AV549238 ( RZ05b10R )

[UP]


[1][TOP]
>UniRef100_Q9FS16 Extensin-3 n=1 Tax=Arabidopsis thaliana RepID=EXTN3_ARATH
          Length = 427

 Score =  273 bits (697), Expect = 6e-72
 Identities = 113/113 (100%), Positives = 113/113 (100%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP
Sbjct: 63  KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 122

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK
Sbjct: 123 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 175

 Score =  273 bits (697), Expect = 6e-72
 Identities = 113/113 (100%), Positives = 113/113 (100%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP
Sbjct: 91  KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 150

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK
Sbjct: 151 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 203

 Score =  273 bits (697), Expect = 6e-72
 Identities = 113/113 (100%), Positives = 113/113 (100%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP
Sbjct: 119 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 178

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK
Sbjct: 179 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 231

 Score =  273 bits (697), Expect = 6e-72
 Identities = 113/113 (100%), Positives = 113/113 (100%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP
Sbjct: 147 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 206

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK
Sbjct: 207 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 259

 Score =  273 bits (697), Expect = 6e-72
 Identities = 113/113 (100%), Positives = 113/113 (100%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP
Sbjct: 175 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 234

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK
Sbjct: 235 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 287

 Score =  273 bits (697), Expect = 6e-72
 Identities = 113/113 (100%), Positives = 113/113 (100%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP
Sbjct: 203 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 262

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK
Sbjct: 263 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 315

 Score =  273 bits (697), Expect = 6e-72
 Identities = 113/113 (100%), Positives = 113/113 (100%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP
Sbjct: 231 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 290

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK
Sbjct: 291 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 343

 Score =  273 bits (697), Expect = 6e-72
 Identities = 113/113 (100%), Positives = 113/113 (100%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP
Sbjct: 259 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 318

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK
Sbjct: 319 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 371

 Score =  268 bits (684), Expect = 2e-70
 Identities = 111/113 (98%), Positives = 112/113 (99%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP
Sbjct: 287 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 346

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK+ YVYK
Sbjct: 347 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYK 399

 Score =  261 bits (668), Expect = 1e-68
 Identities = 108/109 (99%), Positives = 108/109 (99%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 193
           PPVKHYSPPPVYHSPPPPKKHY YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK
Sbjct: 39  PPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 98

Query: 194 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK
Sbjct: 99  HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 147

 Score =  233 bits (593), Expect = 6e-60
 Identities = 100/113 (88%), Positives = 102/113 (90%), Gaps = 3/113 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP
Sbjct: 315 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 374

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKS-PPPPVKHYSPP--PVYHSPPPPKKHY 331
           PPVKHYSPPPVYHSPPPPK+ YVYKS PPPPV HYSPP  P  +  PPP  HY
Sbjct: 375 PPVKHYSPPPVYHSPPPPKEKYVYKSPPPPPVHHYSPPHHPYLYKSPPPPYHY 427

 Score =  200 bits (509), Expect = 4e-50
 Identities = 85/96 (88%), Positives = 86/96 (89%), Gaps = 7/96 (7%)
 Frame = +2

Query: 74  HYVYKSPPPPVK-------HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 232
           +Y Y SPPPPVK       HYSPPPVYHSPPPPKKHY YKSPPPPVKHYSPPPVYHSPPP
Sbjct: 24  NYFYSSPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPP 83

Query: 233 PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK
Sbjct: 84  PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 119

[2][TOP]
>UniRef100_Q8LK15 Extensin n=1 Tax=Brassica napus RepID=Q8LK15_BRANA
          Length = 259

 Score =  230 bits (586), Expect = 4e-59
 Identities = 99/113 (87%), Positives = 102/113 (90%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPPVKHYSPP VYHSPPPPK  YVYKSPPPPVKHY+PP VYHS PPPKKHY+YKSPP
Sbjct: 121 QSPPPPVKHYSPPSVYHSPPPPKNQYVYKSPPPPVKHYTPP-VYHSGPPPKKHYMYKSPP 179

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPV HYS P VYHSPPPPKKHYVYKSPPPPVKHYSP  VYHSPPPPKK YVYK
Sbjct: 180 PPVMHYSLPQVYHSPPPPKKHYVYKSPPPPVKHYSPRLVYHSPPPPKKKYVYK 232

 Score =  210 bits (534), Expect = 4e-53
 Identities = 97/133 (72%), Positives = 101/133 (75%), Gaps = 20/133 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP-----------PVYHSPPPP---------KKHYVYKSPPPPVKHYSP 121
           KSPPPPVK YSPP            VY SPPPP          K+YVY+SPPPPVKHYSP
Sbjct: 73  KSPPPPVKQYSPPWLRSPPPPRKDYVYKSPPPPVKQYSSPPPNKYYVYQSPPPPVKHYSP 132

Query: 122 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 301
           P VYHSPPPPK  YVYKSPPPPVKHY+ PPVYHS PPPKKHY+YKSPPPPV HYS P VY
Sbjct: 133 PSVYHSPPPPKNQYVYKSPPPPVKHYT-PPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVY 191

Query: 302 HSPPPPKKHYVYK 340
           HSPPPPKKHYVYK
Sbjct: 192 HSPPPPKKHYVYK 204

 Score =  207 bits (527), Expect = 3e-52
 Identities = 93/113 (82%), Positives = 97/113 (85%), Gaps = 3/113 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVKHY+PP VYHS PPPKKHY+YKSPPPPV HYS P VYHSPPPPKKHYVYKSPP
Sbjct: 149 KSPPPPVKHYTPP-VYHSGPPPKKHYMYKSPPPPVMHYSLPQVYHSPPPPKKHYVYKSPP 207

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKKHY 331
           PPVKHYSP  VYHSPPPPKK YVYKSPPPPV+HY PP    +Y SPPPP  HY
Sbjct: 208 PPVKHYSPRLVYHSPPPPKKKYVYKSPPPPVRHYFPPHHLYLYKSPPPP-YHY 259

 Score =  175 bits (443), Expect = 2e-42
 Identities = 84/146 (57%), Positives = 87/146 (59%), Gaps = 48/146 (32%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH---------------------- 160
           Y SPPPP KHY YKSPPPPV HYS P VYHSPPPPKKH                      
Sbjct: 32  YSSPPPPVKHYEYKSPPPPVMHYSLPQVYHSPPPPKKHTVNKSPPPPVKQYSPPWLRSPP 91

Query: 161 --------------------------YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 262
                                     YVY+SPPPPVKHYSPP VYHSPPPPK  YVYKSP
Sbjct: 92  PPRKDYVYKSPPPPVKQYSSPPPNKYYVYQSPPPPVKHYSPPSVYHSPPPPKNQYVYKSP 151

Query: 263 PPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPPVKHY+ PPVYHS PPPKKHY+YK
Sbjct: 152 PPPVKHYT-PPVYHSGPPPKKHYMYK 176

[3][TOP]
>UniRef100_Q38913 Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=EXTN1_ARATH
          Length = 373

 Score =  218 bits (554), Expect = 2e-55
 Identities = 103/136 (75%), Positives = 104/136 (76%), Gaps = 24/136 (17%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY--- 163
           SPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY SPPPP K+Y   
Sbjct: 25  SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 84

Query: 164 ---------VYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYH 304
                    VYKSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY 
Sbjct: 85  PVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYK 144

Query: 305 SPPPPKKHY----VYK 340
           SPPPP KHY    VYK
Sbjct: 145 SPPPPVKHYSPPPVYK 160

 Score =  217 bits (553), Expect = 3e-55
 Identities = 103/137 (75%), Positives = 105/137 (76%), Gaps = 24/137 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY------------VYKSPPPPVKHYSPPPVYHSPP 145
           KSPPPPVKHYSPPPVY SPPPP K+Y            VYKSPPPPVKHYSPPPVY SPP
Sbjct: 56  KSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPP 115

Query: 146 PPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVY 301
           PP KHY    VYKSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVK+YSPPPVY
Sbjct: 116 PPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVY 175

Query: 302 HSPPPPKKHY----VYK 340
            SPPPP KHY    VYK
Sbjct: 176 KSPPPPVKHYSPPPVYK 192

 Score =  211 bits (536), Expect = 3e-53
 Identities = 102/137 (74%), Positives = 105/137 (76%), Gaps = 24/137 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPK--------KHY----VYKSPPPPVKHYSPPPVYHSPP 145
           KSPPPPVK+YSPPPVY SPPPP         KHY    VYKSPPPPVKHYSPPPVY SPP
Sbjct: 72  KSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 131

Query: 146 PPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVY 301
           PP KHY    VYKSPPPPVKHYSPPPVY SPPPP K+Y    VYKSPPPPVKHYSPPPVY
Sbjct: 132 PPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVKHYSPPPVY 191

Query: 302 HSPPPPKKHY----VYK 340
            SPPPP K+Y    VYK
Sbjct: 192 KSPPPPVKYYSPPPVYK 208

 Score =  194 bits (493), Expect = 3e-48
 Identities = 96/124 (77%), Positives = 99/124 (79%), Gaps = 14/124 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY-- 163
           KSPPPPVK+YSPPPVY SPPPP KHY    VYKSPPPPVK+YSPPPVY SPPPP KHY  
Sbjct: 160 KSPPPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVKHYSP 219

Query: 164 --VYKSPPPPVKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVKHYSPPP-VYHSPPPP 319
             VYKSPPPPVK+YSPPPVY SPPPP  HY     VY SPPPPV HYSPPP VYHSPPPP
Sbjct: 220 PPVYKSPPPPVKYYSPPPVYKSPPPP-VHYSPPPVVYHSPPPPV-HYSPPPVVYHSPPPP 277

Query: 320 KKHY 331
             HY
Sbjct: 278 -VHY 280

 Score =  190 bits (483), Expect = 4e-47
 Identities = 101/158 (63%), Positives = 103/158 (65%), Gaps = 45/158 (28%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY-- 163
           KSPPPPVKHYSPPPVY SPPPP K+Y    VYKSPPPPVKHYSPPPVY SPPPP K+Y  
Sbjct: 176 KSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSP 235

Query: 164 --VYKSPPPPVK---------------HYSPPPV-YHSPPPPKK---------------H 244
             VYKSPPPPV                HYSPPPV YHSPPPP                 H
Sbjct: 236 PPVYKSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVH 295

Query: 245 Y-----VYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYK 340
           Y     VY SPPPPV HYSPPPV YHSPPPPKKHY YK
Sbjct: 296 YSPPPVVYHSPPPPV-HYSPPPVVYHSPPPPKKHYEYK 332

 Score =  184 bits (466), Expect = 3e-45
 Identities = 97/151 (64%), Positives = 98/151 (64%), Gaps = 41/151 (27%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVK---------------HYSPP 124
           KSPPPPVKHYSPPPVY SPPPP K+Y    VYKSPPPPV                HYSPP
Sbjct: 208 KSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVHYSPPPVVYHSPPPPVHYSPP 267

Query: 125 PV-YHSPPPPKK---------------HY-----VYKSPPPPVKHYSPPPV-YHSPPPPK 238
           PV YHSPPPP                 HY     VY SPPPPV HYSPPPV YHSPPPPK
Sbjct: 268 PVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPV-HYSPPPVVYHSPPPPK 326

Query: 239 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           KHY YKSPPPPV HYSPP VYHSPPPP  HY
Sbjct: 327 KHYEYKSPPPPV-HYSPPTVYHSPPPPVHHY 356

 Score =  152 bits (385), Expect = 8e-36
 Identities = 83/116 (71%), Positives = 84/116 (72%), Gaps = 7/116 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV-YHSPPPPKKHY-----VYKSPPPPVKHYSPPPV-YHSPPPPKKHY 163
           SPPPPV HYSPPPV YHSPPPP  HY     VY SPPPPV HYSPPPV YHSPPPPKKHY
Sbjct: 273 SPPPPV-HYSPPPVVYHSPPPPV-HYSPPPVVYHSPPPPV-HYSPPPVVYHSPPPPKKHY 329

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
            YKSPPPPV HYSPP VYHSPPPP  HY   SPP        P +Y SPPPP  HY
Sbjct: 330 EYKSPPPPV-HYSPPTVYHSPPPPVHHY---SPP------HQPYLYKSPPPP--HY 373

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/69 (76%), Positives = 55/69 (79%), Gaps = 8/69 (11%)
 Frame = +2

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKK 325
           +Y Y SPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY SPPPP K
Sbjct: 20  NYFYSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVK 79

Query: 326 HY----VYK 340
           +Y    VYK
Sbjct: 80  YYSPPPVYK 88

[4][TOP]
>UniRef100_Q3ECC3 Putative uncharacterized protein At1g76930.1 n=1 Tax=Arabidopsis
           thaliana RepID=Q3ECC3_ARATH
          Length = 293

 Score =  217 bits (553), Expect = 3e-55
 Identities = 100/129 (77%), Positives = 101/129 (78%), Gaps = 20/129 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY--- 163
           SPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY SPPPP K+Y   
Sbjct: 29  SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 88

Query: 164 ---------VYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYH 304
                    VYKSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY 
Sbjct: 89  PVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYK 148

Query: 305 SPPPPKKHY 331
           SPPPP KHY
Sbjct: 149 SPPPPVKHY 157

 Score =  194 bits (492), Expect = 3e-48
 Identities = 92/120 (76%), Positives = 93/120 (77%), Gaps = 20/120 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPK----- 154
           KSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVK+YSPPPVY SPPPP      
Sbjct: 44  KSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPP 103

Query: 155 ---KHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVY 301
              KHY    VYKSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPP Y
Sbjct: 104 PPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPSY 163

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/69 (76%), Positives = 55/69 (79%), Gaps = 8/69 (11%)
 Frame = +2

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKK 325
           +Y Y SPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY SPPPP K
Sbjct: 24  NYFYSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVK 83

Query: 326 HY----VYK 340
           +Y    VYK
Sbjct: 84  YYSPPPVYK 92

[5][TOP]
>UniRef100_Q304C4 Putative uncharacterized protein At1g76930.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q304C4_ARATH
          Length = 256

 Score =  217 bits (553), Expect = 3e-55
 Identities = 100/129 (77%), Positives = 101/129 (78%), Gaps = 20/129 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY--- 163
           SPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY SPPPP K+Y   
Sbjct: 29  SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 88

Query: 164 ---------VYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYH 304
                    VYKSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY 
Sbjct: 89  PVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYK 148

Query: 305 SPPPPKKHY 331
           SPPPP KHY
Sbjct: 149 SPPPPVKHY 157

 Score =  194 bits (492), Expect = 3e-48
 Identities = 92/120 (76%), Positives = 93/120 (77%), Gaps = 20/120 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPK----- 154
           KSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVK+YSPPPVY SPPPP      
Sbjct: 44  KSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPP 103

Query: 155 ---KHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVY 301
              KHY    VYKSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPP Y
Sbjct: 104 PPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPSY 163

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/69 (76%), Positives = 55/69 (79%), Gaps = 8/69 (11%)
 Frame = +2

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKK 325
           +Y Y SPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY SPPPP K
Sbjct: 24  NYFYSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVK 83

Query: 326 HY----VYK 340
           +Y    VYK
Sbjct: 84  YYSPPPVYK 92

[6][TOP]
>UniRef100_Q38913-2 Isoform 2 of Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=Q38913-2
          Length = 246

 Score =  217 bits (553), Expect = 3e-55
 Identities = 100/129 (77%), Positives = 101/129 (78%), Gaps = 20/129 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY--- 163
           SPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY SPPPP K+Y   
Sbjct: 25  SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 84

Query: 164 ---------VYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYH 304
                    VYKSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY 
Sbjct: 85  PVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYK 144

Query: 305 SPPPPKKHY 331
           SPPPP KHY
Sbjct: 145 SPPPPVKHY 153

 Score =  209 bits (533), Expect = 6e-53
 Identities = 103/150 (68%), Positives = 104/150 (69%), Gaps = 37/150 (24%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY------------VYKSPPPPVKHYSPPPVYHSPP 145
           KSPPPPVKHYSPPPVY SPPPP K+Y            VYKSPPPPVKHYSPPPVY SPP
Sbjct: 56  KSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPP 115

Query: 146 PPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVK------- 277
           PP KHY    VYKSPPPPVKHYSPPPVY SPPPP KHY     VY SPPPPV        
Sbjct: 116 PPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVVYHSPPPPVHYSPPPVV 175

Query: 278 --------HYSPPPV-YHSPPPPKKHYVYK 340
                   HYSPPPV YHSPPPPKKHY YK
Sbjct: 176 YHSPPPPVHYSPPPVVYHSPPPPKKHYEYK 205

