--SYYSPSPKVEYKSPPPPSYSPSP 314
            P        SPPPP  S   P P  +  SPPPP  SP P
Sbjct: 309 PPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPP 348

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 41/98 (41%), Positives = 47/98 (47%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 200
           +Y  PP    +   K +    P P +   PP PP  SP P     SPPPP +  SPPPP 
Sbjct: 227 FYARPPVNCAAFHCKPFVPPMPPPRLPSPPPSPPPPSPPPP----SPPPPLM--SPPPP- 279

Query: 201 YSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            SP P     SPPPP    P P+    SPPPP  SP P
Sbjct: 280 -SPPPP----SPPPPPLLPPPPQPH--SPPPPLSSPPP 310

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 35/70 (50%), Positives = 37/70 (52%)
 Frame = +3

Query: 108 PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP 287
           PP PP   PSP     SPPPP    SPPPP  SP P +   SPPPPS   PSP      P
Sbjct: 245 PPMPPPRLPSPP---PSPPPP----SPPPP--SPPPPLM--SPPPPSPPPPSP------P 287

Query: 288 PPPSYSPSPK 317
           PPP   P P+
Sbjct: 288 PPPLLPPPPQ 297

[197][TOP]
>UniRef100_B9RS81 Serine-threonine protein kinase, plant-type, putative n=1
           Tax=Ricinus communis RepID=B9RS81_RICCO
          Length = 516

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 43/104 (41%), Positives = 52/104 (50%), Gaps = 3/104 (2%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYN 182
           + +P     SPPPP +SP P      PP P +   PPPPP   P        PPPP  Y+
Sbjct: 405 KPNPSPPLSSPPPPPFSPPP------PPSPPLSPPPPPPPPPPPPSPSPLPPPPPPPFYS 458

Query: 183 SPPPPYYS---PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
            PPPP Y    PSP      PPPP   SP P +E + PP P+Y+
Sbjct: 459 PPPPPTYQSPPPSPPPCVNPPPPP---SPPPCLE-QPPPAPTYN 498

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 45/96 (46%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPP--PYVYNSPPPPYY 203
           SPPPP   P P      PP P     PPPPP YSP P   Y+SPPP  P   N PPPP  
Sbjct: 431 SPPPPPPPPPP------PPSPSPLPPPPPPPFYSPPPPPTYQSPPPSPPPCVNPPPPP-- 482

Query: 204 SPSPKVYYKSPPPPSY---YSPSPKVEYKSPPPPSY 302
           SP P    + PP P+Y   + P   V Y +PPPP Y
Sbjct: 483 SP-PPCLEQPPPAPTYNHIFPPVMGVPY-APPPPFY 516

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/92 (43%), Positives = 45/92 (48%), Gaps = 3/92 (3%)
 Frame = +3

Query: 48  YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYY 227
           + P+P     SPP P     PPP P  SP P      PPPP     PPPP  SP P    
Sbjct: 404 HKPNPSPPLSSPPPPPFSPPPPPSPPLSPPP------PPPP----PPPPPSPSPLP---- 449

Query: 228 KSPPPPSYYSPSPKVEYKSP---PPPSYSPSP 314
             PPPP +YSP P   Y+SP   PPP  +P P
Sbjct: 450 -PPPPPPFYSPPPPPTYQSPPPSPPPCVNPPP 480

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 38/82 (46%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPP-HPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNS 185
           SP      PPPP+YSP P   Y+SPP  P  CV PPPP    PSP    + PPP   YN 
Sbjct: 444 SPSPLPPPPPPPFYSPPPPPTYQSPPPSPPPCVNPPPP----PSPPPCLEQPPPAPTYNH 499

Query: 186 PPPPYYSPSPKVYYKSPPPPSY 251
             PP       V Y +PPPP Y
Sbjct: 500 IFPPVMG----VPY-APPPPFY 516

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 32/68 (47%), Positives = 35/68 (51%)
 Frame = +3

Query: 123 CYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           C+ P+P     SPPPP    SPPPP   PSP +    PPPP    PSP      PPPP Y
Sbjct: 403 CHKPNPSPPLSSPPPPPF--SPPPP---PSPPLSPPPPPPPPPPPPSPSPLPPPPPPPFY 457

Query: 303 SPSPKTEY 326
           SP P   Y
Sbjct: 458 SPPPPPTY 465

[198][TOP]
>UniRef100_B9HBD6 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9HBD6_POPTR
          Length = 525

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/124 (37%), Positives = 60/124 (48%), Gaps = 22/124 (17%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCV--CPPPPPCY------------SPSPKV 146
           SP+ +   PPPP  SP P V  + P + H+     PPPPP +              SP  
Sbjct: 374 SPRTHLPPPPPPPPSPPPPVEQQPPTYHHIPPPPSPPPPPSHYHSNHPAPPPIEKVSPGT 433

Query: 147 VYKSPPPP--YVYNSPPPPYYS---PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS-- 305
            Y  PPPP  + Y +PPPP  S   P+P  +  SPPPP      P  +Y++PPPP  S  
Sbjct: 434 HYHVPPPPPSHQYQAPPPPKQSAEVPAPSYHPNSPPPPP-----PSCQYQAPPPPKQSAG 488

Query: 306 -PSP 314
            P+P
Sbjct: 489 VPAP 492

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/123 (37%), Positives = 55/123 (44%), Gaps = 18/123 (14%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHP------------HVCVCPPPPPCYS----PSPK 143
           P  Y+  PPPP   P P  Y+ + P P            HV   PPPPP +     P PK
Sbjct: 397 PPTYHHIPPPPSPPPPPSHYHSNHPAPPPIEKVSPGTHYHV---PPPPPSHQYQAPPPPK 453

Query: 144 VVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYS--PSPKVEYKSPPPPSYSPSPK 317
              + P P Y  NSPPPP     P   Y++PPPP   +  P+P     SPPPP   P P 
Sbjct: 454 QSAEVPAPSYHPNSPPPP----PPSCQYQAPPPPKQSAGVPAPSYHTNSPPPP---PPPT 506

Query: 318 TEY 326
             Y
Sbjct: 507 NGY 509

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 37/91 (40%), Positives = 42/91 (46%), Gaps = 6/91 (6%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYS---PSPKVYYKSPPHPHVCVCPPPPPCY---SPSPKVVYKSPPPPY 173
           P   Y++PPPP  S   P+P  +  SPP       PPPP C     P PK     P P Y
Sbjct: 442 PSHQYQAPPPPKQSAEVPAPSYHPNSPP-------PPPPSCQYQAPPPPKQSAGVPAPSY 494

Query: 174 VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSP 266
             NSPPPP   P    Y  SPPP    +P P
Sbjct: 495 HTNSPPPP--PPPTNGYTHSPPPTQPTAPVP 523