 Score =  206 bits (524), Expect = 6e-52
 Identities = 99/135 (73%), Positives = 99/135 (73%), Gaps = 25/135 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY-- 163
           KSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY SPPPP KHY  
Sbjct: 96  KSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 155

Query: 164 ---VYKSPPPPVK---------------HYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYS 286
              VY SPPPPV                HYSPPPV YHSPPPPKKHY YKSPPPPV HYS
Sbjct: 156 PPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPKKHYEYKSPPPPV-HYS 214

Query: 287 PPPVYHSPPPPKKHY 331
           PP VYHSPPPP  HY
Sbjct: 215 PPTVYHSPPPPVHHY 229

 Score =  166 bits (419), Expect = 1e-39
 Identities = 87/147 (59%), Positives = 88/147 (59%), Gaps = 37/147 (25%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPV------------- 130
           KSPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPV             
Sbjct: 112 KSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVVYHSPPPPVHYSP 171

Query: 131 --------------------YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 250
                               YHSPPPPKKHY YKSPPPPV HYSPP VYHSPPPP  HY 
Sbjct: 172 PPVVYHSPPPPVHYSPPPVVYHSPPPPKKHYEYKSPPPPV-HYSPPTVYHSPPPPVHHY- 229

Query: 251 YKSPPPPVKHYSPPPVYHSPPPPKKHY 331
             SPP        P +Y SPPPP  HY
Sbjct: 230 --SPP------HQPYLYKSPPPP--HY 246

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/69 (76%), Positives = 55/69 (79%), Gaps = 8/69 (11%)
 Frame = +2

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKK 325
           +Y Y SPPPPVKHYSPPPVY SPPPP KHY    VYKSPPPPVKHYSPPPVY SPPPP K
Sbjct: 20  NYFYSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVK 79

Query: 326 HY----VYK 340
           +Y    VYK
Sbjct: 80  YYSPPPVYK 88

[7][TOP]
>UniRef100_Q39949 Hydroxyproline-rich protein n=1 Tax=Helianthus annuus
           RepID=Q39949_HELAN
          Length = 263

 Score =  165 bits (417), Expect = 2e-39
 Identities = 80/113 (70%), Positives = 81/113 (71%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPV    PPPVY SPPPPKK YVYKSPPP      PPPV+ SPPPP    VYKSPP
Sbjct: 80  KSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPP------PPPVHKSPPPP----VYKSPP 129

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPV    PPPVY SPPPP    VYKSPPPPV    PPPVY SPPPPKK YVYK
Sbjct: 130 PPVYESPPPPVYKSPPPP----VYKSPPPPVHKSPPPPVYKSPPPPKKPYVYK 178

 Score =  160 bits (406), Expect = 3e-38
 Identities = 82/119 (68%), Positives = 82/119 (68%), Gaps = 6/119 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS-- 175
           KSPPPPV    PPPVY SPPPP    VYKSPPPPV    PPPVY SPPPPKK YVYKS  
Sbjct: 126 KSPPPPVYESPPPPVYKSPPPP----VYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPP 181

Query: 176 PPPPVKHYSPPPVYHSPPPP----KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PPPPV    PPPVY SP PP      H VYKSP P   H SPPPVY SPPPPKK YVYK
Sbjct: 182 PPPPVHKSPPPPVYKSPTPPVHKSPPHPVYKSPLP--VHKSPPPVYKSPPPPKKPYVYK 238

 Score =  145 bits (367), Expect = 1e-33
 Identities = 73/112 (65%), Positives = 76/112 (67%), Gaps = 7/112 (6%)
 Frame = +2

Query: 5   SPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPKKHYVY 169
           SP     HYS    PPP    PPPPK+ YVYKSPPPP  + SPPP VY SPPPP    V+
Sbjct: 24  SPTTATYHYSSPPPPPPKKSPPPPPKQQYVYKSPPPPPVYKSPPPPVYKSPPPP----VH 79

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKS--PPPPVKHYSPPPVYHSPPPP 319
           KSPPPPV    PPPVY SPPPPKK YVYKS  PPPPV    PPPVY SPPPP
Sbjct: 80  KSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPPPP 131

 Score =  121 bits (303), Expect = 3e-26
 Identities = 60/96 (62%), Positives = 63/96 (65%), Gaps = 1/96 (1%)
 Frame = +2

Query: 56  PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-PPPVYHSPPP 232
           P P    Y Y SPPP      PPP    PPPPK+ YVYKSPPPP  + S PPPVY SPPP
Sbjct: 23  PSPTTATYHYSSPPP------PPPKKSPPPPPKQQYVYKSPPPPPVYKSPPPPVYKSPPP 76

Query: 233 PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           P    V+KSPPPPV    PPPVY SPPPPKK YVYK
Sbjct: 77  P----VHKSPPPPVHKSPPPPVYKSPPPPKKPYVYK 108

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 42/71 (59%), Positives = 44/71 (61%), Gaps = 6/71 (8%)
 Frame = +2

Query: 2   KSPPPPVK------HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPP PV       H SPPPVY SPPPPKK YVYKSPPPPVK + PP           HY
Sbjct: 204 KSPPHPVYKSPLPVHKSPPPVYKSPPPPKKPYVYKSPPPPVKKHPPP-----------HY 252

Query: 164 VYKSPPPPVKH 196
           +Y SPPPP  H
Sbjct: 253 IYSSPPPPYHH 263

[8][TOP]
>UniRef100_Q9ZW80 Putative extensin n=1 Tax=Arabidopsis thaliana RepID=Q9ZW80_ARATH
          Length = 212

 Score =  152 bits (383), Expect = 1e-35
 Identities = 76/120 (63%), Positives = 76/120 (63%), Gaps = 12/120 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPPVK   PP  YHSPPPP K     YVY SPPPPVK   PP  YHSPPPP K    
Sbjct: 59  KSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPP 118

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            Y Y SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K
Sbjct: 119 PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 178

 Score =  148 bits (374), Expect = 2e-34
 Identities = 73/115 (63%), Positives = 75/115 (65%), Gaps = 8/115 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP ++ SPPP   SPPPP   Y YKSPPPPVK   PP  YHSPPPP K     YVY 
Sbjct: 35  SPPPPYEYKSPPPPVKSPPPP---YEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYS 91

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K
Sbjct: 92  SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 146

 Score =  144 bits (363), Expect = 3e-33
 Identities = 74/120 (61%), Positives = 74/120 (61%), Gaps = 12/120 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPPVK   PP  Y SPPPP K     Y Y SPPPPVK   PP VY SPPPP K    
Sbjct: 43  KSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPP 102

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            Y Y SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K
Sbjct: 103 PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 162

 Score =  144 bits (362), Expect = 4e-33
 Identities = 74/122 (60%), Positives = 77/122 (63%), Gaps = 13/122 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 160
           SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K     
Sbjct: 92  SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 151

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVY-HSPPPPKK 325
           Y Y SPPPPVK   PP  YHSPPPP K     Y+Y SPPPPVK   PPPVY ++ PPP  
Sbjct: 152 YYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKS-PPPPVYIYASPPPPT 210

Query: 326 HY 331
           HY
Sbjct: 211 HY 212

 Score =  118 bits (295), Expect = 2e-25
 Identities = 56/87 (64%), Positives = 58/87 (66%), Gaps = 4/87 (4%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 244
           Y Y SPPPP ++ SPPP   SPPPP   Y YKSPPPPVK   PP  YHSPPPP K     
Sbjct: 31  YYYSSPPPPYEYKSPPPPVKSPPPP---YEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPP 87

Query: 245 YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           YVY SPPPPVK   PP  YHSPPPP K
Sbjct: 88  YVYSSPPPPVKSPPPPYYYHSPPPPVK 114

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 38/66 (57%), Positives = 42/66 (63%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  ++SPPP   SPPPP   Y+Y SPPPPVK         SPPPP   Y+Y SPP
Sbjct: 162 KSPPPPYYYHSPPPPVKSPPPP---YLYSSPPPPVK---------SPPPPV--YIYASPP 207

Query: 182 PPVKHY 199
           PP  HY
Sbjct: 208 PPT-HY 212

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/61 (57%), Positives = 36/61 (59%), Gaps = 10/61 (16%)
 Frame = +2

Query: 185 PVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YV 334
           P  + SPPP Y   SPPPP K     Y YKSPPPPVK   PP  YHSPPPP K     YV
Sbjct: 30  PYYYSSPPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYV 89

Query: 335 Y 337
           Y
Sbjct: 90  Y 90

[9][TOP]
>UniRef100_Q9M564 CRANTZ hydroxyproline-rich glycoprotein n=1 Tax=Manihot esculenta
           RepID=Q9M564_MANES
          Length = 232

 Score =  147 bits (372), Expect = 3e-34
 Identities = 74/119 (62%), Positives = 74/119 (62%), Gaps = 12/119 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 160
           SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K     
Sbjct: 102 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 161

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           Y Y SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K
Sbjct: 162 YYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 220

 Score =  146 bits (369), Expect = 6e-34
 Identities = 72/116 (62%), Positives = 74/116 (63%), Gaps = 8/116 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVY 169
           KSPPPP  ++SPPP   SPPPP   Y Y SPPPPVK   PP  YHSPPPP K     Y Y
Sbjct: 60  KSPPPPYYYHSPPPPVKSPPPP---YYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYY 116

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K
Sbjct: 117 HSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 172

 Score =  145 bits (365), Expect = 2e-33
 Identities = 73/120 (60%), Positives = 73/120 (60%), Gaps = 12/120 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K    
Sbjct: 37  KSPPPPSPSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPP 96

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            Y Y SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K
Sbjct: 97  PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 156

 Score =  142 bits (358), Expect = 1e-32
 Identities = 71/115 (61%), Positives = 72/115 (62%), Gaps = 8/115 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y Y SPPPPVK   PP  YHSPPPP K     Y Y 
Sbjct: 29  SPPPPYYYKSPPPPSPSPPPP---YYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYH 85

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K
Sbjct: 86  SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 140

 Score =  140 bits (352), Expect = 6e-32
 Identities = 70/115 (60%), Positives = 71/115 (61%), Gaps = 8/115 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  YHSPPPP K     Y Y 
Sbjct: 13  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYHSPPPPVKSPPPPYYYH 69

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K
Sbjct: 70  SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 124

 Score =  139 bits (351), Expect = 7e-32
 Identities = 77/135 (57%), Positives = 78/135 (57%), Gaps = 28/135 (20%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 160
           SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K     
Sbjct: 54  SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 113

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVK------HY-SPPP---- 295
           Y Y SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK      +Y SPPP    
Sbjct: 114 YYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKS 173

Query: 296 -----VYHSPPPPKK 325
                 YHSPPPP K
Sbjct: 174 PPPPYYYHSPPPPVK 188

 Score =  139 bits (351), Expect = 7e-32
 Identities = 77/135 (57%), Positives = 78/135 (57%), Gaps = 28/135 (20%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 160
           SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K     
Sbjct: 70  SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 129

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVK------HY-SPPP---- 295
           Y Y SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK      +Y SPPP    
Sbjct: 130 YYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKS 189

Query: 296 -----VYHSPPPPKK 325
                 YHSPPPP K
Sbjct: 190 PPPPYYYHSPPPPVK 204

 Score =  133 bits (335), Expect = 5e-30
 Identities = 69/111 (62%), Positives = 69/111 (62%), Gaps = 12/111 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 160
           SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K     
Sbjct: 118 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 177

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVY 301
           Y Y SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PPPVY
Sbjct: 178 YYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKS-PPPPVY 227

 Score =  124 bits (310), Expect = 4e-27
 Identities = 63/104 (60%), Positives = 64/104 (61%), Gaps = 8/104 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 160
           SPPPPVK   PP  YHSPPPP K     Y Y SPPPPVK   PP  YHSPPPP K     
Sbjct: 134 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 193

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 292
           Y Y SPPPPVK   PP  YHSPPPP      KSPPPPV  Y+ P
Sbjct: 194 YYYHSPPPPVKSPPPPYYYHSPPPP-----VKSPPPPVYIYASP 232

 Score =  107 bits (268), Expect = 3e-22
 Identities = 52/87 (59%), Positives = 57/87 (65%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  ++SPPP   SPPPP   Y Y SPPPPVK   PP  YHSPPPP      KSPP
Sbjct: 156 KSPPPPYYYHSPPPPVKSPPPP---YYYHSPPPPVKSPPPPYYYHSPPPP-----VKSPP 207

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSP 262
           PP  ++SPPP   SPPPP   Y+Y SP
Sbjct: 208 PPYYYHSPPPPVKSPPPPV--YIYASP 232

 Score =  105 bits (262), Expect = 2e-21
 Identities = 53/92 (57%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +2

Query: 62  PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 241
           P  K     SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  YHSPPPP K
Sbjct: 4   PAAKLKTSPSPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYHSPPPPVK 60

Query: 242 H----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
                Y Y SPPPPVK   PP  YHSPPPP K
Sbjct: 61  SPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 92

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 29/64 (45%), Positives = 32/64 (50%)
 Frame = +2

Query: 146 PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           P  K     SPPPP  + SPPP   SPPPP   Y YKSPPPP           SP PP  
Sbjct: 4   PAAKLKTSPSPPPPYYYKSPPPPSPSPPPP---YYYKSPPPP-----------SPSPPPP 49

Query: 326 HYVY 337
           +Y +
Sbjct: 50  YYYH 53

[10][TOP]
>UniRef100_Q09082 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q09082_SOLLC
          Length = 388

 Score =  147 bits (371), Expect = 4e-34
 Identities = 82/137 (59%), Positives = 82/137 (59%), Gaps = 24/137 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY---SPPP-----VYHSPPPPKK 157
           KSPPPP    SP  VY SPPPP   YVYKSPPPP   Y   SPPP     VY SPPPP  
Sbjct: 13  KSPPPP----SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSP 68

Query: 158 HYVYKSPPPPVKHY---SPPP-----VYHSPPPPKKHYVYKSPPPPVKHY---SPPP--- 295
            YVYKSPPPP   Y   SPPP     VY SPPPP   YVYKSPPPP   Y   SPPP   
Sbjct: 69  KYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSP 128

Query: 296 --VYHSPPPPKKHYVYK 340
             VY SPPPP   YVYK
Sbjct: 129 KYVYKSPPPPSPKYVYK 145

 Score =  147 bits (371), Expect = 4e-34
 Identities = 82/137 (59%), Positives = 82/137 (59%), Gaps = 24/137 (17%)
 Frame = +2

Query: 2   KSPPPPVKHY---SPPP-----VYHSPPPPKKHYVYKSPPPPVKHY---SPPP-----VY 133
           KSPPPP   Y   SPPP     VY SPPPP   YVYKSPPPP   Y   SPPP     VY
Sbjct: 109 KSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVY 168

Query: 134 HSPPPPKKHYVYKSPPPPVKHY---SPPP-----VYHSPPPPKKHYVYKSPPPPVKHYSP 289
            SPPPP   YVYKSPPPP   Y   SPPP     VY SPPPP   YVYKSPPPP    SP
Sbjct: 169 KSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP----SP 224

Query: 290 PPVYHSPPPPKKHYVYK 340
             VY SPPPP   YVYK
Sbjct: 225 KYVYKSPPPPSPKYVYK 241

 Score =  143 bits (360), Expect = 7e-33
 Identities = 86/146 (58%), Positives = 86/146 (58%), Gaps = 33/146 (22%)
 Frame = +2

Query: 2   KSPPPPVKHY---SPPP-----VYHSPPPPK-KHYVYKSPPPPVKHY---SPPP-----V 130
           KSPPPP   Y   SPPP     VY SPPPP  K YVYKSPPPP   Y   SPPP     V
Sbjct: 73  KSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPK-YVYKSPPPPSPKYVYKSPPPPSPKYV 131

Query: 131 YHSPPPPKKHYVYKSPPPPVKHY---SPPP-----VYHSPPPPKKHYVYKSPPPPVKHY- 283
           Y SPPPP   YVYKSPPPP   Y   SPPP     VY SPPPP   YVYKSPPPP   Y 
Sbjct: 132 YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYV 191

Query: 284 --SPPP-----VYHSPPPPKKHYVYK 340
             SPPP     VY SPPPP   YVYK
Sbjct: 192 YKSPPPPSPKYVYKSPPPPSPKYVYK 217

 Score =  139 bits (351), Expect = 7e-32
 Identities = 82/151 (54%), Positives = 84/151 (55%), Gaps = 38/151 (25%)
 Frame = +2