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 37/108 (34%), Positives = 45/108 (41%), Gaps = 4/108 (3%)
 Frame = +3

Query: 3   RASPKVYYKSPPPP----YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP 170
           + SP  +Y  PPPP    Y +P P       P P      PPPP     P   Y++PPPP
Sbjct: 428 KVSPGTHYHVPPPPPSHQYQAPPPPKQSAEVPAPSYHPNSPPPP----PPSCQYQAPPPP 483

Query: 171 YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                 P P Y      +  SPPPP    P P   Y   PPP+   +P
Sbjct: 484 KQSAGVPAPSY------HTNSPPPP----PPPTNGYTHSPPPTQPTAP 521

[199][TOP]
>UniRef100_UPI0000DB7674 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera
           RepID=UPI0000DB7674
          Length = 441

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 42/106 (39%), Positives = 45/106 (42%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP      PP PY  PSP      PP P+V    PP P   P P      PP P     P
Sbjct: 106 SPTSRPPPPPTPYVPPSPTSRPPPPPTPYV----PPSPTSRPPPIPTPYLPPSPPTSRPP 161

Query: 189 PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
           P PY  PSP +   SPPP SY  PSP       PPP+  P     Y
Sbjct: 162 PTPYLPPSPPINRPSPPPSSYLPPSPSRPPSPQPPPTRPPPTGPTY 207

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 45/107 (42%), Positives = 47/107 (43%), Gaps = 7/107 (6%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP      PP PY  PSP      PP P+V    PP P   P P      PP PYV  SP
Sbjct: 90  SPTSRPPPPPTPYVPPSPTSRPPPPPTPYV----PPSPTSRPPP------PPTPYVPPSP 139

Query: 189 -------PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
                  P PY  PSP      PPP  Y  PSP +   SPPP SY P
Sbjct: 140 TSRPPPIPTPYLPPSPPT--SRPPPTPYLPPSPPINRPSPPPSSYLP 184

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 42/97 (43%), Positives = 45/97 (46%), Gaps = 2/97 (2%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP-PYYS 206
           +PP PY  PSP      PP P     PP PP   P P   Y  P PP     PPP PY  
Sbjct: 32  APPTPYVPPSPPT--SRPPPPPTPYVPPSPPTSRPPP-TPYLPPSPPTSRPRPPPTPYVP 88

Query: 207 PSPKVYYKSPPPPS-YYSPSPKVEYKSPPPPSYSPSP 314
           PSP    + PPPP+ Y  PSP      PP P   PSP
Sbjct: 89  PSPTS--RPPPPPTPYVPPSPTSRPPPPPTPYVPPSP 123

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 41/96 (42%), Positives = 46/96 (47%), Gaps = 2/96 (2%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP-PYYSP 209
           PP PY  PSP    + PP P++   PP PP   P P      PP P     PPP PY  P
Sbjct: 50  PPTPYVPPSPPTS-RPPPTPYL---PPSPPTSRPRPPPTPYVPPSPTSRPPPPPTPYVPP 105

Query: 210 SPKVYYKSPPPPS-YYSPSPKVEYKSPPPPSYSPSP 314
           SP    + PPPP+ Y  PSP      PP P   PSP
Sbjct: 106 SPTS--RPPPPPTPYVPPSPTSRPPPPPTPYVPPSP 139

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/96 (38%), Positives = 42/96 (43%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           + PP PY  PSP      PP P+V   PP P    P P   Y  P P      PP PY  
Sbjct: 80  RPPPTPYVPPSPTSRPPPPPTPYV---PPSPTSRPPPPPTPYVPPSPTSRPPPPPTPYVP 136

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PSP    + PP P+ Y P      + PP P   PSP
Sbjct: 137 PSPTS--RPPPIPTPYLPPSPPTSRPPPTPYLPPSP 170

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 32/78 (41%), Positives = 32/78 (41%)
 Frame = +3

Query: 81  PPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSP 260
           PP P     PP PP   P P      PP P     PP PY  PSP      PPP  Y  P
Sbjct: 30  PPAPPTPYVPPSPPTSRPPPPPTPYVPPSPPTSRPPPTPYLPPSPPTSRPRPPPTPYVPP 89

Query: 261 SPKVEYKSPPPPSYSPSP 314
           SP      PP P   PSP
Sbjct: 90  SPTSRPPPPPTPYVPPSP 107

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 42/109 (38%), Positives = 49/109 (44%), Gaps = 7/109 (6%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPP-----PPPCYSPSPKVVYKSPPPPY 173
           SP      PP PY  PSP       P P++   PP     P P   PSP +   SPPP  
Sbjct: 122 SPTSRPPPPPTPYVPPSPTSRPPPIPTPYLPPSPPTSRPPPTPYLPPSPPINRPSPPPSS 181

Query: 174 VYNSPPPPYYSPSPKVYYKSPPP--PSYYSPSPKVEYKSPPPPSYSPSP 314
               PP P   PSP+     PPP  P+Y  PSP V +   PP +  PSP
Sbjct: 182 YL--PPSPSRPPSPQPPPTRPPPTGPTYLPPSPPVTH---PPITRPPSP 225

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 40/100 (40%), Positives = 44/100 (44%), Gaps = 4/100 (4%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           + PP PY  PSP +   SPP        PP P   PSP+     PPP      PP P  +
Sbjct: 159 RPPPTPYLPPSPPINRPSPPPSSYL---PPSPSRPPSPQPPPTRPPPTGPTYLPPSPPVT 215

Query: 207 PSPKVYYKSPP-PPSYYSPSPKVEYKSPP---PPSYSPSP 314
             P     SPP PP    PSP     SPP   PPS  PSP
Sbjct: 216 HPPITRPPSPPSPPVTRPPSP----PSPPITRPPS-PPSP 250

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 42/106 (39%), Positives = 43/106 (40%), Gaps = 5/106 (4%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P   Y  P PP   PSP      PP P     P PPP   P     Y  P PP  +    
Sbjct: 161 PPTPYLPPSPPINRPSPPPSSYLPPSPSRPPSPQPPPTRPPPTGPTYLPPSPPVTHPPIT 220

Query: 192 PPYYSPSPKVYY-KSPP-PPSYYSPSPKVEYKSPP---PPSYSPSP 314
            P   PSP V    SPP PP    PSP     SPP   PPS  PSP
Sbjct: 221 RPPSPPSPPVTRPPSPPSPPITRPPSP----PSPPITRPPS-PPSP 261

[200][TOP]
>UniRef100_Q10Z71 Peptidase M23B n=1 Tax=Trichodesmium erythraeum IMS101
           RepID=Q10Z71_TRIEI
          Length = 687

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 53/135 (39%), Positives = 60/135 (44%), Gaps = 21/135 (15%)
 Frame = +3

Query: 12  PKVYYKSP---PPPYYSP----SPKVYYKSPPHPHVCVCPPPPPCYSPSP--------KV 146
           P+  Y +P   P PYYSP    SP+ YY   P         P P YSP+P          
Sbjct: 81  PQTSYSAPSYSPEPYYSPAPSYSPEPYYSPAPSYSPEPYYSPAPSYSPAPYYSQPYYEPA 140

Query: 147 VYKSPPPPY----VYNSPPPPYYSPSPKVYYKSP--PPPSYYSPSPKVEYKSPPPPSYSP 308
            Y SP P Y     Y+SP P YY P P  YY  P   P  YYSP P   Y S P P+Y P
Sbjct: 141 PYYSPAPSYSPEPYYSSPAPSYYEPEP--YYSQPYYEPEPYYSPEP---YYSQPAPTYEP 195

Query: 309 SPKTEY*ISRLPLYE 353
            P   Y     P+YE
Sbjct: 196 EP--YYYSQPAPIYE 208

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 52/124 (41%), Positives = 56/124 (45%), Gaps = 19/124 (15%)
 Frame = +3

Query: 9   SPKVYYKSPPP----PYYSP----SPKVYYKSP---PHPHVCVCPPPPPCYSPSPKVVYK 155
           SP+ YY   P     PYYSP    SP  YY  P   P P+      P P YSP P   Y 
Sbjct: 103 SPEPYYSPAPSYSPEPYYSPAPSYSPAPYYSQPYYEPAPYYS----PAPSYSPEP--YYS 156

Query: 156 SPPPPYV-----YNSP---PPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPS 311
           SP P Y      Y+ P   P PYYSP P  YY  P P   Y P P   Y S P P Y P 
Sbjct: 157 SPAPSYYEPEPYYSQPYYEPEPYYSPEP--YYSQPAPT--YEPEPY--YYSQPAPIYEPE 210

Query: 312 PKTE 323
           P+ E
Sbjct: 211 PEPE 214

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 38/95 (40%), Positives = 42/95 (44%), Gaps = 1/95 (1%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP 188
           SP+ YY SP P YY P P  YY  P +        P P YSP P   Y  P P Y    P
Sbjct: 150 SPEPYYSSPAPSYYEPEP--YYSQPYY-------EPEPYYSPEP--YYSQPAPTY---EP 195

Query: 189 PPPYYSPSPKVYYKSP-PPPSYYSPSPKVEYKSPP 290
            P YYS    +Y   P P P      PK  Y +PP
Sbjct: 196 EPYYYSQPAPIYEPEPEPEPDSTIYLPKNLYVAPP 230

[201][TOP]
>UniRef100_B8GAZ4 Putative uncharacterized protein n=1 Tax=Chloroflexus aggregans DSM
           9485 RepID=B8GAZ4_CHLAD
          Length = 381

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/95 (42%), Positives = 50/95 (52%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           +PPPP  +P P      PP P      PPPP  +PSP +   +PPPP     PPPP  +P
Sbjct: 275 TPPPPTATPPPPPTATPPPPP---TATPPPPTATPSP-LPTATPPPPPTATPPPPPTATP 330

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           SP     +PPPP   +P P     SPPPPS + +P
Sbjct: 331 SPPP-TATPPPPPTATPPPPTATPSPPPPSPTATP 364

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/95 (37%), Positives = 43/95 (45%)
 Frame = +3

Query: 36  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP 215
           P    +PSP V   + P P     PPPP    P P     +PPPP    SP P    P P
Sbjct: 260 PTATVTPSPMVTPTATPPPPTATPPPPPTATPPPPPTA--TPPPPTATPSPLPTATPPPP 317

Query: 216 KVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKT 320
                +PPPP   +PSP      PPPP+ +P P T
Sbjct: 318 PT--ATPPPPPTATPSPPPTATPPPPPTATPPPPT 350

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/79 (43%), Positives = 40/79 (50%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           +PPPP  +PSP      PP P     PPPPP  +PSP      PPPP    +PPPP  +P
Sbjct: 298 TPPPPTATPSPLPTATPPPPP--TATPPPPPTATPSPPPTATPPPPPTA--TPPPPTATP 353

Query: 210 SPKVYYKSPPPPSYYSPSP 266
                  SPPPPS  +  P
Sbjct: 354 -------SPPPPSPTATPP 365

[202][TOP]
>UniRef100_B9T3Z7 Nutrient reservoir, putative n=1 Tax=Ricinus communis
           RepID=B9T3Z7_RICCO
          Length = 119

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 42/94 (44%), Positives = 50/94 (53%)
 Frame = +3

Query: 24  YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYY 203
           Y SPPPP+Y   P  Y   PP      CPPPP   SP   +V  +PP P++    PPP +
Sbjct: 15  YSSPPPPFYDGCP--YSCQPPPTPTTKCPPPP---SPPLPLVPPAPPQPWL----PPPVW 65

Query: 204 SPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 305
            P P  YY +PPPP+   P     YK PPPP YS
Sbjct: 66  FPPPFPYY-APPPPNPILPYFPWFYKFPPPPEYS 98

[203][TOP]
>UniRef100_B9RNJ0 Nutrient reservoir, putative n=1 Tax=Ricinus communis
           RepID=B9RNJ0_RICCO
          Length = 154

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 46/101 (45%), Positives = 54/101 (53%), Gaps = 10/101 (9%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPH-VCVCPPPPPCYSPSPKVVYKSPPPP----YVYNSPPP 194
           SPPPP  +  P     SPP P  V  CPPPP   +PS    Y SPPPP    YVY+SPPP
Sbjct: 14  SPPPPVSTCPPPPPPPSPPPPAIVSDCPPPP--VTPSSGAYYYSPPPPAEPTYVYSSPPP 71

Query: 195 PY----YSPSPKV-YYKSPPPPSYYSPSPKVEYKSPPPPSY 302
           P     + PSP    Y+ PPPP+   P     Y +PPP S+
Sbjct: 72  PANDGGFYPSPNYGSYQGPPPPNPIVPYFPFYYYNPPPSSF 112

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/83 (45%), Positives = 44/83 (53%), Gaps = 4/83 (4%)
 Frame = +3

Query: 78  SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYS 257
           SPP P V  CPPPPP           SPPPP + +  PPP  +PS   YY SPPPP+   
Sbjct: 14  SPPPP-VSTCPPPPPP---------PSPPPPAIVSDCPPPPVTPSSGAYYYSPPPPA--- 60