Query: 2   KSPPPPVKHY---SPPP-----VYHSPPPPKKHYVYKSPPPPVKHY---SPPP-----VY 133
           KSPPPP   Y   SPPP     VY SPPPP   YVYKSPPPP   Y   SPPP     VY
Sbjct: 133 KSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVY 192

Query: 134 HSPPPPKKHYVYKSPPPPVKHY---SPPP-----VYHSPPPPKKHYVYKSPPPPVKHYS- 286
            SPPPP   YVYKSPPPP   Y   SPPP     VY SPPPP   YVYKSPPPP  +Y  
Sbjct: 193 KSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKS 252

Query: 287 --------PPPVYH-SPPPPKKH----YVYK 340
                   PPP Y+ SPPPP       Y YK
Sbjct: 253 PPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 283

 Score =  137 bits (346), Expect = 3e-31
 Identities = 77/137 (56%), Positives = 78/137 (56%), Gaps = 24/137 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY---SPPP-----VYHSPPPPKK 157
           K  P P  +Y     Y SPPPP   YVYKSPPPP   Y   SPPP     VY SPPPP  
Sbjct: 2   KPKPTPTPYY-----YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSP 56

Query: 158 HYVYKSPPPPVKHY---SPPP-----VYHSPPPPKKHYVYKSPPPPVKHY---SPPP--- 295
            YVYKSPPPP   Y   SPPP     VY SPPPP   YVYKSPPPP   Y   SPPP   
Sbjct: 57  KYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSP 116

Query: 296 --VYHSPPPPKKHYVYK 340
             VY SPPPP   YVYK
Sbjct: 117 KYVYKSPPPPSPKYVYK 133

 Score =  127 bits (319), Expect = 4e-28
 Identities = 71/130 (54%), Positives = 72/130 (55%), Gaps = 17/130 (13%)
 Frame = +2

Query: 2   KSPPPPVKHY---SPPP-----VYHSPPPPKKHYVYKSPPPPVKHY-SPPPVYHSPPPPK 154
           KSPPPP   Y   SPPP     VY SPPPP   YVYKSPPPP  +Y SPPP   SPPPP 
Sbjct: 205 KSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPPPPSPSPPPP- 263

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPK 322
             Y YKSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y  PPPP 
Sbjct: 264 --YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKCPPPPS 321

Query: 323 KH----YVYK 340
                 Y YK
Sbjct: 322 PSPPPPYYYK 331

 Score =  123 bits (308), Expect = 7e-27
 Identities = 67/120 (55%), Positives = 69/120 (57%), Gaps = 11/120 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y  PPPP       Y YK
Sbjct: 275 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKCPPPPSPSPPPPYYYK 331

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPP---VYHSPPPPKKHY 331
           SPPPP     PP  YHSPPPP       Y Y SPPPPVK  SPPP   +Y SPPPP  HY
Sbjct: 332 SPPPPSPSPPPPYYYHSPPPPVNSPPPPYYYSSPPPPVK--SPPPPVYIYGSPPPP-VHY 388

 Score =  122 bits (307), Expect = 9e-27
 Identities = 64/115 (55%), Positives = 65/115 (56%), Gaps = 9/115 (7%)
 Frame = +2

Query: 2   KSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YV 166
           KSPPPP  +Y SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       Y 
Sbjct: 241 KSPPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY 297

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
           YKSPPPP     PP  Y  PPPP       Y YKSPPPP     PP  YHSPPPP
Sbjct: 298 YKSPPPPSPSPPPPYYYKCPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPP 352

 Score =  120 bits (301), Expect = 5e-26
 Identities = 62/115 (53%), Positives = 63/115 (54%), Gaps = 8/115 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       Y YK
Sbjct: 259 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 315

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            PPPP     PP  Y SPPPP       Y Y SPPPPV    PP  Y SPPPP K
Sbjct: 316 CPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPVNSPPPPYYYSSPPPPVK 370

[11][TOP]
>UniRef100_Q40502 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40502_TOBAC
          Length = 280

 Score =  146 bits (369), Expect = 6e-34
 Identities = 82/128 (64%), Positives = 84/128 (65%), Gaps = 18/128 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKK 157
           KSPPPP K Y PP  PVY SPPPPKK Y      VYKSPPPP       PVY SPPPPKK
Sbjct: 85  KSPPPPKKPYYPPHPPVYKSPPPPKKPYSLPHTPVYKSPPPPT------PVYKSPPPPKK 138

Query: 158 -HY-----VYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHS 307
            HY     +YKSPPPP K Y PP  PVY SPPPP    VYKSPPPP K + PP  PVY S
Sbjct: 139 PHYPPHTPIYKSPPPPNKPYYPPHTPVYKSPPPPTP--VYKSPPPPKKPHYPPHTPVYKS 196

Query: 308 PPPPKKHY 331
           PPPPKK Y
Sbjct: 197 PPPPKKPY 204

 Score =  144 bits (363), Expect = 3e-33
 Identities = 88/151 (58%), Positives = 89/151 (58%), Gaps = 41/151 (27%)
 Frame = +2

Query: 2   KSPPPPVKHY-SPP--PVYHSPPPPKKHY-----------VYKSPPPPVKHYSPP--PVY 133
           KSPPPPV  Y SPP  PVY SPPPPKK Y           VYKSPPPP K Y PP  PVY
Sbjct: 43  KSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPVY 102

Query: 134 HSPPPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKK-HY-----VYKSPPPPVK 277
            SPPPPKK Y      VYKSPPPP       PVY SPPPPKK HY     +YKSPPPP K
Sbjct: 103 KSPPPPKKPYSLPHTPVYKSPPPPT------PVYKSPPPPKKPHYPPHTPIYKSPPPPNK 156

Query: 278 HYSPP------------PVYHSPPPPKK-HY 331
            Y PP            PVY SPPPPKK HY
Sbjct: 157 PYYPPHTPVYKSPPPPTPVYKSPPPPKKPHY 187

 Score =  140 bits (354), Expect = 3e-32
 Identities = 85/150 (56%), Positives = 86/150 (57%), Gaps = 40/150 (26%)
 Frame = +2

Query: 2   KSPPPPVKHYS------------PPPVYHSPPPPKK-HY-----VYKSPPPPVKHYSPP- 124
           KSPPPP K YS            P PVY SPPPPKK HY     +YKSPPPP K Y PP 
Sbjct: 103 KSPPPPKKPYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYPPH 162

Query: 125 -----------PVYHSPPPPKK-HY-----VYKSPPPPVKHYSPP--PVYHSPPPPKKHY 247
                      PVY SPPPPKK HY     VYKSPPPP K Y PP  PVY SPPPP    
Sbjct: 163 TPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTP-- 220

Query: 248 VYKSPPPPVKHYSPP--PVYHSPPPPKKHY 331
           VYKSPPP  K Y PP  PVY SPPPP   Y
Sbjct: 221 VYKSPPPSKKPYYPPHTPVYKSPPPPTPVY 250

 Score =  135 bits (340), Expect = 1e-30
 Identities = 83/137 (60%), Positives = 83/137 (60%), Gaps = 27/137 (19%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP------------PVYHSPPPPKK-HY-----VYKSPPPPVKHYSPP- 124
           KSPPPP K Y PP            PVY SPPPPKK HY     VYKSPPPP K Y PP 
Sbjct: 149 KSPPPPNKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPH 208

Query: 125 -PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHY-SPP 292
            PVY SPPPP    VYKSPPP  K Y PP  PVY SPPPP    VYKSPPPP   Y SPP
Sbjct: 209 TPVYKSPPPPTP--VYKSPPPSKKPYYPPHTPVYKSPPPPTP--VYKSPPPPTPVYKSPP 264

Query: 293 P----VYHSPPPPKKHY 331
           P    VY SPPPP  HY
Sbjct: 265 PHHPYVYASPPPP-YHY 280

 Score =  133 bits (335), Expect = 5e-30
 Identities = 75/118 (63%), Positives = 76/118 (64%), Gaps = 23/118 (19%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHY-SPP--PVYHSPPPPKKHY-----------VYKSPPP 184
           Y SPPPPKK Y+YKSPPPPV  Y SPP  PVY SPPPPKK Y           VYKSPPP
Sbjct: 30  YSSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKSPPP 89

Query: 185 PVKHYSPP--PVYHSPPPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKK-HY 331
           P K Y PP  PVY SPPPPKK Y      VYKSPPPP       PVY SPPPPKK HY
Sbjct: 90  PKKPYYPPHPPVYKSPPPPKKPYSLPHTPVYKSPPPPT------PVYKSPPPPKKPHY 141

 Score =  110 bits (276), Expect = 4e-23
 Identities = 66/132 (50%), Positives = 69/132 (52%), Gaps = 46/132 (34%)
 Frame = +2

Query: 74  HYVYKSPPPPVKHY---SPP------------PVYHSPPPPKKHY-----------VYKS 175
           +Y Y SPPPP K Y   SPP            PVY SPPPPKK Y           VYKS
Sbjct: 27  NYQYSSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKS 86

Query: 176 PPPPVKHYSP--PPVYHSPPPPKKHY----------------VYKSPPPPVKHYSPP--P 295
           PPPP K Y P  PPVY SPPPPKK Y                VYKSPPPP K + PP  P
Sbjct: 87  PPPPKKPYYPPHPPVYKSPPPPKKPYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTP 146

Query: 296 VYHSPPPPKKHY 331
           +Y SPPPP K Y
Sbjct: 147 IYKSPPPPNKPY 158

[12][TOP]
>UniRef100_Q06802 Extensin n=1 Tax=Nicotiana tabacum RepID=Q06802_TOBAC
          Length = 318

 Score =  146 bits (369), Expect = 6e-34
 Identities = 83/134 (61%), Positives = 83/134 (61%), Gaps = 24/134 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP------------PVYHSPPPPKKHY------VYKSPPPPVKHYSPP- 124
           KSPPPP K Y PP            PVY SPPPPKK Y      VYKSPPPP K Y PP 
Sbjct: 62  KSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPKKPYYPPH 121

Query: 125 -PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP- 292
            PVY SPPPP    VYKSPPPP K Y PP  PVY SPPPP    VYKSPPP  K Y PP 
Sbjct: 122 TPVYKSPPPPTP--VYKSPPPPKKPYYPPHTPVYKSPPPPTP--VYKSPPPHKKPYYPPH 177

Query: 293 -PVYHSPPPPKKHY 331
            PVY SPPPPKK Y
Sbjct: 178 TPVYKSPPPPKKPY 191

 Score =  144 bits (362), Expect = 4e-33
 Identities = 86/160 (53%), Positives = 86/160 (53%), Gaps = 50/160 (31%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHY----------------VYKSPPPPVKHYSPP- 124
           KSPPPP K Y PP  PVY SPPPPKK Y                VYKSPPPP K Y PP 
Sbjct: 90  KSPPPPKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPH 149

Query: 125 -----------PVYHSPPPPKKHY------VYKSPPPPVKHYSPP--PVYHSPPPPKKHY 247
                      PVY SPPP KK Y      VYKSPPPP K Y PP  PVY SPPPP    
Sbjct: 150 TPVYKSPPPPTPVYKSPPPHKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTP-- 207

Query: 248 VYKSPPPPVKHYSPP------------PVYHSPPPPKKHY 331
           VYKSPPPP K Y PP            PVY SPPPPKK Y
Sbjct: 208 VYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPY 247

 Score =  142 bits (359), Expect = 9e-33
 Identities = 83/144 (57%), Positives = 83/144 (57%), Gaps = 34/144 (23%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP------------PVYHSPPPPKKHY------VYKSPPPPVKHYSPP- 124
           KSPPPP K Y PP            PVY SPPP KK Y      VYKSPPPP K Y PP 
Sbjct: 136 KSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPHKKPYYPPHTPVYKSPPPPKKPYYPPH 195

Query: 125 -PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP- 292
            PVY SPPPP    VYKSPPPP K Y PP  PVY SPPPP    VYKSPPPP K Y PP 
Sbjct: 196 TPVYKSPPPPTP--VYKSPPPPKKPYYPPHTPVYKSPPPPTP--VYKSPPPPKKPYYPPY 251

Query: 293 -----------PVYHSPPPPKKHY 331
                      PVY SPPPPKK Y
Sbjct: 252 TPVYKSPPPPTPVYKSPPPPKKPY 275

 Score =  142 bits (357), Expect = 1e-32
 Identities = 82/129 (63%), Positives = 82/129 (63%), Gaps = 19/129 (14%)
 Frame = +2

Query: 2   KSPPPPVKHY-SPP--PVYHSPPPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPK 154
           KSPPPPV  Y SPP  PVY SPPPPKK Y      VYKSPPPP       PVY SPPPPK
Sbjct: 43  KSPPPPVHVYPSPPHHPVYKSPPPPKKPYYPPHTPVYKSPPPPT------PVYKSPPPPK 96

Query: 155 KHY------VYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYH 304
           K Y      VYKSPPPP K Y PP  PVY SPPPP    VYKSPPPP K Y PP  PVY 
Sbjct: 97  KPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTP--VYKSPPPPKKPYYPPHTPVYK 154

Query: 305 SPPPPKKHY 331
           SPPPP   Y
Sbjct: 155 SPPPPTPVY 163

 Score =  139 bits (350), Expect = 1e-31
 Identities = 78/123 (63%), Positives = 78/123 (63%), Gaps = 13/123 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVY 169
           KSPPPP K Y PP  PVY SPPPP    VYKSPPPP K Y PP  PVY SPPPP    VY
Sbjct: 182 KSPPPPKKPYYPPHTPVYKSPPPPTP--VYKSPPPPKKPYYPPHTPVYKSPPPPTP--VY 237

Query: 170 KSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVK-------HYSPPPVYHSPPPPK 322
           KSPPPP K Y PP  PVY SPPPP    VYKSPPPP K        Y P PVY SPPPP 
Sbjct: 238 KSPPPPKKPYYPPYTPVYKSPPPPTP--VYKSPPPPKKPYYPSPTPYHPAPVYKSPPPPT 295

Query: 323 KHY 331
             Y
Sbjct: 296 PVY 298

 Score =  132 bits (333), Expect = 9e-30
 Identities = 74/122 (60%), Positives = 75/122 (61%), Gaps = 27/122 (22%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHY-SPP--PVYHSPPPPKKHY------VYKSPPPPVKHY 199
           Y SPPPPKK Y+YKSPPPPV  Y SPP  PVY SPPPPKK Y      VYKSPPPP    
Sbjct: 30  YSSPPPPKKSYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYYPPHTPVYKSPPPPT--- 86

Query: 200 SPPPVYHSPPPPKKHY------VYKSPPPPVKHYSPP------------PVYHSPPPPKK 325
              PVY SPPPPKK Y      VYKSPPPP K Y PP            PVY SPPPPKK
Sbjct: 87  ---PVYKSPPPPKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKK 143

Query: 326 HY 331
            Y
Sbjct: 144 PY 145

 Score =  122 bits (306), Expect = 1e-26
 Identities = 70/114 (61%), Positives = 71/114 (62%), Gaps = 13/114 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVY 169
           KSPPPP K Y PP  PVY SPPPP    VYKSPPPP K Y PP  PVY SPPPP    VY
Sbjct: 210 KSPPPPKKPYYPPHTPVYKSPPPPTP--VYKSPPPPKKPYYPPYTPVYKSPPPPTP--VY 265

Query: 170 KSPPPPVKHY-------SPPPVYHSPPPPKKHYVYKSPPP--PVKHYSPPPVYH 304
           KSPPPP K Y        P PVY SPPPP    VYKSPPP  P  + SPP  YH
Sbjct: 266 KSPPPPKKPYYPSPTPYHPAPVYKSPPPPTP--VYKSPPPHHPYVYASPPSPYH 317

 Score =  115 bits (289), Expect = 1e-24
 Identities = 60/93 (64%), Positives = 61/93 (65%), Gaps = 7/93 (7%)
 Frame = +2

Query: 74  HYVYKSPPPPVKHY---SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPK 238
           +Y Y SPPPP K Y   SPPP  H  P P  H VYKSPPPP K Y PP  PVY SPPPP 
Sbjct: 27  NYQYSSPPPPKKSYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYYPPHTPVYKSPPPPT 86

Query: 239 KHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHY 331
              VYKSPPPP K Y PP  PVY SPPPPKK Y
Sbjct: 87  P--VYKSPPPPKKPYYPPHTPVYKSPPPPKKPY 117

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 31/44 (70%), Positives = 32/44 (72%), Gaps = 3/44 (6%)
 Frame = +2

Query: 215 YHSPPPPKKHYVYKSPPPPVKHY-SPP--PVYHSPPPPKKHYVY 337
           Y SPPPPKK Y+YKSPPPPV  Y SPP  PVY SPPPP K   Y
Sbjct: 30  YSSPPPPKKSYLYKSPPPPVHVYPSPPHHPVYKSPPPP-KKPYY 72