Query: 258 PSPKVEYKSPPPPS----YSPSP 314
             P   Y SPPPP+    + PSP
Sbjct: 61  -EPTYVYSSPPPPANDGGFYPSP 82

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 38/96 (39%), Positives = 49/96 (51%), Gaps = 8/96 (8%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHP----HVCVCPPPPP---CYSPSPKV-VYKSPPP 167
           P +    PPPP  +PS   YY SPP P    +V   PPPP     + PSP    Y+ PPP
Sbjct: 34  PAIVSDCPPPPV-TPSSGAYYYSPPPPAEPTYVYSSPPPPANDGGFYPSPNYGSYQGPPP 92

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVE 275
           P    +P  PY+      YY +PPP S+ S S ++E
Sbjct: 93  P----NPIVPYF----PFYYYNPPPSSFRSHSVRLE 120

[204][TOP]
>UniRef100_Q9FLQ7 Formin-like protein 20 n=1 Tax=Arabidopsis thaliana RepID=FH20_ARATH
          Length = 1615

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 46/101 (45%), Positives = 47/101 (46%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPP   P P   Y SPP P     PPPPP Y   P      PPPP  Y SPP
Sbjct: 936  PPPSYGSPPPP---PPPPPSYGSPPPP-----PPPPPSYGSPPP----PPPPPPGYGSPP 983

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            PP   P P   Y SPPPP    P P   + S  PP   P P
Sbjct: 984  PP---PPPPPSYGSPPPP----PPPPFSHVSSIPPPPPPPP 1017

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/98 (45%), Positives = 47/98 (47%), Gaps = 6/98 (6%)
 Frame = +3

Query: 33   PPPPYYSPS------PKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPP 194
            PPPP +S +      P   Y SPP P     PPPPP Y   P      PPPP  Y SPPP
Sbjct: 921  PPPPPFSNAHSVLSPPPPSYGSPPPP-----PPPPPSYGSPPP----PPPPPPSYGSPPP 971

Query: 195  PYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P   P P   Y SPPPP    P P   Y SPPPP   P
Sbjct: 972  P---PPPPPGYGSPPPP----PPPPPSYGSPPPPPPPP 1002

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 44/99 (44%), Positives = 47/99 (47%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPP   P P   Y SPP P     PPPPP Y   P      PPPP  Y SPP
Sbjct: 949  PPPSYGSPPPP---PPPPPSYGSPPPP-----PPPPPGYGSPPP----PPPPPPSYGSPP 996

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            PP   P P  +  S PPP    P P +   +PPPP   P
Sbjct: 997  PP--PPPPFSHVSSIPPP---PPPPPMHGGAPPPPPPPP 1030

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 49/105 (46%), Positives = 49/105 (46%), Gaps = 9/105 (8%)
 Frame = +3

Query: 21   YYKSPPP-PYYS--PSPKVYY------KSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 173
            Y   PPP PY S  PSP V         S P P V   PPPPP    S      SPPPP 
Sbjct: 880  YILPPPPLPYTSIAPSPSVKILPLHGISSAPSPPVKTAPPPPPPPPFSNAHSVLSPPPPS 939

Query: 174  VYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
             Y SPPPP   P P   Y SPPPP    P P   Y SPPPP   P
Sbjct: 940  -YGSPPPP---PPPPPSYGSPPPP----PPPPPSYGSPPPPPPPP 976

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/99 (44%), Positives = 46/99 (46%), Gaps = 7/99 (7%)
 Frame = +3

Query: 51   SPSPKVYYKSPPHP-------HVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
            +PSP V    PP P       H  + PPPP   SP P      PPPP  Y SPPPP   P
Sbjct: 909  APSPPVKTAPPPPPPPPFSNAHSVLSPPPPSYGSPPPP-----PPPPPSYGSPPPP---P 960

Query: 210  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY 326
             P   Y SPPPP    P P   Y SPPPP   P P   Y
Sbjct: 961  PPPPSYGSPPPP----PPPPPGYGSPPPP---PPPPPSY 992

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 40/99 (40%), Positives = 48/99 (48%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P   Y SPPPP   P P   Y SPP       PPPPP +S    +    PPPP    +PP
Sbjct: 975  PPPGYGSPPPP---PPPPPSYGSPP-------PPPPPPFSHVSSIPPPPPPPPMHGGAPP 1024

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            PP   P P ++  +PPPP    P P +   +PPPP   P
Sbjct: 1025 PP---PPPPMHGGAPPPP----PPPPMHGGAPPPPPPPP 1056

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 44/115 (38%), Positives = 51/115 (44%), Gaps = 21/115 (18%)
 Frame = +3

Query: 33   PPPPYYSP-----SPKVYYKSPPHPHVCVCPPPP----PCY----SPSPKVVYKSPPPP- 170
            PPPP +SP     +       PP P+  + P P     P +    +PSP V    PPPP 
Sbjct: 864  PPPPPFSPLNTTKANDYILPPPPLPYTSIAPSPSVKILPLHGISSAPSPPVKTAPPPPPP 923

Query: 171  -------YVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
                    V + PPP Y SP P      PPPPSY SP P      PPPPSY   P
Sbjct: 924  PPFSNAHSVLSPPPPSYGSPPP----PPPPPPSYGSPPP----PPPPPPSYGSPP 970

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 42/105 (40%), Positives = 49/105 (46%), Gaps = 10/105 (9%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCY-----SPSPKVV----YKSPPPPYVYN 182
            SPPPP   P P     +    +  + PPPP  Y     SPS K++      S P P V  
Sbjct: 859  SPPPP--PPPPPFSPLNTTKANDYILPPPPLPYTSIAPSPSVKILPLHGISSAPSPPVKT 916

Query: 183  SPPPPYYSPSPKVY-YKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            +PPPP   P    +   SPPPPSY SP P      PPPPSY   P
Sbjct: 917  APPPPPPPPFSNAHSVLSPPPPSYGSPPP----PPPPPPSYGSPP 957

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/95 (35%), Positives = 45/95 (47%)
 Frame = +3

Query: 12   PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
            P ++  +PPPP   P P ++  +PP       PPPPP +  +P      PPPP    +PP
Sbjct: 1016 PPMHGGAPPPP---PPPPMHGGAPPP------PPPPPMHGGAPP---PPPPPPMHGGAPP 1063

Query: 192  PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            PP   P P      PPPP      P +   +PPPP
Sbjct: 1064 PP---PPPMFGGAQPPPP------PPMRGGAPPPP 1089

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 31/88 (35%), Positives = 40/88 (45%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP +  +P      P H      PPPPP +  +P      PPPP ++   PPP   P 
Sbjct: 1014 PPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPP----PPPPPPMHGGAPPP---PP 1066

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            P ++  + PPP    P P      PPPP
Sbjct: 1067 PPMFGGAQPPP----PPPMRGGAPPPPP 1090

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 38/95 (40%), Positives = 41/95 (43%), Gaps = 6/95 (6%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKS--PPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           PPPP   P+   Y  S  PP P     PPPPP  S  P      PPPP     PPPP+ S
Sbjct: 650 PPPPPPLPTYSHYQTSQLPPPP-----PPPPPFSSERPNSGTVLPPPP----PPPPPFSS 700

Query: 207 PSPK--VYYKSPPPPS--YYSPSPKVEYKSPPPPS 299
             P        PPPP   + S  P      PPPPS
Sbjct: 701 ERPNSGTVLPPPPPPPLPFSSERPNSGTVLPPPPS 735

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 31/88 (35%), Positives = 39/88 (44%)
 Frame = +3

Query: 33   PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
            PPPP +  +P      P H      PPPPP +  +P      PPPP ++    PP   P 
Sbjct: 1027 PPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPP-----PPPPPMFGGAQPP---PP 1078

Query: 213  PKVYYKSPPPPSYYSPSPKVEYKSPPPP 296
            P +   +PPPP    P P      PPPP
Sbjct: 1079 PPMRGGAPPPP----PPPMRGGAPPPPP 1102

[205][TOP]
>UniRef100_UPI0000ECB104 UPI0000ECB104 related cluster n=1 Tax=Gallus gallus
           RepID=UPI0000ECB104
          Length = 559

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/121 (37%), Positives = 57/121 (47%), Gaps = 19/121 (15%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPC---YSPSPKVVYKSPPPPY 173
           R  P  ++  PPPPY+ P     Y  PPH H    PPPPP    Y P P   +  PPPP+
Sbjct: 341 RPPPHGHHYPPPPPYHWP-----YCPPPHGHHY--PPPPPYHGPYCPPPHGHHHPPPPPH 393

Query: 174 -----------VYNSPPPPY---YSPSPKVYYKSPPPPSY--YSPSPKVEYKSPPPPSYS 305
                       ++ PPPPY   Y P P  ++  PPPP +  Y P P   +  PPPP + 
Sbjct: 394 HHRPRRPPPHGHHHLPPPPYHWPYCPPPHGHHYPPPPPYHGPYCPPPHGHHYPPPPPYHG 453

Query: 306 P 308
           P
Sbjct: 454 P 454

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 40/111 (36%), Positives = 53/111 (47%), Gaps = 19/111 (17%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPC---YSPSPKVVYKSPPPPYV--------- 176
           PPPP++ P      + PPH H    PPPPP    Y P P   +  PPPPY          
Sbjct: 332 PPPPHHRPR-----RPPPHGHHY--PPPPPYHWPYCPPPHGHHYPPPPPYHGPYCPPPHG 384

Query: 177 -YNSPPPPYY----SPSPKVYYKSPPPPSY--YSPSPKVEYKSPPPPSYSP 308
            ++ PPPP++     P P  ++  PPPP +  Y P P   +  PPPP + P
Sbjct: 385 HHHPPPPPHHHRPRRPPPHGHHHLPPPPYHWPYCPPPHGHHYPPPPPYHGP 435

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 36/102 (35%), Positives = 46/102 (45%), Gaps = 9/102 (8%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPP--PCYSPSPKVVYKSPPPPYVYNSPPPP-- 197
           S PPPY           PP PH     PPP    Y P P   +   PPP+ ++ PPPP  
Sbjct: 320 STPPPYDEQQ-----SPPPPPHHRPRRPPPHGHHYPPPPPYHWPYCPPPHGHHYPPPPPY 374

Query: 198 --YYSPSPKVYYKSPPPPSYY---SPSPKVEYKSPPPPSYSP 308
              Y P P  ++  PPPP ++    P P   +  PPPP + P
Sbjct: 375 HGPYCPPPHGHHHPPPPPHHHRPRRPPPHGHHHLPPPPYHWP 416

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 34/102 (33%), Positives = 44/102 (43%), Gaps = 5/102 (4%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP 191
           P +Y K   P            +PP       PPPPP + P      + PPP   +  PP
Sbjct: 299 PPLYDKQDRPLLIQEKSDFPPSTPPPYDEQQSPPPPPHHRP------RRPPPHGHHYPPP 352

Query: 192 PPY---YSPSPKVYYKSPPPPSY--YSPSPKVEYKSPPPPSY 302
           PPY   Y P P  ++  PPPP +  Y P P   +  PPPP +
Sbjct: 353 PPYHWPYCPPPHGHHYPPPPPYHGPYCPPPHGHHHPPPPPHH 394

[206][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/95 (47%), Positives = 45/95 (47%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   PSP      PP P     PPPP   SP P     SPPPP      PPP   P
Sbjct: 57  SPPPPLPPPSPSPPSPPPPSPPP-PSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 115

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P      PP PS  SP P     SPPPPS SPSP
Sbjct: 116 PPSPPPSPPPSPSPPSPPPP----SPPPPSISPSP 146

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 44/95 (46%), Positives = 49/95 (51%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   PSP      PP P     PP PP  SP P  +  SPPPP     PPP + +P
Sbjct: 113 SPPPPSPPPSP------PPSP----SPPSPPPPSPPPPSISPSPPPP-----PPPWWQAP 157

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           S       PPPP + +PS      SPPPPS SPSP
Sbjct: 158 SASPSPPPPPPPWWQAPSAS---PSPPPPSISPSP 189

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/100 (46%), Positives = 48/100 (48%), Gaps = 5/100 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPP    PSP      PP P     PPP P  SP P     SPPPP    SPPPP  SP
Sbjct: 89  SPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP----SPPPPSISP 144

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPP-----PSYSPSP 314
           SP      PPPP + +PS       PPP     PS SPSP
Sbjct: 145 SP----PPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSP 180

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 46/103 (44%), Positives = 49/103 (47%), Gaps = 8/103 (7%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP---CYSPSPKVVYKSPPPPY-----VYNS 185
           SPPP    PSP     SPP P +   PPPPP     +PS       PPPP+        S
Sbjct: 122 SPPPSPSPPSPPP--PSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPS 179

Query: 186 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           PPPP  SPSP       PPP   SPSP     SPPPPS  P P
Sbjct: 180 PPPPSISPSPPSSASPTPPPPSASPSPPP--PSPPPPSPPPPP 220

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/93 (49%), Positives = 46/93 (49%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P     SPP P     PPP P  SP P     SPPPP    SP PP   P
Sbjct: 21  SPPPP--SPPPP----SPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPP-SPP 73

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P     SPPPPS  SP P     SPPPPS  P
Sbjct: 74  PPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPP 106

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 48/95 (50%), Positives = 48/95 (50%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   PSP      PP P     PP PP  SP P     SPPPP    SPP P  SP
Sbjct: 48  SPPPPSPPPSPP-----PPLPPPSPSPPSPPPPSPPPP----SPPPP----SPPSPPPSP 94

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPPS   PSP     SPPPPS  PSP
Sbjct: 95  PPP----SPPPPSPPPPSPPP--PSPPPPSPPPSP 123