[13][TOP]
>UniRef100_C3VPW8 Extensin n=1 Tax=Lithospermum erythrorhizon RepID=C3VPW8_LITER
          Length = 247

 Score =  145 bits (366), Expect = 1e-33
 Identities = 67/106 (63%), Positives = 77/106 (72%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP+    PPPVY SPPPP    ++KSPPPP K+  PPPVY SPPPP    ++KSPP
Sbjct: 64  KSPPPPMHKSPPPPVYKSPPPP----MHKSPPPPKKYSPPPPVYKSPPPP----MHKSPP 115

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP K+  PPPVY SPPPP    ++KSPPPP K+  PPPVY SPPPP
Sbjct: 116 PPKKYSPPPPVYKSPPPP----MHKSPPPPKKYSPPPPVYKSPPPP 157

 Score =  144 bits (363), Expect = 3e-33
 Identities = 71/117 (60%), Positives = 82/117 (70%), Gaps = 8/117 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP K+  PPPVY SPPPP    ++KSPPPP K+  PPPVY SPPPP    ++KSPP
Sbjct: 88  KSPPPPKKYSPPPPVYKSPPPP----MHKSPPPPKKYSPPPPVYKSPPPP----MHKSPP 139

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY-------H-SPPPPKKH 328
           PP K+  PPPVY SPPPP    ++KSPPPP K+  PPPVY       H SPPPPKK+
Sbjct: 140 PPKKYSPPPPVYKSPPPP----MHKSPPPPKKYSPPPPVYKSPPPPMHKSPPPPKKY 192

 Score =  144 bits (362), Expect = 4e-33
 Identities = 68/118 (57%), Positives = 80/118 (67%), Gaps = 12/118 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY------------VYKSPPPPVKHYSPPPVYHSPP 145
           KSPPPPV    PPP++ SPPPPKK+             ++KSPPPP K+  PPPVY SPP
Sbjct: 72  KSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPP 131

Query: 146 PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP    ++KSPPPP K+  PPPVY SPPPP    ++KSPPPP K+  PPPVY SPPPP
Sbjct: 132 PP----MHKSPPPPKKYSPPPPVYKSPPPP----MHKSPPPPKKYSPPPPVYKSPPPP 181

 Score =  143 bits (360), Expect = 7e-33
 Identities = 68/109 (62%), Positives = 77/109 (70%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP K+  PPPVY SPPPP    ++KSPPPP K+  PPPVY SPPPP    ++KSPP
Sbjct: 112 KSPPPPKKYSPPPPVYKSPPPP----MHKSPPPPKKYSPPPPVYKSPPPP----MHKSPP 163

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PP K+  PPPVY SPPPP    ++KSPPPP K YSPPP  H PPP   H
Sbjct: 164 PPKKYSPPPPVYKSPPPP----MHKSPPPP-KKYSPPPPVHKPPPHWSH 207

 Score =  139 bits (349), Expect = 1e-31
 Identities = 67/107 (62%), Positives = 75/107 (70%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH--SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           SPPPP K+  PP  YH  SPPPP    VYKSPPPP+    PPPVY SPPPP    ++KSP
Sbjct: 39  SPPPPKKYSPPPHHYHHKSPPPP----VYKSPPPPMHKSPPPPVYKSPPPP----MHKSP 90

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPP K+  PPPVY SPPPP    ++KSPPPP K+  PPPVY SPPPP
Sbjct: 91  PPPKKYSPPPPVYKSPPPP----MHKSPPPPKKYSPPPPVYKSPPPP 133

 Score =  123 bits (308), Expect = 7e-27
 Identities = 60/100 (60%), Positives = 68/100 (68%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP K+  PPPVY SPPPP    ++KSPPPP K+  PPPVY SPPPP    ++KSPP
Sbjct: 136 KSPPPPKKYSPPPPVYKSPPPP----MHKSPPPPKKYSPPPPVYKSPPPP----MHKSPP 187

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 301
           PP K YSPPP  H PPP   H+ +K  PPP  H SPP  Y
Sbjct: 188 PP-KKYSPPPPVHKPPP---HWSHKYSPPPPVHKSPPHHY 223

 Score =  110 bits (275), Expect = 5e-23
 Identities = 53/90 (58%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +2

Query: 56  PPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 229
           P     +Y Y SPPPP K+  PP  YH  SPPPP    VYKSPPPP+    PPPVY SPP
Sbjct: 28  PSETSANYKYSSPPPPKKYSPPPHHYHHKSPPPP----VYKSPPPPMHKSPPPPVYKSPP 83

Query: 230 PPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP    ++KSPPPP K+  PPPVY SPPPP
Sbjct: 84  PP----MHKSPPPPKKYSPPPPVYKSPPPP 109

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 32/67 (47%), Positives = 36/67 (53%)
 Frame = +2

Query: 140 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     +Y Y SPPPP K           PPP  HY +KSPPPPV    PPP++ SPPPP
Sbjct: 28  PSETSANYKYSSPPPPKK---------YSPPP-HHYHHKSPPPPVYKSPPPPMHKSPPPP 77

Query: 320 KKHYVYK 340
               VYK
Sbjct: 78  ----VYK 80

[14][TOP]
>UniRef100_Q39600 Extensin n=1 Tax=Catharanthus roseus RepID=Q39600_CATRO
          Length = 217

 Score =  144 bits (364), Expect = 2e-33
 Identities = 81/136 (59%), Positives = 83/136 (61%), Gaps = 23/136 (16%)
 Frame = +2

Query: 2   KSPPPPVK-HYSPPP---VYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYHSPPPPKKHYV 166
           KSPPPP   H SPPP   VY SPPPP   Y YKSPPPP   H  PP +Y SPPPP    +
Sbjct: 55  KSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPP--I 112

Query: 167 YKSPPPPVKHYSPPP----VYHSPPPP------------KKHYVYKSPPPP--VKHYSPP 292
           YKSPPPPV    PPP    VY SPPPP            KK YVYKSPPPP  V    PP
Sbjct: 113 YKSPPPPVYKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPP 172

Query: 293 PVYHSPPPPKKHYVYK 340
           PVY SPPPPKK YVYK
Sbjct: 173 PVYKSPPPPKKPYVYK 188

 Score =  144 bits (362), Expect = 4e-33
 Identities = 77/130 (59%), Positives = 79/130 (60%), Gaps = 22/130 (16%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPP-------- 151
           PPPP  H  PP +Y SPPPP    +YKSPPPPV    PPP    VY SPPPP        
Sbjct: 90  PPPPPVHKYPPYIYKSPPPPPP--IYKSPPPPVYKSPPPPKNPYVYKSPPPPPPVYKYLH 147

Query: 152 ----KKHYVYKSPPPP--VKHYSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYH-- 304
               KK YVYKSPPPP  V    PPPVY SPPPPKK YVYKSPPPP   H SPPP YH  
Sbjct: 148 HLHQKKPYVYKSPPPPPFVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPIHKSPPPPYHYY 207

Query: 305 -SPPPPKKHY 331
            S PPP  HY
Sbjct: 208 YSSPPPPHHY 217

 Score =  117 bits (292), Expect = 5e-25
 Identities = 65/113 (57%), Positives = 68/113 (60%), Gaps = 15/113 (13%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKHYVYKSPPPPVKHYS----PP 208
           Y SPPPP   Y Y SPPPPV    PPPVY   SPPPP    ++KSPPPP   Y     PP
Sbjct: 27  YSSPPPP---YHYSSPPPPVHSPPPPPVYKYKSPPPPPP--IHKSPPPPPYVYKSPPPPP 81

Query: 209 PVY---HSPPPPKKH----YVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYK 340
           PVY     PPPP  H    Y+YKSPPPP   Y   PPPVY SPPPPK  YVYK
Sbjct: 82  PVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPPVYKSPPPPKNPYVYK 134

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/68 (66%), Positives = 47/68 (69%), Gaps = 2/68 (2%)
 Frame = +2

Query: 2   KSPPPP--VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           KSPPPP  V    PPPVY SPPPPKK YVYKSPPP      PPP++ SPPPP  HY Y S
Sbjct: 158 KSPPPPPFVHKSPPPPVYKSPPPPKKPYVYKSPPP------PPPIHKSPPPP-YHYYYSS 210

Query: 176 PPPPVKHY 199
           PPPP  HY
Sbjct: 211 PPPP-HHY 217

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/62 (56%), Positives = 36/62 (58%), Gaps = 12/62 (19%)
 Frame = +2

Query: 191 KHYSPPPVYH-SPPPPKKH-------YVYKSPPPPVK-HYSPPP---VYHSPPPPKKHYV 334
           K+ SPPP YH S PPP  H       Y YKSPPPP   H SPPP   VY SPPPP   Y 
Sbjct: 26  KYSSPPPPYHYSSPPPPVHSPPPPPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYK 85

Query: 335 YK 340
           YK
Sbjct: 86  YK 87

[15][TOP]
>UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris
           RepID=Q09083_PHAVU
          Length = 580

 Score =  144 bits (364), Expect = 2e-33
 Identities = 73/122 (59%), Positives = 77/122 (63%), Gaps = 11/122 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 165 SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 220

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPKKHY 331
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK  Y
Sbjct: 221 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPKNPY 278

Query: 332 VY 337
            Y
Sbjct: 279 KY 280

 Score =  144 bits (362), Expect = 4e-33
 Identities = 72/118 (61%), Positives = 76/118 (64%), Gaps = 7/118 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 197 SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 252

Query: 170 KSPPPPVKHYSPPPVY-HSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 337
            SPPPP KH  PPP Y HSPPPPK  Y Y SPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 253 HSPPPP-KHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKY 309

 Score =  142 bits (357), Expect = 1e-32
 Identities = 78/128 (60%), Positives = 83/128 (64%), Gaps = 16/128 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 448 KSPPPPYKYPSPPPPPYKYSSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKY 505

Query: 170 KSPPPPVKHYS--PPPVYH--SPPPPKKH-------YVYKSPPPPV-KHYSPPPVYHSPP 313
            SPPPPV  Y   PPPVY   SPPPP K+       Y YKSPPPPV K+ SPPP  HSPP
Sbjct: 506 SSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPVYKYKSPPPPVYKYNSPPPPVHSPP 565

Query: 314 PPKKHYVY 337
           PP  HY+Y
Sbjct: 566 PP--HYIY 571

 Score =  141 bits (355), Expect = 3e-32
 Identities = 72/115 (62%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY-HSPPPPKKHYVYKSPP 181
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y HSPPPPK  Y Y SPP
Sbjct: 229 SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKNPYKYSSPP 284

Query: 182 PPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPPKKHY 331
           PPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPV  Y SPPPP   Y
Sbjct: 285 PPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKY 339

 Score =  140 bits (354), Expect = 3e-32
 Identities = 71/117 (60%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 53  SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 108

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 109 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 163

 Score =  140 bits (354), Expect = 3e-32
 Identities = 71/117 (60%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 69  SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 124

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 125 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 179

 Score =  140 bits (354), Expect = 3e-32
 Identities = 71/117 (60%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 85  SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 140

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 141 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 195

 Score =  140 bits (353), Expect = 4e-32
 Identities = 73/117 (62%), Positives = 76/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY-HSPPPPKKH----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y HSPPPPK      Y Y
Sbjct: 101 SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 156

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 157 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 211

 Score =  136 bits (343), Expect = 6e-31
 Identities = 71/116 (61%), Positives = 74/116 (63%), Gaps = 8/116 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVY-HSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSP 178
           SPPPP KH  PPP Y HSPPPPK  Y Y SPPPPV K+ SPPP Y  P PP   Y Y SP
Sbjct: 254 SPPPP-KHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSP 312

Query: 179 PPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPPKKH 328
           PPPV  Y   PPPVY    PP   Y Y SPPPPV  Y   PPPV  Y+SPPPP K+
Sbjct: 313 PPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKY 368

 Score =  136 bits (342), Expect = 8e-31
 Identities = 70/110 (63%), Positives = 73/110 (66%), Gaps = 4/110 (3%)
 Frame = +2

Query: 5   SPPPPVKHY---SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           SPPPP K Y   SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH    S
Sbjct: 34  SPPPPPKPYYYQSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKH----S 85

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPK 322
           PPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 86  PPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPK 131

 Score =  134 bits (338), Expect = 2e-30
 Identities = 71/119 (59%), Positives = 74/119 (62%), Gaps = 12/119 (10%)
 Frame = +2

Query: 2   KSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----Y 163
           K  PPP  +Y SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y
Sbjct: 115 KHSPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPY 170

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            Y SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 171 YYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 227

 Score =  134 bits (337), Expect = 3e-30
 Identities = 71/119 (59%), Positives = 75/119 (63%), Gaps = 7/119 (5%)
 Frame = +2

Query: 2   KSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYK 172
           KSPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y+  PPPVY    PP   Y YK
Sbjct: 389 KSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYK 448

Query: 173 SPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 337
           SPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 449 SPPPPYKYPSPPPPPYKYSSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKY 505

 Score =  133 bits (335), Expect = 5e-30
 Identities = 75/121 (61%), Positives = 79/121 (65%), Gaps = 12/121 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYS--PPPVY--HSPPPPKKH 160
           KSPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV  Y   PPPVY  +SPPPP   
Sbjct: 291 KSPPPPYKYPSPPPPPYKYSSPPPPV--YKYKSPPPPVYKYKSPPPPVYKYNSPPPPV-- 346

Query: 161 YVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPPKK 325
           Y YKSPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPV  Y SPPPP K
Sbjct: 347 YKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYK 406

Query: 326 H 328
           +
Sbjct: 407 Y 407

 Score =  132 bits (331), Expect = 2e-29
 Identities = 71/118 (60%), Positives = 75/118 (63%), Gaps = 10/118 (8%)
 Frame = +2

Query: 5   SPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPPKKHYVY 169
           SPPPPV  Y+  PPPVY    PP   Y YKSPPPP K+ SPPP    Y SPPPP   Y Y
Sbjct: 419 SPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPV--YKY 476

Query: 170 KSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPPKKH 328
           KSPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPV  Y SPPPP K+
Sbjct: 477 KSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKY 534

 Score =  130 bits (328), Expect = 3e-29
 Identities = 70/121 (57%), Positives = 74/121 (61%), Gaps = 8/121 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPPKKHYV 166
           KSPPPPV  Y+  PPPVY    PP   Y Y SPPPP K+ SPPP    Y SPPPP   Y 
Sbjct: 330 KSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPV--YK 387

Query: 167 YKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVY 337
           YKSPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y+  PPPVY    PP   Y Y
Sbjct: 388 YKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKY 447

Query: 338 K 340
           K
Sbjct: 448 K 448

 Score =  128 bits (322), Expect = 2e-28
 Identities = 72/128 (56%), Positives = 77/128 (60%), Gaps = 21/128 (16%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSPPPV-------------YHS 139
           PPPP K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP              Y+S
Sbjct: 372 PPPPYKYPSPPPPVYKYKSPPPPV--YKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNS 429

Query: 140 PPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YH 304
           PPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPV  Y 
Sbjct: 430 PPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYK 487

Query: 305 SPPPPKKH 328
           SPPPP K+
Sbjct: 488 SPPPPYKY 495

 Score =  127 bits (318), Expect = 5e-28
 Identities = 71/121 (58%), Positives = 74/121 (61%), Gaps = 10/121 (8%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKS 175
           PPPP K+ SPPP    Y+SPPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y S
Sbjct: 411 PPPPYKYPSPPPPVYKYNSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSS 468

Query: 176 PPPPVKHYS--PPPVYH--SPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVY 337
           PPPPV  Y   PPPVY   SPPPP   Y Y SPPPP   YS  PPPVY    PP   Y Y
Sbjct: 469 PPPPVYKYKSPPPPVYKYKSPPPP---YKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKY 525

Query: 338 K 340
           K
Sbjct: 526 K 526

 Score =  125 bits (313), Expect = 2e-27
 Identities = 74/126 (58%), Positives = 78/126 (61%), Gaps = 14/126 (11%)
 Frame = +2

Query: 2   KSPPPPVKHY-SPPP-----VYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPK 154
           K  PPP  +Y SPPP      Y SPPPP   Y YKSPPPP K+ SPPP    Y SPPPP 
Sbjct: 259 KHSPPPPYYYHSPPPPKNPYKYSSPPPPV--YKYKSPPPPYKYPSPPPPPYKYSSPPPPV 316