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 47/111 (42%), Positives = 51/111 (45%), Gaps = 9/111 (8%)
 Frame = +3

Query: 9   SPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY----- 173
           SP      PP P  SP P     SPP P      PPPP  SPSP      PPPP+     
Sbjct: 108 SPPPPSPPPPSPPPSPPPSPSPPSPPPP-----SPPPPSISPSP----PPPPPPWWQAPS 158

Query: 174 VYNSPPPP----YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
              SPPPP    + +PS      SPPPPS     P     +PPPPS SPSP
Sbjct: 159 ASPSPPPPPPPWWQAPSAS---PSPPPPSISPSPPSSASPTPPPPSASPSP 206

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 45/98 (45%), Positives = 47/98 (47%), Gaps = 3/98 (3%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYK-SPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP  SPSP      +PP P     PPPP    PSP      PPPP     PPPP   
Sbjct: 179 SPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSP------PPPP-----PPPPPPP 227

Query: 207 PSPKVYYKSPPPPSYYSPSPKV--EYKSPPPPSYSPSP 314
           PSP     SP PP   SPSP      +SPPPP   P P
Sbjct: 228 PSP----PSPNPPPSASPSPPFGRSLRSPPPPPPPPPP 261

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 48/103 (46%), Positives = 49/103 (47%), Gaps = 8/103 (7%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPP-PPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP   P P     SPP P     PP PPP   P P     SPPPP    SPPP   S
Sbjct: 71  SPPPPS-PPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP---S 126

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPP-------PSYSPSP 314
           PSP     SPPPPS   P P +    PPP       PS SPSP
Sbjct: 127 PSP----PSPPPPS--PPPPSISPSPPPPPPPWWQAPSASPSP 163

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 45/102 (44%), Positives = 48/102 (47%), Gaps = 8/102 (7%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHP------HVCVCPPPPPCYSPS-PKVVYKSPPPPYVYNSPP 191
           PPPP +  +P      PP P            PPPP  SPS P     +PPPP    SPP
Sbjct: 148 PPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPP 207

Query: 192 PPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP-PPPSYSPSP 314
           PP  SP P     SPPPP    P P     SP PPPS SPSP
Sbjct: 208 PP--SPPP----PSPPPPPPPPPPPPPSPPSPNPPPSASPSP 243

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 44/102 (43%), Positives = 48/102 (47%), Gaps = 8/102 (7%)
 Frame = +3

Query: 33  PPPPYY-----SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP 197
           PPPP++     SPSP     SP  P      PPPP  SPSP     SPPPP   + PPPP
Sbjct: 166 PPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPP--PSPPPP---SPPPPP 220

Query: 198 YYSPSPKVYYKSPPPPSYYSPSP---KVEYKSPPPPSYSPSP 314
              P P     SP PP   SPSP   +     PPPP   P P
Sbjct: 221 PPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPP 262

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/109 (39%), Positives = 47/109 (43%), Gaps = 14/109 (12%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP--------YVYNS 185
           SPPPP   P        PP P     PP PP  SP P  +  SPPPP            S
Sbjct: 103 SPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPS 162

Query: 186 PPPP----YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPS--YSPSP 314
           PPPP    + +PS      SPPPPS     P     +PPPPS   SP P
Sbjct: 163 PPPPPPPWWQAPSAS---PSPPPPSISPSPPSSASPTPPPPSASPSPPP 208

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 41/86 (47%), Positives = 43/86 (50%), Gaps = 7/86 (8%)
 Frame = +3

Query: 72  YKSPPHPHVCVCPPP-PPCYSP---SPKVVYKSPPPPYVYNSPPPPYYSPSPKVYY---K 230
           Y +PP P     PPP PP  SP    P +   SPPPP    SPPPP   PSP        
Sbjct: 16  YATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPP 75

Query: 231 SPPPPSYYSPSPKVEYKSPPPPSYSP 308
           SPPPPS   PSP     SPPPPS  P
Sbjct: 76  SPPPPSPPPPSPPSPPPSPPPPSPPP 101

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 39/91 (42%), Positives = 42/91 (46%), Gaps = 2/91 (2%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           +PPPP  SPSP     SPP P      PPPP   P        PPPP   +  PPP  SP
Sbjct: 196 TPPPPSASPSPPP--PSPPPPS-----PPPPPPPP-------PPPPPSPPSPNPPPSASP 241

Query: 210 SPKV--YYKSPPPPSYYSPSPKVEYKSPPPP 296
           SP      +SPPPP    P P      PPPP
Sbjct: 242 SPPFGRSLRSPPPP----PPP------PPPP 262

[207][TOP]
>UniRef100_Q9M7N8 Proline-rich protein 4 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7N8_ARATH
          Length = 448

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/110 (39%), Positives = 50/110 (45%), Gaps = 8/110 (7%)
 Frame = +3

Query: 12  PKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYK--------SPPP 167
           P V    PPP    P P   Y  PP   V   PPP P Y P PKV            P P
Sbjct: 194 PPVPVYEPPPKKEIPPPVPVYDPPPKKEV---PPPVPVYKPPPKVELPPPIPKKPCPPKP 250

Query: 168 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           P + + PP P Y P PK+  + PPP   Y P PK+E+  PP P + P  K
Sbjct: 251 PKIEHPPPVPVYKPPPKI--EHPPPVPVYKPPPKIEH-PPPVPVHKPPKK 297

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/123 (35%), Positives = 50/123 (40%), Gaps = 21/123 (17%)
 Frame = +3

Query: 21  YYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP-----PPPYVYNS 185
           + K P PP YSP  +V             PPP P Y P PK     P     PPP     
Sbjct: 177 FLKKPCPPKYSPPVEV-------------PPPVPVYEPPPKKEIPPPVPVYDPPPKKEVP 223

Query: 186 PPPPYYSPSPKV----------------YYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPK 317
           PP P Y P PKV                  + PPP   Y P PK+E+  PP P Y P PK
Sbjct: 224 PPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEH-PPPVPVYKPPPK 282

Query: 318 TEY 326
            E+
Sbjct: 283 IEH 285

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 48/141 (34%), Positives = 54/141 (38%), Gaps = 43/141 (30%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSP-------PHPHVCVCPPPPPCYSPSPKV-------VYKSP--- 161
           PP P Y P PKV    P       P P     PPP P Y P PK+       VYK P   
Sbjct: 224 PPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEHPPPVPVYKPPPKI 283

Query: 162 --PPPYVYNSP-----PPPYYSPSPKVYYKSP-------------------PPPSYYSPS 263
             PPP   + P     PP    P P   +K P                   PPP    P 
Sbjct: 284 EHPPPVPVHKPPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPP 343