Query: 155 KHYVYKSPPPPVKHYS--PPPV--YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPP 319
             Y YKSPPPPV  Y   PPPV  Y+SPPPP   Y YKSPPPPV K+ SPPP Y  P PP
Sbjct: 317 --YKYKSPPPPVYKYKSPPPPVYKYNSPPPPV--YKYKSPPPPVYKYNSPPPPYKYPSPP 372

Query: 320 KKHYVY 337
              Y Y
Sbjct: 373 PPPYKY 378

 Score =  125 bits (313), Expect = 2e-27
 Identities = 65/99 (65%), Positives = 69/99 (69%), Gaps = 5/99 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 487 KSPPPPYKYPSPPPPPYKYSSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPVYKY 544

Query: 170 KSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
           KSPPPPV K+ SPPP  HSPPPP  HY+Y SPPPP  HY
Sbjct: 545 KSPPPPVYKYNSPPPPVHSPPPP--HYIYASPPPPY-HY 580

 Score =  103 bits (258), Expect = 5e-21
 Identities = 51/93 (54%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +2

Query: 44  VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 223
           +Y SPPPP K Y Y+SPPPP KH  PPP Y+  PPP KH    SPPPP  ++SPPP  HS
Sbjct: 31  IYSSPPPPPKPYYYQSPPPP-KHSPPPPYYYHSPPPPKH----SPPPPYYYHSPPPPKHS 85

Query: 224 PPPPKKHYVYKSPPPPVKHY-SPPPVYHSPPPP 319
           PPPP              +Y SPPP  HSPPPP
Sbjct: 86  PPPPY-------------YYHSPPPPKHSPPPP 105

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 40/66 (60%), Positives = 42/66 (63%), Gaps = 1/66 (1%)
 Frame = +2

Query: 128 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYH 304
           +Y SPPPP K Y Y+SPPPP          HSPPPP   Y Y SPPPP KH  PPP  YH
Sbjct: 31  IYSSPPPPPKPYYYQSPPPPK---------HSPPPP---YYYHSPPPP-KHSPPPPYYYH 77

Query: 305 SPPPPK 322
           SPPPPK
Sbjct: 78  SPPPPK 83

[16][TOP]
>UniRef100_Q40503 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40503_TOBAC
          Length = 224

 Score =  144 bits (363), Expect = 3e-33
 Identities = 88/151 (58%), Positives = 89/151 (58%), Gaps = 41/151 (27%)
 Frame = +2

Query: 2   KSPPPPVKHY-SPP--PVYHSPPPPKKHY-----------VYKSPPPPVKHYSPP--PVY 133
           KSPPPPV  Y SPP  PVY SPPPPKK Y           VYKSPPPP K Y PP  PVY
Sbjct: 43  KSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPVY 102

Query: 134 HSPPPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKK-HY-----VYKSPPPPVK 277
            SPPPPKK Y      VYKSPPPP       PVY SPPPPKK HY     +YKSPPPP K
Sbjct: 103 KSPPPPKKPYSLPHTPVYKSPPPPT------PVYKSPPPPKKPHYPPHTPIYKSPPPPNK 156

Query: 278 HYSPP------------PVYHSPPPPKK-HY 331
            Y PP            PVY SPPPPKK HY
Sbjct: 157 PYYPPHTPVYKSPPPPTPVYKSPPPPKKPHY 187

 Score =  141 bits (356), Expect = 2e-32
 Identities = 80/128 (62%), Positives = 82/128 (64%), Gaps = 18/128 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKK 157
           KSPPPP K Y PP  PVY SPPPPKK Y      VYKSPPPP       PVY SPPPPKK
Sbjct: 85  KSPPPPKKPYYPPHPPVYKSPPPPKKPYSLPHTPVYKSPPPPT------PVYKSPPPPKK 138

Query: 158 -HY-----VYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHS 307
            HY     +YKSPPPP K Y PP  PVY SPPPP    VYKSPPPP K + PP  PVY S
Sbjct: 139 PHYPPHTPIYKSPPPPNKPYYPPHTPVYKSPPPPTP--VYKSPPPPKKPHYPPHTPVYKS 196

Query: 308 PPPPKKHY 331
           PPPP   Y
Sbjct: 197 PPPPTPVY 204

 Score =  133 bits (335), Expect = 5e-30
 Identities = 75/118 (63%), Positives = 76/118 (64%), Gaps = 23/118 (19%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHY-SPP--PVYHSPPPPKKHY-----------VYKSPPP 184
           Y SPPPPKK Y+YKSPPPPV  Y SPP  PVY SPPPPKK Y           VYKSPPP
Sbjct: 30  YSSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKSPPP 89

Query: 185 PVKHYSPP--PVYHSPPPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKK-HY 331
           P K Y PP  PVY SPPPPKK Y      VYKSPPPP       PVY SPPPPKK HY
Sbjct: 90  PKKPYYPPHPPVYKSPPPPKKPYSLPHTPVYKSPPPPT------PVYKSPPPPKKPHY 141

 Score =  132 bits (333), Expect = 9e-30
 Identities = 80/131 (61%), Positives = 82/131 (62%), Gaps = 21/131 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHY-- 163
           KSPPPP K YS P  PVY SPPPP    VYKSPPPP K + PP  P+Y SPPPP K Y  
Sbjct: 103 KSPPPPKKPYSLPHTPVYKSPPPPTP--VYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYP 160

Query: 164 ----VYKSPPPPVKHYSPPPVYHSPPPPKK-HY-----VYKSPPPPVKHY-SPPP----V 298
               VYKSPPPP       PVY SPPPPKK HY     VYKSPPPP   Y SPPP    V
Sbjct: 161 PHTPVYKSPPPPT------PVYKSPPPPKKPHYPPHTPVYKSPPPPTPVYKSPPPHHPYV 214

Query: 299 YHSPPPPKKHY 331
           Y SPPPP  HY
Sbjct: 215 YASPPPP-YHY 224

 Score =  110 bits (276), Expect = 4e-23
 Identities = 66/132 (50%), Positives = 69/132 (52%), Gaps = 46/132 (34%)
 Frame = +2

Query: 74  HYVYKSPPPPVKHY---SPP------------PVYHSPPPPKKHY-----------VYKS 175
           +Y Y SPPPP K Y   SPP            PVY SPPPPKK Y           VYKS
Sbjct: 27  NYQYSSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKS 86

Query: 176 PPPPVKHYSP--PPVYHSPPPPKKHY----------------VYKSPPPPVKHYSPP--P 295
           PPPP K Y P  PPVY SPPPPKK Y                VYKSPPPP K + PP  P
Sbjct: 87  PPPPKKPYYPPHPPVYKSPPPPKKPYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTP 146

Query: 296 VYHSPPPPKKHY 331
           +Y SPPPP K Y
Sbjct: 147 IYKSPPPPNKPY 158

[17][TOP]
>UniRef100_Q9M6R7 Extensin n=1 Tax=Pisum sativum RepID=Q9M6R7_PEA
          Length = 327

 Score =  144 bits (362), Expect = 4e-33
 Identities = 82/144 (56%), Positives = 84/144 (58%), Gaps = 33/144 (22%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH---SPPPPKKHYVYKSPPPPVKHY--------SPPPVYH---SP 142
           SPPPPV  +SPPP YH    PPPPKK Y Y SPPPP+  Y        SPPP YH    P
Sbjct: 60  SPPPPV--HSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPP 117

Query: 143 PPPKKHYVYKSPPPPVKHYS--PPPVYH--SPPPP-KKHYVYKSPPPPVKHYS------- 286
           PPPKK Y Y SPPPPV  Y   PPPVY   SPPPP KK Y Y SPPPPV  Y        
Sbjct: 118 PPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPPPPVY 177

Query: 287 -----PPPVYH--SPPPPKKHYVY 337
                PPPVY   SPPPPKK Y Y
Sbjct: 178 KYKSPPPPVYKYQSPPPPKKSYKY 201

 Score =  142 bits (359), Expect = 9e-33
 Identities = 80/133 (60%), Positives = 82/133 (61%), Gaps = 22/133 (16%)
 Frame = +2

Query: 5   SPPPPVKHY---SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYV 166
           SPPPP K Y   SPPP  HSPPPP   Y Y SPPPPV  +SPPP YH    PPPPKK Y 
Sbjct: 32  SPPPPPKPYYYQSPPPPVHSPPPP---YHYSSPPPPV--HSPPPPYHYSSPPPPPKKSYK 86

Query: 167 YKSPPPPVKHY--------SPPPVYH---SPPPPKKHYVYKSPPPPVKHYS--PPPV--Y 301
           Y SPPPP+  Y        SPPP YH    PPPPKK Y Y SPPPPV  Y   PPPV  Y
Sbjct: 87  YSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKY 146

Query: 302 HSPPPP-KKHYVY 337
            SPPPP KK Y Y
Sbjct: 147 KSPPPPVKKPYKY 159

 Score =  142 bits (357), Expect = 1e-32
 Identities = 76/123 (61%), Positives = 79/123 (64%), Gaps = 14/123 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYH---SPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPP-KK 157
           KSPPPPV  +SPPP YH    PPPPKK Y Y SPPPPV  Y   PPPV  Y SPPPP KK
Sbjct: 98  KSPPPPV--HSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKK 155

Query: 158 HYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPP 319
            Y Y SPPPPV  Y   PPPVY    PP   Y Y+SPPPP K Y     PPPVY SPPPP
Sbjct: 156 PYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPP 215

Query: 320 KKH 328
            K+
Sbjct: 216 YKY 218

 Score =  136 bits (343), Expect = 6e-31
 Identities = 79/136 (58%), Positives = 83/136 (61%), Gaps = 24/136 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYS--PPPVY--HSPPPPKKHY--------VYKSPPPPVKHYSPPP---VYH 136
           KSPPPPV  Y   PPPVY   SPPPPKK Y        VYKSPPPP K+ SPPP    Y 
Sbjct: 170 KSPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPPYKYQSPPPPPYKYS 229

Query: 137 SPPPPKKHYVYKSPPPPVKHYSPP---PVYHSPPPPKKHYVYKSP-----PPPV-KHYSP 289
           SPPPP   Y Y SPPPP KH SPP     +  PPPP   Y YKSP     PPPV K+ SP
Sbjct: 230 SPPPPV--YKYNSPPPPYKHISPPTPGKPFKFPPPPTPIYKYKSPPPVYSPPPVYKYKSP 287

Query: 290 PPVYHSPPPPKKHYVY 337
           PP  +SPPPP  HYVY
Sbjct: 288 PPPVYSPPPP--HYVY 301

 Score =  134 bits (337), Expect = 3e-30
 Identities = 79/138 (57%), Positives = 81/138 (58%), Gaps = 25/138 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYS--PPPV-----YHSPPPPKKHYVYKSPPPPVKHYS--PPPVY--HSPPP 148
           KSPPPPV  Y   PPPV     Y SPPPP   Y YKSPPPPV  Y   PPPVY   SPPP
Sbjct: 137 KSPPPPVYKYKSPPPPVKKPYKYSSPPPPV--YKYKSPPPPVYKYKSPPPPVYKYQSPPP 194

Query: 149 PKKHY--------VYKSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSPPP 295
           PKK Y        VYKSPPPP K+ SPPP    Y SPPPP   Y Y SPPPP KH SPP 
Sbjct: 195 PKKSYKYPSPPPPVYKSPPPPYKYQSPPPPPYKYSSPPPPV--YKYNSPPPPYKHISPPT 252

Query: 296 V---YHSPPPPKKHYVYK 340
               +  PPPP   Y YK
Sbjct: 253 PGKPFKFPPPPTPIYKYK 270

 Score =  133 bits (334), Expect = 7e-30
 Identities = 75/125 (60%), Positives = 80/125 (64%), Gaps = 15/125 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPPKKHY 163
           KSPPPP K+ SPPP    Y SPPPP   Y Y SPPPP KH SPP     +  PPPP   Y
Sbjct: 210 KSPPPPYKYQSPPPPPYKYSSPPPPV--YKYNSPPPPYKHISPPTPGKPFKFPPPPTPIY 267

Query: 164 VYKSPPP-----PV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPP 316
            YKSPPP     PV K+ SPPP  +SPPPP  HYVY SPPPPV  YSPPP   +Y SPPP
Sbjct: 268 KYKSPPPVYSPPPVYKYKSPPPPVYSPPPP--HYVYSSPPPPV--YSPPPPHYIYASPPP 323

Query: 317 PKKHY 331
           P  HY
Sbjct: 324 P-YHY 327

 Score =  119 bits (297), Expect = 1e-25
 Identities = 63/112 (56%), Positives = 67/112 (59%), Gaps = 14/112 (12%)
 Frame = +2

Query: 44  VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH- 220
           +Y SPPPP K Y Y+SPPPPV         HSPPPP   Y Y SPPPPV  +SPPP YH 
Sbjct: 29  LYSSPPPPPKPYYYQSPPPPV---------HSPPPP---YHYSSPPPPV--HSPPPPYHY 74

Query: 221 --SPPPPKKHYVYKSPPPPVKHY--------SPPPVYH---SPPPPKKHYVY 337
              PPPPKK Y Y SPPPP+  Y        SPPP YH    PPPPKK Y Y
Sbjct: 75  SSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKY 126

[18][TOP]
>UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN
          Length = 432

 Score =  142 bits (358), Expect = 1e-32
 Identities = 72/123 (58%), Positives = 77/123 (62%), Gaps = 12/123 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 105 SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 160

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPPVYHS--PPPPKKH 328
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP Y+   PPPPKK 
Sbjct: 161 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYKSPPPPPKKP 218

Query: 329 YVY 337
           Y Y
Sbjct: 219 YKY 221

 Score =  142 bits (357), Expect = 1e-32
 Identities = 74/118 (62%), Positives = 79/118 (66%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 310 KSPPPPYKYPSPPPPPYKYPSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKY 367

Query: 170 KSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 337
            SPPPPV K+ SPPP Y  P PP   Y Y SPPPPV K+ SPPP  HSPPPP  HY+Y
Sbjct: 368 PSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPPPP--HYIY 423

 Score =  141 bits (355), Expect = 3e-32
 Identities = 71/119 (59%), Positives = 76/119 (63%), Gaps = 8/119 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 137 SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 192

Query: 170 KSPPPPVKHYSPPPVYHS--PPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 337
            SPPPP KH  PPP Y+   PPPPKK Y Y SPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 193 HSPPPP-KHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKY 250

 Score =  140 bits (354), Expect = 3e-32
 Identities = 71/117 (60%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 41  SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 96

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 97  HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 151

 Score =  139 bits (350), Expect = 1e-31
 Identities = 71/115 (61%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS--PPPPKKHYVYKSP 178
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+   PPPPKK Y Y SP
Sbjct: 169 SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYKSPPPPPKKPYKYPSP 224

Query: 179 PPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPPKKH 328
           PPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPV  Y SPPPP K+
Sbjct: 225 PPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKY 279

 Score =  134 bits (338), Expect = 2e-30
 Identities = 71/119 (59%), Positives = 74/119 (62%), Gaps = 12/119 (10%)
 Frame = +2

Query: 2   KSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----Y 163
           K  PPP  +Y SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y
Sbjct: 55  KHSPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPY 110

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            Y SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 111 YYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 167

 Score =  132 bits (333), Expect = 9e-30
 Identities = 74/126 (58%), Positives = 78/126 (61%), Gaps = 18/126 (14%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHS--PPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKS 175
           SPPPP KH  PPP Y+   PPPPKK Y Y SPPPPV K+ SPPP Y  P PP   Y Y S
Sbjct: 194 SPPPP-KHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPS 252

Query: 176 PPPPVKHYS--PPPVYH--SPPPPKKH-------YVYKSPPPPVKHYS--PPPV--YHSP 310
           PPPPV  Y   PPPVY   SPPPP K+       Y Y SPPPPV  Y   PPPV  Y SP
Sbjct: 253 PPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP 312

Query: 311 PPPKKH 328
           PPP K+
Sbjct: 313 PPPYKY 318

 Score =  131 bits (330), Expect = 2e-29
 Identities = 71/118 (60%), Positives = 75/118 (63%), Gaps = 8/118 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPPKKHYVY 169
           PPPP K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP    Y SPPPP   Y Y
Sbjct: 283 PPPPYKYPSPPPPVYKYKSPPPPV--YKYKSPPPPYKYPSPPPPPYKYPSPPPPV--YKY 338

Query: 170 KSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 337
           KSPPPPV K+ SPPP Y  P PP   Y Y SPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 339 KSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKY 396