Query: 264 PKVEYKSPPPPSYSPSPKTEY 326
           PK+E+  PP P Y P PK E+
Sbjct: 344 PKIEH-PPPVPVYKPPPKIEH 363

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 42/118 (35%), Positives = 50/118 (42%), Gaps = 19/118 (16%)
 Frame = +3

Query: 12  PKVYYKSPPP-------PYYSPSPKVYYKSP---------PHPHVCVCPPPPPCYSP--- 134
           P   YK PP        P Y P PK+ +  P         P P   V PPP P + P   
Sbjct: 258 PVPVYKPPPKIEHPPPVPVYKPPPKIEHPPPVPVHKPPKKPCPPKKVDPPPVPVHKPPTK 317

Query: 135 SPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P    K  PPP   + PPP    P PK+  + PPP   Y P PK+E+    PP Y P
Sbjct: 318 KPCPPKKVDPPPVPVHKPPPKIVIPPPKI--EHPPPVPVYKPPPKIEH----PPIYIP 369

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 42/106 (39%), Positives = 45/106 (42%), Gaps = 11/106 (10%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPP---HPHVCV-------CPPPPPCYSPSPKVVYKSPPPPYVYN 182
           PPP    P P   YK PP   HP + +       CPPP P Y P P V+ K P P     
Sbjct: 342 PPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKP-PVVIPKKPCP----- 395

Query: 183 SPPPPYYSPSPKVYYKSP-PPPSYYSPSPKVEYKSPPPPSYSPSPK 317
            PP P Y P   V  K P PP     P PK     P PP Y   PK
Sbjct: 396 -PPVPVYKPPVVVIPKKPCPPLPQLPPLPKF---PPLPPKYIHHPK 437

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 39/97 (40%), Positives = 45/97 (46%), Gaps = 4/97 (4%)
 Frame = +3

Query: 45  YYSPSPKVY-YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY---VYNSPPPPYYSPS 212
           ++ P PK+  +K   HP     P PPP     P  + K  PP Y   V   PP P Y P 
Sbjct: 149 FFWPMPKLPPFKGFDHPF----PLPPPL--ELPPFLKKPCPPKYSPPVEVPPPVPVYEPP 202

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTE 323
           PK   + PPP   Y P PK E   PP P Y P PK E
Sbjct: 203 PK--KEIPPPVPVYDPPPKKEV-PPPVPVYKPPPKVE 236

[208][TOP]
>UniRef100_Q01947 Extensin (Class II) n=1 Tax=Solanum lycopersicum RepID=Q01947_SOLLC
          Length = 82

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/93 (45%), Positives = 48/93 (51%), Gaps = 5/93 (5%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PP  ++ P P     SPP+ +     PPPP  SPSP      PPP Y Y+SPPPP  SP 
Sbjct: 1   PPNSHWEPKP-----SPPYTY---SSPPPP--SPSP------PPPTYYYSSPPPPSPSPP 44

Query: 213 PKVYYKSPPPPSYYSPSP-----KVEYKSPPPP 296
           P  Y   PPPP +Y   P      V Y SPPPP
Sbjct: 45  PPTYSSPPPPPPFYENIPLPPVIGVSYASPPPP 77

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/82 (47%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +3

Query: 3   RASPKVYYKSPPPPYYSPSPKV-YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVY 179
           + SP   Y SPPPP  SP P   YY SPP P      PPPP YS  P      PPPP+  
Sbjct: 9   KPSPPYTYSSPPPPSPSPPPPTYYYSSPPPPSP---SPPPPTYSSPP------PPPPFYE 59

Query: 180 NSPPPPYYSPSPKVYYKSPPPP 245
           N P PP       V Y SPPPP
Sbjct: 60  NIPLPPVIG----VSYASPPPP 77

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 29/53 (54%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = +3

Query: 159 PPPPYVYNSPPPPYYSPSPKV-YYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P PPY Y+SPPPP  SP P   YY SPPPPS   P P      PPPP Y   P
Sbjct: 10  PSPPYTYSSPPPPSPSPPPPTYYYSSPPPPSPSPPPPTYSSPPPPPPFYENIP 62

[209][TOP]
>UniRef100_B9IKQ3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IKQ3_POPTR
          Length = 496

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/97 (45%), Positives = 50/97 (51%), Gaps = 6/97 (6%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP  SP P VY   PP P     PPPPP  S  P     SPPPP   +S PPP     
Sbjct: 410 PPPPVTSPPPPVYSPPPPPPPPLSSPPPPP--SLVPPSALPSPPPP---SSMPPP----- 459

Query: 213 PKVYYKSPPP---PSYYSPSPK---VEYKSPPPPSYS 305
           P +++ +PPP   P Y  P P    + Y SPPPPS S
Sbjct: 460 PPIHFYNPPPLPAPVYNGPLPPITGISYASPPPPSIS 496

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/88 (40%), Positives = 41/88 (46%), Gaps = 11/88 (12%)
 Frame = +3

Query: 63  KVYYKSPPHPHVCVC-----------PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           KV+   P H     C           PPPPP  SP P V    PPPP   +SPPPP  S 
Sbjct: 383 KVFLSRPVHCEAFNCHEFDPSPPSQPPPPPPVTSPPPPVYSPPPPPPPPLSSPPPP-PSL 441

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPP 293
            P     SPPPPS   P P + + +PPP
Sbjct: 442 VPPSALPSPPPPSSMPPPPPIHFYNPPP 469

[210][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 44/95 (46%), Positives = 44/95 (46%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P      PP P     PPPPP   P P     SPPPP    SPPPP  SP
Sbjct: 324 SPPPPSPPPPPPPSPPPPPSP-----PPPPPPRPPPPSPPPPSPPPP----SPPPP--SP 372

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P      PPPP    P P     SPPPPS  P P
Sbjct: 373 PPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPP 407

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 46/101 (45%), Positives = 47/101 (46%), Gaps = 6/101 (5%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P     PPPPP  SP P      PPPP     PPPP   P
Sbjct: 239 SPPPPS-PPPPSPPPPSPPPPS----PPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPP 293

Query: 210 SPKVYYKSPPPPSYYSPS------PKVEYKSPPPPSYSPSP 314
            P     SPPPPS   PS      P+    SPPPPS  P P
Sbjct: 294 PPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPP 334

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 42/96 (43%), Positives = 44/96 (45%), Gaps = 2/96 (2%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY--YS 206
           PPP    PSP      PP P     PPPPP   P P     SPPPP   + PPPP     
Sbjct: 288 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPP 347

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P P+    SPPPPS   PSP      PPPP   P P
Sbjct: 348 PPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 383

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 45/96 (46%), Positives = 45/96 (46%), Gaps = 1/96 (1%)
 Frame = +3

Query: 30  SPPPPYYSP-SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP   P SP      PP P     PPPPP   P P     SPPPP     PPPP  S
Sbjct: 234 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP--PSPPPPPPPRPPPPPPPS 291