 Score =  130 bits (328), Expect = 3e-29
 Identities = 72/118 (61%), Positives = 76/118 (64%), Gaps = 11/118 (9%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPPKKHYVY 169
           PPPP K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP    Y SPPPP   Y Y
Sbjct: 244 PPPPYKYPSPPPPVYKYKSPPPPV--YKYKSPPPPYKYPSPPPPPYKYPSPPPPV--YKY 299

Query: 170 KSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPPKKH 328
           KSPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPV  Y SPPPP K+
Sbjct: 300 KSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKY 357

 Score =  130 bits (326), Expect = 6e-29
 Identities = 75/138 (54%), Positives = 79/138 (57%), Gaps = 26/138 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 232 KSPPPPYKYPSPPPPPYKYPSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKY 289

Query: 170 KSPPPPVKHYS--PPPVYH--SPPPPKKH-----------------YVYKSPPPPV-KHY 283
            SPPPPV  Y   PPPVY   SPPPP K+                 Y YKSPPPPV K+ 
Sbjct: 290 PSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 349

Query: 284 SPPPVYHSPPPPKKHYVY 337
           SPPP Y  P PP   Y Y
Sbjct: 350 SPPPPYKYPSPPPPPYKY 367

 Score =  129 bits (325), Expect = 8e-29
 Identities = 75/138 (54%), Positives = 79/138 (57%), Gaps = 28/138 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 271 KSPPPPYKYPSPPPPPYKYPSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKY 328

Query: 170 KSPPPPVKHYS--PPPVYH--SPPPPKKH-----------------YVYKSPPPPVKHYS 286
            SPPPPV  Y   PPPVY   SPPPP K+                 Y YKSPPPP K+ S
Sbjct: 329 PSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPS 388

Query: 287 PPP---VYHSPPPPKKHY 331
           PPP    Y SPPPP   Y
Sbjct: 389 PPPPPYKYPSPPPPVYKY 406

 Score =  129 bits (324), Expect = 1e-28
 Identities = 74/119 (62%), Positives = 78/119 (65%), Gaps = 11/119 (9%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPPKKHYVY 169
           PPPP K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP    Y SPPPP   Y Y
Sbjct: 322 PPPPYKYPSPPPPVYKYKSPPPPV--YKYKSPPPPYKYPSPPPPPYKYPSPPPPV--YKY 377

Query: 170 KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHY 331
           KSPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV H  PPP  +Y SPPPP  HY
Sbjct: 378 KSPPPPYKYPSPPPPPYKYPSPPPPV--YKYKSPPPPV-HSPPPPHYIYASPPPP-YHY 432

 Score =  127 bits (320), Expect = 3e-28
 Identities = 68/108 (62%), Positives = 69/108 (63%), Gaps = 11/108 (10%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY-HSPPPPKKH----YVYKSPPPPVKH 196
           SPPP  HSPPPP   Y Y SPPPP KH  PPP Y HSPPPPK      Y Y SPPPP KH
Sbjct: 34  SPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KH 88

Query: 197 YSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
             PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 89  SPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 135

 Score =  126 bits (317), Expect = 7e-28
 Identities = 73/122 (59%), Positives = 76/122 (62%), Gaps = 12/122 (9%)
 Frame = +2

Query: 2   KSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYH--SPPPPKKHYV 166
           KSPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPVY   SPPPP   Y 
Sbjct: 261 KSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP---YK 317

Query: 167 YKSPPPP-VKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKK 325
           Y SPPPP  K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP    Y SPPPP  
Sbjct: 318 YPSPPPPPYKYPSPPPPVYKYKSPPPPV--YKYKSPPPPYKYPSPPPPPYKYPSPPPPVY 375

Query: 326 HY 331
            Y
Sbjct: 376 KY 377

 Score =  124 bits (312), Expect = 2e-27
 Identities = 72/121 (59%), Positives = 75/121 (61%), Gaps = 12/121 (9%)
 Frame = +2

Query: 5   SPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYH--SPPPPKKHYVY 169
           SPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPVY   SPPPP   Y Y
Sbjct: 223 SPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP---YKY 279

Query: 170 KSPPPP-VKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKKH 328
            SPPPP  K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP    Y SPPPP   
Sbjct: 280 PSPPPPPYKYPSPPPPVYKYKSPPPPV--YKYKSPPPPYKYPSPPPPPYKYPSPPPPVYK 337

Query: 329 Y 331
           Y
Sbjct: 338 Y 338

 Score =  112 bits (279), Expect = 2e-23
 Identities = 58/94 (61%), Positives = 61/94 (64%), Gaps = 11/94 (11%)
 Frame = +2

Query: 74  HYVYKSPPPPVKHYSPPPVY-HSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPK 238
           +Y+Y SPPPP KH  PPP Y HSPPPPK      Y Y SPPPP KH  PPP Y+  PPP 
Sbjct: 29  NYIYSSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPP 86

Query: 239 KH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
           KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 87  KHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 119

 Score =  111 bits (278), Expect = 2e-23
 Identities = 59/96 (61%), Positives = 63/96 (65%), Gaps = 2/96 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSP 178
           KSPPPP K+ SPPP    PP     Y Y SPPPPV K+ SPPP Y  P PP   Y Y SP
Sbjct: 349 KSPPPPYKYPSPPP----PP-----YKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSP 399

Query: 179 PPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
           PPPV K+ SPPP  HSPPPP  HY+Y SPPPP  HY
Sbjct: 400 PPPVYKYKSPPPPVHSPPPP--HYIYASPPPPY-HY 432

 Score =  109 bits (273), Expect = 8e-23
 Identities = 56/93 (60%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +2

Query: 44  VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 223
           +Y SPPPPK      SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+ 
Sbjct: 31  IYSSPPPPKH-----SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYH 81

Query: 224 PPPPKKHYVYKSPPPPVKHY-SPPPVYHSPPPP 319
            PPP KH    SPPPP  +Y SPPP  HSPPPP
Sbjct: 82  SPPPPKH----SPPPPY-YYHSPPPPKHSPPPP 109

[19][TOP]
>UniRef100_Q9FSG1 Putative extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG1_NICSY
          Length = 311

 Score =  140 bits (354), Expect = 3e-32
 Identities = 78/125 (62%), Positives = 80/125 (64%), Gaps = 16/125 (12%)
 Frame = +2

Query: 5   SPPPPV-KHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKKH 160
           SPPPPV K+ SPP   P+Y SPPPP   Y YKSPPPPV  Y     PPPVY SPPPP   
Sbjct: 44  SPPPPVYKYKSPPPPLPIYRSPPPPV--YKYKSPPPPVYKYKSPPPPPPVYKSPPPPV-- 99

Query: 161 YVYKSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 316
           Y YKSPPPPV  Y     PPPVY SPPPP   Y YKSPPPPV  Y     PPPVY SPPP
Sbjct: 100 YKYKSPPPPVYKYKSPPPPPPVYKSPPPPV--YKYKSPPPPVYKYKSPPPPPPVYKSPPP 157

Query: 317 PKKHY 331
           P   Y
Sbjct: 158 PVYKY 162

 Score =  138 bits (348), Expect = 2e-31
 Identities = 73/125 (58%), Positives = 74/125 (59%), Gaps = 12/125 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKK 157
           KSPPPPV  Y     PPPVY SPPPP   Y YKSPPPPV  Y     PPPVY SPPPP  
Sbjct: 73  KSPPPPVYKYKSPPPPPPVYKSPPPPV--YKYKSPPPPVYKYKSPPPPPPVYKSPPPPV- 129

Query: 158 HYVYKSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            Y YKSPPPPV  Y     PPPVY SPPPP   Y    PPPPV    PPP+Y    PP  
Sbjct: 130 -YKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPP 188

Query: 326 HYVYK 340
            Y YK
Sbjct: 189 VYKYK 193

 Score =  137 bits (345), Expect = 4e-31
 Identities = 82/147 (55%), Positives = 84/147 (57%), Gaps = 34/147 (23%)
 Frame = +2

Query: 2   KSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPK- 154
           KSPPPPV  Y     PPPV+ SPPPP   Y YKSPPPPV  Y     PPP+Y SPPPP  
Sbjct: 153 KSPPPPVYKYKSPPPPPPVHKSPPPPI--YKYKSPPPPVYKYKSPPPPPPMYKSPPPPVY 210

Query: 155 KH---------YVYKSPPPPVKHYS----PPPVYHSPPPPKKHY--------VYKSPPPP 271
           KH         Y YKSPPPPV  Y     PPPVY SPPPP   Y        VYKSPPPP
Sbjct: 211 KHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPP 270

Query: 272 VKHYS----PPPVYHSPPPPKKHYVYK 340
           V  Y     PPPVY SPPPP    VYK
Sbjct: 271 VYKYKSPPPPPPVYKSPPPP----VYK 293

 Score =  135 bits (340), Expect = 1e-30
 Identities = 79/129 (61%), Positives = 79/129 (61%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKK 157
           KSPPPPV  Y     PPPVY SPPPP   Y YKSPPPPV  Y     PPPVY SPPPP  
Sbjct: 103 KSPPPPVYKYKSPPPPPPVYKSPPPPV--YKYKSPPPPVYKYKSPPPPPPVYKSPPPPV- 159

Query: 158 HYVYKSPPPPVK-HYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYS--PPPVY--HSPP 313
            Y YKSPPPP   H SPPP    Y SPPPP   Y YKSPPPP   Y   PPPVY   SPP
Sbjct: 160 -YKYKSPPPPPPVHKSPPPPIYKYKSPPPPV--YKYKSPPPPPPMYKSPPPPVYKHKSPP 216

Query: 314 PPKKHYVYK 340
           PP   Y YK
Sbjct: 217 PPPPVYKYK 225

 Score =  135 bits (340), Expect = 1e-30
 Identities = 70/122 (57%), Positives = 71/122 (58%), Gaps = 12/122 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           KSPPPPV  Y     PPPVY SPPPP   Y    PPPPV    PPP+Y    PP   Y Y
Sbjct: 133 KSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKY 192

Query: 170 KSPPPPVKHYS--PPPVY--HSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKK 325
           KSPPPP   Y   PPPVY   SPPPP   Y YKSPPPPV  Y     PPPVY SPPPP  
Sbjct: 193 KSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIY 252

Query: 326 HY 331
            Y
Sbjct: 253 KY 254

 Score =  135 bits (340), Expect = 1e-30
 Identities = 76/122 (62%), Positives = 76/122 (62%), Gaps = 10/122 (8%)
 Frame = +2

Query: 2   KSPPPPVKHYS--PPPVYH--SPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKK 157
           KSPPPP   Y   PPPVY   SPPPP   Y YKSPPPPV  Y     PPPVY SPPPP  
Sbjct: 193 KSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPI- 251

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHY 331
            Y YKSPPPP      PPVY SPPPP   Y YKSPPPP   Y   PPPVY SPPPP  HY
Sbjct: 252 -YKYKSPPPP------PPVYKSPPPPV--YKYKSPPPPPPVYKSPPPPVYKSPPPP-YHY 301

Query: 332 VY 337
            Y
Sbjct: 302 YY 303

 Score =  129 bits (323), Expect = 1e-28
 Identities = 68/107 (63%), Positives = 70/107 (65%), Gaps = 12/107 (11%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPV-KHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYS---- 202
           Y SPPPP K YVY SPPPPV K+ SPP   P+Y SPPPP   Y YKSPPPPV  Y     
Sbjct: 30  YSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPV--YKYKSPPPPVYKYKSPPP 87

Query: 203 PPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKKHY 331
           PPPVY SPPPP   Y YKSPPPPV  Y     PPPVY SPPPP   Y
Sbjct: 88  PPPVYKSPPPPV--YKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKY 132

 Score =  123 bits (308), Expect = 7e-27
 Identities = 71/122 (58%), Positives = 73/122 (59%), Gaps = 12/122 (9%)
 Frame = +2

Query: 2   KSPPPPV-KHYSPPPV-----YHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKK 157
           KSPPPPV KH SPPP      Y SPPPP   Y    PPPPV    PPP+Y   SPPPP  
Sbjct: 203 KSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPP 262

Query: 158 HYVYKSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
             VYKSPPPPV  Y     PPPVY SPPPP    VYKSPPPP  +Y     Y SPPPP  
Sbjct: 263 --VYKSPPPPVYKYKSPPPPPPVYKSPPPP----VYKSPPPPYHYY-----YTSPPPP-- 309

Query: 326 HY 331
           HY
Sbjct: 310 HY 311

[20][TOP]
>UniRef100_Q7DMV8 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q7DMV8_PHAVU
          Length = 230

 Score =  140 bits (354), Expect = 3e-32
 Identities = 71/117 (60%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 54  SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 109

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 110 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 164

 Score =  140 bits (354), Expect = 3e-32
 Identities = 71/117 (60%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 70  SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 125

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 126 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 180

 Score =  140 bits (354), Expect = 3e-32
 Identities = 71/117 (60%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 86  SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 141

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 142 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 196

 Score =  140 bits (354), Expect = 3e-32
 Identities = 71/117 (60%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 102 SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 157

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPK 322
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 158 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 212

 Score =  140 bits (354), Expect = 3e-32
 Identities = 71/117 (60%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 118 SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 173

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPPVY-HSPPPPK 322
            SPPPP KH  PPP Y+  PPP KH     Y Y SPPPP KH  PPP Y HSPPPPK
Sbjct: 174 HSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KHSPPPPYYYHSPPPPK 228

 Score =  136 bits (342), Expect = 8e-31
 Identities = 70/110 (63%), Positives = 73/110 (66%), Gaps = 4/110 (3%)
 Frame = +2

Query: 5   SPPPPVKHY---SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           SPPPP K Y   SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH    S
Sbjct: 35  SPPPPPKPYYYQSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKH----S 86

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPK 322
           PPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP  YHSPPPPK
Sbjct: 87  PPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPK 132

 Score =  127 bits (319), Expect = 4e-28
 Identities = 62/106 (58%), Positives = 68/106 (64%), Gaps = 5/106 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  ++SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH     Y Y
Sbjct: 134 SPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKHSPPPPYYY 189

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 307
            SPPPP KH  PPP Y+  PPP KH    SPPPP  ++SPPP  HS
Sbjct: 190 HSPPPP-KHSPPPPYYYHSPPPPKH----SPPPPYYYHSPPPPKHS 230

 Score =  110 bits (276), Expect = 4e-23
 Identities = 57/94 (60%), Positives = 61/94 (64%), Gaps = 1/94 (1%)
 Frame = +2

Query: 2   KSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           K  PPP  +Y SPPP  HSPPPP   Y Y SPPPP KH  PPP Y+  PPP KH    SP
Sbjct: 148 KHSPPPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KHSPPPPYYYHSPPPPKH----SP 199

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH 280
           PPP  ++SPPP  HSPPPP   Y Y SPPPP KH
Sbjct: 200 PPPYYYHSPPPPKHSPPPP---YYYHSPPPP-KH 229

 Score =  103 bits (258), Expect = 5e-21
 Identities = 51/93 (54%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +2

Query: 44  VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 223
           +Y SPPPP K Y Y+SPPPP KH  PPP Y+  PPP KH    SPPPP  ++SPPP  HS
Sbjct: 32  IYSSPPPPPKPYYYQSPPPP-KHSPPPPYYYHSPPPPKH----SPPPPYYYHSPPPPKHS 86

Query: 224 PPPPKKHYVYKSPPPPVKHY-SPPPVYHSPPPP 319
           PPPP              +Y SPPP  HSPPPP
Sbjct: 87  PPPPY-------------YYHSPPPPKHSPPPP 106

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 40/66 (60%), Positives = 42/66 (63%), Gaps = 1/66 (1%)
 Frame = +2

Query: 128 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYH 304
           +Y SPPPP K Y Y+SPPPP          HSPPPP   Y Y SPPPP KH  PPP  YH
Sbjct: 32  IYSSPPPPPKPYYYQSPPPPK---------HSPPPP---YYYHSPPPP-KHSPPPPYYYH 78

Query: 305 SPPPPK 322
           SPPPPK
Sbjct: 79  SPPPPK 84

[21][TOP]
>UniRef100_B9H7Q5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H7Q5_POPTR
          Length = 173

 Score =  138 bits (348), Expect = 2e-31
 Identities = 71/116 (61%), Positives = 72/116 (62%), Gaps = 8/116 (6%)
 Frame = +2

Query: 8   PPPPVKHYS---PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           PPPP  HY    PPP  HSPPPP   Y YKSPPPP      PPV+ SPPPPKK Y YKSP
Sbjct: 43  PPPPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPP------PPVHKSPPPPKKPYKYKSP 96

Query: 179 PPPVKHYSPPPV----YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP-PKKHY 331
           PPP  H  PPP     Y SPPPP   Y YKSPPPP      PPVY SPPP PKK Y
Sbjct: 97  PPPPVHSPPPPSHPYKYKSPPPPPPVYKYKSPPPP------PPVYKSPPPPPKKPY 146