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P P     SPPPPS   PSP      PPPP   P P
Sbjct: 292 PPP----PSPPPPSPPPPSPPPPSPPPPPPPRPPPP 323

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 42/93 (45%), Positives = 44/93 (47%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP   P P     SPPPP   + PPPP  SP
Sbjct: 219 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPPPPPSPPPPPPPSP 276

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P    + PPPP    P P     SPPPPS  P
Sbjct: 277 PPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPP 309

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 42/95 (44%), Positives = 44/95 (46%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P+    SPP P     PPPPP  SP P      PPPP      PPP   P
Sbjct: 311 SPPPP---PPPRPPPPSPPPPS----PPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPP 363

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPP   SP P    + PPP    PSP
Sbjct: 364 PPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSP 398

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/94 (46%), Positives = 46/94 (48%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP  SP P    + PP P     PP PP  SP P     SPPPP    SPPPP   P 
Sbjct: 269 PPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP----SPPPP----SPPPP---PP 317

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P+    SPPPPS   P P      PPPPS  P P
Sbjct: 318 PRPPPPSPPPPS---PPPPPPPSPPPPPSPPPPP 348

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 45/94 (47%), Positives = 45/94 (47%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP  SP P     SPP P     PPPPP   P P     SPPPP    SPPPP   P 
Sbjct: 261 PPPPPPSPPPPP-PPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP----SPPPPSPPPP 315

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P      PPPPS   PSP      PPPP  SP P
Sbjct: 316 PP---PRPPPPSPPPPSP------PPPPPPSPPP 340

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 42/93 (45%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPH-VCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           PPPP   P P     SPP P      PPPPP  SP P    + PPP     SPPPP  SP
Sbjct: 346 PPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPP--SP 403

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
            P      PPPP    P P     SPPPPS  P
Sbjct: 404 PPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPP 436

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/95 (46%), Positives = 45/95 (47%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP   P P     SPPPP    SPPPP   P
Sbjct: 209 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPP----SPPPPSPPP 262

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPP   SP P    + PPPP  SP P
Sbjct: 263 PPP---PSPPPPPPPSPPPPPPPRPPPPPPPSPPP 294

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 42/94 (44%), Positives = 43/94 (45%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP   P P      PP P     P PPP   P P     SPPPP   + PPPP   P 
Sbjct: 333 PPPPSPPPPPSPPPPPPPRPPP---PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPP 389

Query: 213 PKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P     SPPPPS   PSP      PPPP  SP P
Sbjct: 390 P----PSPPPPSPPPPSP------PPPPPPSPPP 413

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 45/95 (47%), Positives = 46/95 (48%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P     SPP P      PPPP   P P     SPPPP   + PPPP   P
Sbjct: 229 SPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP---PSPPPPPPPSPPPPPPPRP 284

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPPS   PSP     SPPPPS  P P
Sbjct: 285 PPPPP-PSPPPPSPPPPSPPP--PSPPPPSPPPPP 316

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 45/96 (46%), Positives = 45/96 (46%), Gaps = 1/96 (1%)
 Frame = +3

Query: 30  SPPPPYY-SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 206
           SPPPP    PSP      PP P     P PPP   P P     SPPPP    SPPPP  S
Sbjct: 189 SPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPP----SPPPP--S 239

Query: 207 PSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
           P P     SPPPPS   PSP      PPPP   P P
Sbjct: 240 PPP----PSPPPPSPPPPSPPPPSPPPPPPPSPPPP 271

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 44/101 (43%), Positives = 47/101 (46%), Gaps = 5/101 (4%)
 Frame = +3

Query: 27  KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPC--YSPSPKVVYKSPPPPYVYNSPPPPY 200
           + PPPP  SP P     SPP P      PPPP     P P+    SPPPP   + PPPP 
Sbjct: 283 RPPPPPPPSPPPP----SPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPP---SPPPPPP 335

Query: 201 YSPSPKVYYKSPPPPSYYSPS---PKVEYKSPPPPSYSPSP 314
            SP P      PPPP    PS   P     SPPPPS  P P
Sbjct: 336 PSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPP 376

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 42/95 (44%), Positives = 43/95 (45%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP   P P+    SPP P     PPPP    PSP      PPPP     PPPP   P
Sbjct: 343 SPPPP---PPPRPPPPSPPPPS----PPPPSPPPPSP------PPPPPPSPPPPPPPRPP 389

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 314
            P     SPPPPS   P P      PPP    PSP
Sbjct: 390 PPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSP 424

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 41/93 (44%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPP-PPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           PPPP   P P      PP P     PPP PP  SP P    + PPP     SPPPP   P
Sbjct: 278 PPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPP-PPP 336

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 308
           SP      PPPP    P P     SPPPPS  P
Sbjct: 337 SPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPP 369

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 43/90 (47%), Positives = 44/90 (48%)
 Frame = +3

Query: 30  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 209
           SPPPP  SP P      PP P     PP PP  SP P     SPPPP   + PPPP   P
Sbjct: 366 SPPPP--SPPPPPPPSPPPPPPPRPPPPSPPPPSPPP----PSPPPPPPPSPPPPPPPRP 419

Query: 210 SPKVYYKSPPPPSYYSPSPKVEYKSPPPPS 299
            P     SPPPP   SP P     SPPPPS
Sbjct: 420 PP----PSPPPP---SPPP----PSPPPPS 438

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 38/78 (48%), Positives = 38/78 (48%)
 Frame = +3

Query: 33  PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPS 212
           PPPP   P P     SPP P     PPPPP  SP P      PPPP     PPPP  SP 
Sbjct: 382 PPPPPRPPPPSPPPPSPPPP----SPPPPPPPSPPP------PPPP----RPPPP--SPP 425

Query: 213 PKVYYKSPPPPSYYSPSP 266
           P     SPPPPS   PSP
Sbjct: 426 P----PSPPPPSPPPPSP 439

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 34/69 (49%), Positives = 34/69 (49%)
 Frame = +3

Query: 108 PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP 287
           P PPP   P P     SPPPP    SPPPP  SP P     SPPPPS   PSP      P
Sbjct: 188 PSPPPPSPPPPSPPPPSPPPP----SPPPP--SPPPP----SPPPPSPPPPSPP----PP 233

Query: 288 PPPSYSPSP 314
            PP  SP P
Sbjct: 234 SPPPPSPPP 242

[211][TOP]
>UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO
          Length = 1765

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 45/97 (46%), Positives = 47/97 (48%), Gaps = 2/97 (2%)
 Frame = +3

Query: 30   SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPP--PPYY 203
            SPPPP  SP P      PP P     PPPPP   P       SPPPP V+  PP  PP  
Sbjct: 1149 SPPPPPPSPPPSPPPSPPP