 Score =  130 bits (328), Expect = 3e-29
 Identities = 70/123 (56%), Positives = 71/123 (57%), Gaps = 16/123 (13%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV-YH-----------SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 148
           SPPPP K   PPP  YH           SPPPP   Y YKSPPP      PPPV+ SPPP
Sbjct: 33  SPPPPKKSPPPPPPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPP------PPPVHKSPPP 86

Query: 149 PKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           PKK Y YKSPPPP  H  PPP     Y SPPPP   Y YKSPPP      PPPVY SPPP
Sbjct: 87  PKKPYKYKSPPPPPVHSPPPPSHPYKYKSPPPPPPVYKYKSPPP------PPPVYKSPPP 140

Query: 317 PKK 325
           P K
Sbjct: 141 PPK 143

 Score =  126 bits (317), Expect = 7e-28
 Identities = 65/110 (59%), Positives = 68/110 (61%), Gaps = 4/110 (3%)
 Frame = +2

Query: 23  KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS 202
           ++ SPPP   SPPPP   Y YKSPPPP      PPV HSPPPP   Y YKSPPP      
Sbjct: 30  EYSSPPPPKKSPPPPPPPYHYKSPPPP------PPV-HSPPPPPHPYKYKSPPP------ 76

Query: 203 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYK 340
           PPPV+ SPPPPKK Y YKSPPPP  H  PPP     Y SPPPP   Y YK
Sbjct: 77  PPPVHKSPPPPKKPYKYKSPPPPPVHSPPPPSHPYKYKSPPPPPPVYKYK 126

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 52/92 (56%), Positives = 54/92 (58%), Gaps = 11/92 (11%)
 Frame = +2

Query: 5   SPPPPVKHYS------PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV----YHSPPPPK 154
           SPPPP   Y       PPPV+ SPPPPKK Y YKSPPPP  H  PPP     Y SPPPP 
Sbjct: 61  SPPPPPHPYKYKSPPPPPPVHKSPPPPKKPYKYKSPPPPPVHSPPPPSHPYKYKSPPPPP 120

Query: 155 KHYVYKSPPPPVK-HYSPPPVYHSPPPPKKHY 247
             Y YKSPPPP   + SP      PPPPKK Y
Sbjct: 121 PVYKYKSPPPPPPVYKSP------PPPPKKPY 146

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 5/59 (8%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV----YHSPPPPKKHYVYKSPPPPVK-HYSPPPVYHSPPPPKKHY 163
           KSPPPP  H  PPP     Y SPPPP   Y YKSPPPP   + SP      PPPPKK Y
Sbjct: 94  KSPPPPPVHSPPPPSHPYKYKSPPPPPPVYKYKSPPPPPPVYKSP------PPPPKKPY 146

[22][TOP]
>UniRef100_Q40402 Extensin (ext) n=1 Tax=Nicotiana plumbaginifolia RepID=Q40402_NICPL
          Length = 416

 Score =  138 bits (347), Expect = 2e-31
 Identities = 83/144 (57%), Positives = 85/144 (59%), Gaps = 34/144 (23%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP------------PVYHSPPPPKK-HY-----VYKSPPPPVKHY-SPP 124
           KSPPPP K Y PP            PVY SPPPPKK HY     VYKSPPPP   Y SPP
Sbjct: 64  KSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPTPVYKSPP 123

Query: 125 -----------PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPP 265
                      PVY SPPPP    VYKSPPPP K + PP  PVY SPPPP    VYKSPP
Sbjct: 124 SPKKPHYPPHTPVYKSPPPPTP--VYKSPPPPKKPHYPPHTPVYKSPPPPTP--VYKSPP 179

Query: 266 PPVKHYSPP--PVYHSPPPPKKHY 331
           PP K + PP  PVY SPPPPKK Y
Sbjct: 180 PPKKPHYPPHTPVYKSPPPPKKPY 203

 Score =  137 bits (344), Expect = 5e-31
 Identities = 81/144 (56%), Positives = 84/144 (58%), Gaps = 34/144 (23%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVY 169
           KSPPPP K + PP  PVY SPPPP    VYKSPP P K + PP  PVY SPPPP    VY
Sbjct: 92  KSPPPPKKPHYPPHTPVYKSPPPPTP--VYKSPPSPKKPHYPPHTPVYKSPPPPTP--VY 147

Query: 170 KSPPPPVKHYSPP------------PVYHSPPPPKK-HY-----VYKSPPPPVKHYSPP- 292
           KSPPPP K + PP            PVY SPPPPKK HY     VYKSPPPP K Y PP 
Sbjct: 148 KSPPPPKKPHYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPH 207

Query: 293 -----------PVYHSPPPPKKHY 331
                      PVY SPPPPKK Y
Sbjct: 208 TPVYKSPPPPTPVYKSPPPPKKPY 231

 Score =  135 bits (339), Expect = 2e-30
 Identities = 83/149 (55%), Positives = 85/149 (57%), Gaps = 39/149 (26%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP------------PVYHS 139
           KSPP P K + PP  PVY SPPPP    VYKSPPPP K + PP            PVY S
Sbjct: 120 KSPPSPKKPHYPPHTPVYKSPPPPTP--VYKSPPPPKKPHYPPHTPVYKSPPPPTPVYKS 177

Query: 140 PPPPKK-HY-----VYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHY---- 283
           PPPPKK HY     VYKSPPPP K Y PP  PVY SPPPP    VYKSPPPP K Y    
Sbjct: 178 PPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTP--VYKSPPPPKKPYHPSP 235

Query: 284 ----------SPP---PVYHSPPPPKKHY 331
                     SPP   PVY SPPPPKK Y
Sbjct: 236 TPYHPSPVYKSPPPPTPVYKSPPPPKKPY 264

 Score =  130 bits (326), Expect = 6e-29
 Identities = 77/133 (57%), Positives = 79/133 (59%), Gaps = 24/133 (18%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP-------VYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKK 157
           SPPPP K Y P P       VY SPPPP    VYKSPPPP K Y PP  PVY SPPPP  
Sbjct: 32  SPPPPKKPYHPSPTPYYPAPVYKSPPPPIP--VYKSPPPPKKPYYPPHTPVYKSPPPPTP 89

Query: 158 HYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP------------P 295
             VYKSPPPP K + PP  PVY SPPPP    VYKSPP P K + PP            P
Sbjct: 90  --VYKSPPPPKKPHYPPHTPVYKSPPPPTP--VYKSPPSPKKPHYPPHTPVYKSPPPPTP 145

Query: 296 VYHSPPPPKK-HY 331
           VY SPPPPKK HY
Sbjct: 146 VYKSPPPPKKPHY 158

 Score =  127 bits (320), Expect = 3e-28
 Identities = 76/138 (55%), Positives = 76/138 (55%), Gaps = 28/138 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP-------VYHSPPPPKKHYVYKSPPPPVKHYSPPP-------VYHS 139
           KSPPPP K Y P P       VY SPPPP    VYKSPPPP K Y P P       VY S
Sbjct: 255 KSPPPPKKPYHPSPTPYHPSPVYKSPPPPTP--VYKSPPPPKKPYHPSPTPYHPSPVYKS 312

Query: 140 PPPPKKHYVYKSPPPPVKHYSPPP-------VYHSPPPPKKHYVYKSPPPPVK------- 277
           PPPP    VYKSPPPP K Y P P       VY SPPPP    VYKSPPPPVK       
Sbjct: 313 PPPPTP--VYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPTP--VYKSPPPPVKPYHPSPT 368

Query: 278 HYSPPPVYHSPPPPKKHY 331
            Y P PVY SPPPP   Y
Sbjct: 369 PYHPAPVYKSPPPPTPVY 386

 Score =  126 bits (317), Expect = 7e-28
 Identities = 78/136 (57%), Positives = 78/136 (57%), Gaps = 26/136 (19%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP-------VYHSPPPPKKHYVYKSPPPPVKHYSPPP-------VYHS 139
           KSPPPP K Y P P       VY SPPPP    VYKSPPPP K Y P P       VY S
Sbjct: 288 KSPPPPKKPYHPSPTPYHPSPVYKSPPPPTP--VYKSPPPPKKPYHPSPTPYHPAPVYKS 345

Query: 140 PPPPKKHYVYKSPPPPVKHYSPPP-------VYHSPPPPKKHYVYKSPPPPVKHY-SPPP 295
           PPPP    VYKSPPPPVK Y P P       VY SPPPP    VYKSPPPP   Y SPPP
Sbjct: 346 PPPPTP--VYKSPPPPVKPYHPSPTPYHPAPVYKSPPPPTP--VYKSPPPPTPVYKSPPP 401

Query: 296 ----VYHSPPPPKKHY 331
               VY SPPPP  HY
Sbjct: 402 HHPYVYASPPPP-YHY 416

 Score =  125 bits (314), Expect = 1e-27
 Identities = 75/138 (54%), Positives = 75/138 (54%), Gaps = 28/138 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP-------VYHSPPPPKKHYVYKSPPPPVK-------HYSPPPVYHS 139
           KSPPPP K Y P P       VY SPPPP    VYKSPPPP K        Y P PVY S
Sbjct: 222 KSPPPPKKPYHPSPTPYHPSPVYKSPPPPTP--VYKSPPPPKKPYHPSPTPYHPSPVYKS 279

Query: 140 PPPPKKHYVYKSPPPPVK-------HYSPPPVYHSPPPPKKHYVYKSPPPPVK------- 277
           PPPP    VYKSPPPP K        Y P PVY SPPPP    VYKSPPPP K       
Sbjct: 280 PPPPTP--VYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTP--VYKSPPPPKKPYHPSPT 335

Query: 278 HYSPPPVYHSPPPPKKHY 331
            Y P PVY SPPPP   Y
Sbjct: 336 PYHPAPVYKSPPPPTPVY 353

 Score =  111 bits (277), Expect = 3e-23
 Identities = 62/99 (62%), Positives = 64/99 (64%), Gaps = 4/99 (4%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYH 220
           Y SPPPPKK Y + SP P    Y P PVY SPPPP    VYKSPPPP K Y PP  PVY 
Sbjct: 30  YSSPPPPKKPY-HPSPTP----YYPAPVYKSPPPPIP--VYKSPPPPKKPYYPPHTPVYK 82

Query: 221 SPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHY 331
           SPPPP    VYKSPPPP K + PP  PVY SPPPP   Y
Sbjct: 83  SPPPPTP--VYKSPPPPKKPHYPPHTPVYKSPPPPTPVY 119

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/93 (55%), Positives = 55/93 (59%), Gaps = 7/93 (7%)
 Frame = +2

Query: 74  HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY-- 247
           +Y Y SPPPP K Y P P  + P P     VYKSPPPP+      PVY SPPPPKK Y  
Sbjct: 27  NYQYSSPPPPKKPYHPSPTPYYPAP-----VYKSPPPPI------PVYKSPPPPKKPYYP 75

Query: 248 ----VYKSPPPPVKHYSPPPVYHSPPPPKK-HY 331
               VYKSPPPP       PVY SPPPPKK HY
Sbjct: 76  PHTPVYKSPPPPT------PVYKSPPPPKKPHY 102

[23][TOP]
>UniRef100_B9GWA6 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9GWA6_POPTR
          Length = 202

 Score =  137 bits (346), Expect = 3e-31
 Identities = 84/137 (61%), Positives = 86/137 (62%), Gaps = 24/137 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYH--SPPPP--KKH----YVYKSPPPPVKHYSPPPVYH--SPPPP 151
           KSPPPP    SPPP YH  SPPPP  KK     YVYKSPPPP    SPPP YH  SPPPP
Sbjct: 42  KSPPPPSP--SPPPPYHYSSPPPPPLKKSPPPSYVYKSPPPPSP--SPPPPYHYSSPPPP 97

Query: 152 KKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYH- 304
           KK     YVYKSPPPP    SPP  Y SPPPPKK     Y+YKSPPPP    SPPP YH 
Sbjct: 98  KKSPPPPYVYKSPPPPSPSLSPPYHYSSPPPPKKSPPPPYIYKSPPPPSP--SPPPPYHY 155

Query: 305 -SPPPPKKH----YVYK 340
            SP PPKK     Y+YK
Sbjct: 156 SSPSPPKKSPPPLYIYK 172

 Score =  135 bits (341), Expect = 1e-30
 Identities = 75/122 (61%), Positives = 77/122 (63%), Gaps = 16/122 (13%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH- 160
           KSPPPP    SPPP YH  SPPPPKK     YVYKSPPPP    SPP  Y SPPPPKK  
Sbjct: 76  KSPPPPSP--SPPPPYHYSSPPPPKKSPPPPYVYKSPPPPSPSLSPPYHYSSPPPPKKSP 133

Query: 161 ---YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPP 313
              Y+YKSPPPP    SPPP YH  SP PPKK     Y+YKSPPPP     PP  Y SPP
Sbjct: 134 PPPYIYKSPPPPSP--SPPPPYHYSSPSPPKKSPPPLYIYKSPPPPSPSPPPPYYYKSPP 191

Query: 314 PP 319
           PP
Sbjct: 192 PP 193

 Score =  122 bits (306), Expect = 1e-26
 Identities = 67/118 (56%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSP 178
           SP P   + SPPP   SPPPP   Y Y SPPPP    SPPP  VY SPPPP       SP
Sbjct: 34  SPTPRYVYKSPPPPSPSPPPP---YHYSSPPPPPLKKSPPPSYVYKSPPPPS-----PSP 85

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 340
           PPP  + SPPP   SPPPP   YVYKSPPPP    SPP  Y SPPPPKK     Y+YK
Sbjct: 86  PPPYHYSSPPPPKKSPPPP---YVYKSPPPPSPSLSPPYHYSSPPPPKKSPPPPYIYK 140

 Score =  112 bits (280), Expect = 1e-23
 Identities = 65/111 (58%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH- 160
           KSPPPP    SPP  Y SPPPPKK     Y+YKSPPPP    SPPP YH  SP PPKK  
Sbjct: 108 KSPPPPSPSLSPPYHYSSPPPPKKSPPPPYIYKSPPPPSP--SPPPPYHYSSPSPPKKSP 165

Query: 161 ---YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
              Y+YKSPPPP    SP     SPPPP   Y YKSPPPP   +SPPP Y+
Sbjct: 166 PPLYIYKSPPPP----SP-----SPPPP---YYYKSPPPPT--HSPPPPYY 202

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 43/99 (43%), Positives = 46/99 (46%), Gaps = 24/99 (24%)
 Frame = +2

Query: 116 SPPPVYHSPPP---PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY- 283
           S P ++ SP     P   YVYKSPPPP    SPPP YH   PP         PPP+K   
Sbjct: 21  SIPLLFTSPAKEVSPTPRYVYKSPPPPSP--SPPPPYHYSSPP---------PPPLKKSP 69

Query: 284 --------------SPPPVYH--SPPPPKKH----YVYK 340
                         SPPP YH  SPPPPKK     YVYK
Sbjct: 70  PPSYVYKSPPPPSPSPPPPYHYSSPPPPKKSPPPPYVYK 108

[24][TOP]
>UniRef100_P06599 Extensin n=1 Tax=Daucus carota RepID=EXTN_DAUCA
          Length = 306

 Score =  137 bits (346), Expect = 3e-31
 Identities = 78/133 (58%), Positives = 83/133 (62%), Gaps = 21/133 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK------HY-SPPPVYHSPPPPKKHY 163
           SPPPP  + SPPP  HSPPPP   Y YKSPPPP+       H+ SPPP  HSPPPP   Y
Sbjct: 52  SPPPPYHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPPYHFESPPPPKHSPPPPTPVY 111

Query: 164 VYKSPPPPVKHYSPPPVYH----SPPPPKKHYVYKSPPPPVKHYSPPPVYH----SPPPP 319
            YKSPPPP KH SP PV+H    SPPPP   Y YKSPPPP KH SP P +H    SPPPP
Sbjct: 112 KYKSPPPP-KH-SPAPVHHYKYKSPPPPTPVYKYKSPPPP-KH-SPAPEHHYKYKSPPPP 167

Query: 320 K------KHYVYK 340
           K       HY YK
Sbjct: 168 KHFPAPEHHYKYK 180

 Score =  135 bits (339), Expect = 2e-30
 Identities = 80/168 (47%), Positives = 86/168 (51%), Gaps = 56/168 (33%)
 Frame = +2

Query: 2   KSPPPPV---KHYSPPPVYHSP----------PPPKKH---------YVYKSPPPPV--- 106
           KSPPPP    K+ SPPP  HSP          PPP KH         Y YKSPPPP    
Sbjct: 132 KSPPPPTPVYKYKSPPPPKHSPAPEHHYKYKSPPPPKHFPAPEHHYKYKYKSPPPPTPVY 191

Query: 107 KHYSPPPV-----YHSPPPPKK------HYVYKSPPPPV--------------------K 193
           K+ SPPP      Y SPPPPK       HY YKSPPPP                     K
Sbjct: 192 KYKSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEHSPPPPTPVYK 251

Query: 194 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           + SPPP  HSPPPP   Y YKSPPPP+  +SPPP  +SPPPPK HY Y
Sbjct: 252 YKSPPPPMHSPPPPTPVYKYKSPPPPM--HSPPPPVYSPPPPKHHYSY 297

 Score =  133 bits (335), Expect = 5e-30
 Identities = 82/160 (51%), Positives = 85/160 (53%), Gaps = 47/160 (29%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV----YHSPPPPKK------HYVYKSPPPPV---KHYSPPPVYHSP 142
           +SPPPP KH  PPP     Y SPPPPK       HY YKSPPPP    K+ SPPP  HSP
Sbjct: 95  ESPPPP-KHSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKYKSPPPPKHSP 153

Query: 143 ----------PPPKKH---------YVYKSPPPPV---KHYSPPPV-----YHSPPPPKK 241
                     PPP KH         Y YKSPPPP    K+ SPPP      Y SPPPPK 
Sbjct: 154 APEHHYKYKSPPPPKHFPAPEHHYKYKYKSPPPPTPVYKYKSPPPPTPVYKYKSPPPPKH 213

Query: 242 ------HYVYKSPPPPVKHY-SPPPVYHSPPPPKKHYVYK 340
                 HY YKSPPPP   Y SPPP  HSPPPP   Y YK
Sbjct: 214 SPAPVHHYKYKSPPPPTPVYKSPPPPEHSPPPPTPVYKYK 253

 Score =  127 bits (319), Expect = 4e-28
 Identities = 73/135 (54%), Positives = 80/135 (59%), Gaps = 23/135 (17%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP----------VKHYSPPPVYHSPPPPK 154
           SPPPP   +SPPP  HSPPPP   Y Y+SPPPP           K+ SPPP  HSPPPP 
Sbjct: 38  SPPPP--EHSPPPPEHSPPPP---YHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPP- 91

Query: 155 KHYVYKSPPPPVKHYSPPPV----YHSPPPPK------KHYVYKSPPPPV---KHYSPPP 295
             Y ++SPPPP KH  PPP     Y SPPPPK       HY YKSPPPP    K+ SPPP
Sbjct: 92  --YHFESPPPP-KHSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKYKSPPP 148

Query: 296 VYHSPPPPKKHYVYK 340
             HS P P+ HY YK
Sbjct: 149 PKHS-PAPEHHYKYK 162

 Score =  122 bits (307), Expect = 9e-27
 Identities = 71/129 (55%), Positives = 75/129 (58%), Gaps = 28/129 (21%)
 Frame = +2

Query: 2   KSPPPPV---KHYSPPPV-----YHSPPPPKK------HYVYKSPPPPVKHY-SPPPVYH 136
           KSPPPP    K+ SPPP      Y SPPPPK       HY YKSPPPP   Y SPPP  H
Sbjct: 182 KSPPPPTPVYKYKSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEH 241

Query: 137 SPPPPKKHYVYKSPPPPV----------KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS 286
           SPPPP   Y YKSPPPP+          K+ SPPP  HSPPPP    VY SPPPP  HYS
Sbjct: 242 SPPPPTPVYKYKSPPPPMHSPPPPTPVYKYKSPPPPMHSPPPP----VY-SPPPPKHHYS 296

Query: 287 ---PPPVYH 304
              PPP +H
Sbjct: 297 YTSPPPPHH 305

 Score =  122 bits (305), Expect = 2e-26
 Identities = 72/141 (51%), Positives = 79/141 (56%), Gaps = 28/141 (19%)
 Frame = +2

Query: 2   KSPPPPVK----------HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV----YHS 139
           +SPPPP            + SPPP  HSPPPP   Y ++SPPPP KH  PPP     Y S
Sbjct: 60  ESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPP---YHFESPPPP-KHSPPPPTPVYKYKS 115

Query: 140 PPPPK------KHYVYKSPPPPV---KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 292
           PPPPK       HY YKSPPPP    K+ SPPP  HS P P+ HY YKSPPPP KH+  P
Sbjct: 116 PPPPKHSPAPVHHYKYKSPPPPTPVYKYKSPPPPKHS-PAPEHHYKYKSPPPP-KHFPAP 173

Query: 293 P-----VYHSPPPPKKHYVYK 340
                  Y SPPPP   Y YK
Sbjct: 174 EHHYKYKYKSPPPPTPVYKYK 194

 Score =  120 bits (302), Expect = 4e-26
 Identities = 65/115 (56%), Positives = 70/115 (60%), Gaps = 11/115 (9%)
 Frame = +2

Query: 29  YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK----- 193
           YS PP     PPP +H    SPPPP  + SPPP  HSPPPP   Y YKSPPPP+      
Sbjct: 36  YSSPPPPEHSPPPPEH----SPPPPYHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPP 91

Query: 194 -HY-SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH----SPPPPKKHYVYK 340
            H+ SPPP  HSPPPP   Y YKSPPPP KH SP PV+H    SPPPP   Y YK
Sbjct: 92  YHFESPPPPKHSPPPPTPVYKYKSPPPP-KH-SPAPVHHYKYKSPPPPTPVYKYK 144

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 41/75 (54%), Positives = 42/75 (56%), Gaps = 10/75 (13%)
 Frame = +2

Query: 5   SPPPPV---KHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPPVYHSPPPPK 154
           SPPPP    K+ SPPP  HSPPPP   Y YKSPPPP       V          SPPPPK
Sbjct: 242 SPPPPTPVYKYKSPPPPMHSPPPPTPVYKYKSPPPPMHSPPPPVY---------SPPPPK 292

Query: 155 KHYVYKSPPPPVKHY 199
            HY Y SPPPP  HY
Sbjct: 293 HHYSYTSPPPP-HHY 306

[25][TOP]
>UniRef100_Q9ZUC3 F5O8.27 protein n=1 Tax=Arabidopsis thaliana RepID=Q9ZUC3_ARATH
          Length = 895

 Score =  137 bits (345), Expect = 4e-31
 Identities = 69/118 (58%), Positives = 73/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   Y+Y SPPPP    SP PVY SPPPP   Y
Sbjct: 180 KSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPP---Y 236

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP P Y SPPPP   YVY SPPPP    SP P+Y SPPPP   YVY
Sbjct: 237 VYSSPPPPYYSPSPKPAYKSPPPP---YVYSSPPPPYYSPSPKPIYKSPPPP---YVY 288

 Score =  135 bits (340), Expect = 1e-30
 Identities = 69/118 (58%), Positives = 72/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP P Y SPPPP   Y
Sbjct: 330 KSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP---Y 386

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP PVY SPPPP   Y+Y SPPPP    SP P Y SPPPP   YVY
Sbjct: 387 VYSSPPPPYYSPSPKPVYKSPPPP---YIYNSPPPPYYSPSPKPSYKSPPPP---YVY 438

 Score =  134 bits (337), Expect = 3e-30
 Identities = 68/111 (61%), Positives = 69/111 (62%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP P+Y SPPPP   YVY SPPPP    SP P Y SPPPP   YVY  PPP
Sbjct: 265 SPPPPYYSPSPKPIYKSPPPP---YVYNSPPPPYYSPSPKPAYKSPPPP---YVYSFPPP 318

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           P    SP PVY SPPPP   YVY SPPPP    SP P Y SPPPP   YVY
Sbjct: 319 PYYSPSPKPVYKSPPPP---YVYNSPPPPYYSPSPKPAYKSPPPP---YVY 363

 Score =  134 bits (336), Expect = 4e-30
 Identities = 68/118 (57%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP P Y SPPPP   Y
Sbjct: 632 KSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP---Y 688

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    +P P Y SPPPP   YVY SPPPP    SP P Y SPPPP   YVY
Sbjct: 689 VYSSPPPPYYSPAPKPTYKSPPPP---YVYSSPPPPYYSPSPKPTYKSPPPP---YVY 740

 Score =  132 bits (333), Expect = 9e-30
 Identities = 67/118 (56%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    +P P Y SPPPP   Y
Sbjct: 607 KSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPP---Y 663

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP P Y SPPPP   YVY SPPPP    +P P Y SPPPP   YVY
Sbjct: 664 VYSSPPPPYYSPSPKPTYKSPPPP---YVYSSPPPPYYSPAPKPTYKSPPPP---YVY 715

 Score =  128 bits (322), Expect = 2e-28
 Identities = 67/118 (56%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP PVY SPPPP   Y
Sbjct: 355 KSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPP---Y 411

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           +Y SPPPP    SP P Y SPPPP   YVY SPPPP    SP   Y S PPP   YVY
Sbjct: 412 IYNSPPPPYYSPSPKPSYKSPPPP---YVYSSPPPPYYSPSPKLTYKSSPPP---YVY 463

 Score =  124 bits (312), Expect = 2e-27
 Identities = 69/137 (50%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPV-------KHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP         + SPPP  VY+
Sbjct: 80  KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYN 139

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYS 286
           SPPP    P     YKSPPPP  + SPPP Y+SP P      P   YVY SPPPP    S
Sbjct: 140 SPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPS 199

Query: 287 PPPVYHSPPPPKKHYVY 337
           P P Y SPPPP   Y+Y
Sbjct: 200 PKPTYKSPPPP---YIY 213

 Score =  124 bits (312), Expect = 2e-27
 Identities = 71/140 (50%), Positives = 75/140 (53%), Gaps = 28/140 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY  PPPP    SP PVY SPPPP   Y
Sbjct: 280 KSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPP---Y 336

Query: 164 VYKSPPPPV-------KHYSPPP--VYHSPPP-------------PKKHYVYKSPPPPVK 277
           VY SPPPP         + SPPP  VY SPPP             P   YVY SPPPP  
Sbjct: 337 VYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYY 396

Query: 278 HYSPPPVYHSPPPPKKHYVY 337
             SP PVY SPPPP   Y+Y
Sbjct: 397 SPSPKPVYKSPPPP---YIY 413

 Score =  124 bits (311), Expect = 3e-27
 Identities = 71/133 (53%), Positives = 73/133 (54%), Gaps = 22/133 (16%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP PVY SPPPP   YVY SPPPP    SP P Y SPPPP   YVY SPPP
Sbjct: 215 SPPPPYYSPSPKPVYKSPPPP---YVYSSPPPPYYSPSPKPAYKSPPPP---YVYSSPPP 268

Query: 185 PVK-------HYSPPP--VYHSPPP-------------PKKHYVYKSPPPPVKHYSPPPV 298
           P         + SPPP  VY+SPPP             P   YVY  PPPP    SP PV
Sbjct: 269 PYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPV 328

Query: 299 YHSPPPPKKHYVY 337
           Y SPPPP   YVY
Sbjct: 329 YKSPPPP---YVY 338

 Score =  123 bits (308), Expect = 7e-27
 Identities = 63/112 (56%), Positives = 67/112 (59%), Gaps = 6/112 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH------YVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P   +      YVY SPPPP    SP  VY SPPPP   Y
Sbjct: 430 KSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPP---Y 486

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           VY SPPPP    SP P Y SPPPP   YVY SPPPP    SP  +Y SPP P
Sbjct: 487 VYSSPPPPYYSPSPKPSYKSPPPP---YVYNSPPPPYYSPSPKVIYKSPPHP 535

 Score =  123 bits (308), Expect = 7e-27
 Identities = 72/142 (50%), Positives = 77/142 (54%), Gaps = 30/142 (21%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
            KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP P Y SPPPP   Y
Sbjct: 682  KSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP---Y 738

Query: 164  VYKSPPPP--------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPP-- 295
            VY SPPPP        V++ SPPP  VY SPPP    P     YKSPPPP  + SPPP  
Sbjct: 739  VYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPP 798

Query: 296  --------VYHSPPPPKKHYVY 337
                     Y SPPPP   YVY
Sbjct: 799  YYSPSPKVEYKSPPPP---YVY 817

 Score =  122 bits (307), Expect = 9e-27
 Identities = 68/122 (55%), Positives = 69/122 (56%), Gaps = 10/122 (8%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV----------YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 151
           KSPPPP  + SPPP           Y SPPPP   YVY SPPPP    SP   Y SPPPP
Sbjct: 29  KSPPPPYVYSSPPPPLSYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVEYKSPPPP 85

Query: 152 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
              YVY SPPPP    SP   Y SPPPP   YVY SPPPP    SP P Y SPPPP   Y
Sbjct: 86  ---YVYSSPPPPYYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKPTYKSPPPP---Y 136

Query: 332 VY 337
           VY
Sbjct: 137 VY 138

 Score =  121 bits (304), Expect = 2e-26
 Identities = 68/137 (49%), Positives = 77/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  +   YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 130 KSPPPPYVYNSPPPPYYSPSPKVE---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 186

Query: 164 VYKSPPPPV-------KHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP         + SPPP  +Y SPPP    P    VYKSPPPP  + SPPP Y+
Sbjct: 187 VYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYY 246

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 247 SPSPKPAYKSPPPPYVY 263

 Score =  121 bits (304), Expect = 2e-26
 Identities = 68/142 (47%), Positives = 73/142 (51%), Gaps = 30/142 (21%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP-------PKKHYVYKSPPPPVKHYSP---------PPVY 133
           KSPPPP  + SPPP Y+SP P       P  H     PPPP   +SP         P VY
Sbjct: 505 KSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSPKIEYKSPPTPYVY 564

Query: 134 HSPPPPKKH--------------YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 271
           HSPPPP  +              YVY SPPPP    +P PVY SPPPP   YVY SPPPP
Sbjct: 565 HSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPP---YVYNSPPPP 621

Query: 272 VKHYSPPPVYHSPPPPKKHYVY 337
               SP P Y SPPPP   YVY
Sbjct: 622 YYSPSPKPTYKSPPPP---YVY 640

 Score =  120 bits (302), Expect = 4e-26
 Identities = 70/136 (51%), Positives = 71/136 (52%), Gaps = 25/136 (18%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP PVY SPPPP   Y+Y SPPPP    SP P Y SPPPP   YVY SPPP
Sbjct: 390 SPPPPYYSPSPKPVYKSPPPP---YIYNSPPPPYYSPSPKPSYKSPPPP---YVYSSPPP 443

Query: 185 PVKH---------------YSPPP----------VYHSPPPPKKHYVYKSPPPPVKHYSP 289
           P                  YS PP          VY SPPPP   YVY SPPPP    SP
Sbjct: 444 PYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPP---YVYSSPPPPYYSPSP 500

Query: 290 PPVYHSPPPPKKHYVY 337
            P Y SPPPP   YVY
Sbjct: 501 KPSYKSPPPP---YVY 513

 Score =  120 bits (302), Expect = 4e-26
 Identities = 71/142 (50%), Positives = 80/142 (56%), Gaps = 32/142 (22%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKK 157
            KSPPPP  + SPPP Y+SP P      P   YVY SPPPP  +YSP P   Y SPPPP  
Sbjct: 758  KSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP-PYYSPSPKVEYKSPPPP-- 814

Query: 158  HYVYKSPPPP--------VKHYSPPP--VYHSPPPPKKH-----YVYKSPPPPVKHYSPP 292
             YVY SPPPP        V++ SPPP  VY+SPPPP  +       YKSPPPP  + SPP
Sbjct: 815  -YVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSPP 873

Query: 293  P---------VYHSPPPPKKHY 331
            P          Y SPPPP  +Y
Sbjct: 874  PPSYSPSPKAEYKSPPPPSLYY 895

 Score =  120 bits (301), Expect = 5e-26
 Identities = 64/124 (51%), Positives = 70/124 (56%), Gaps = 19/124 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPV---------KHYSPPPVYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP          K   PP VY 
Sbjct: 405 KSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYS 464

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           SPPP    P    VYKSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+
Sbjct: 465 SPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPS---YKSPPPPYVYNSPPPPYY 521

Query: 305 SPPP 316
           SP P
Sbjct: 522 SPSP 525

 Score =  119 bits (297), Expect = 1e-25
 Identities = 68/132 (51%), Positives = 70/132 (53%), Gaps = 22/132 (16%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP    SP P Y S PPP   YVY SPPPP    +P PVY SPPPP   YVY SPPPP
Sbjct: 568 PPPPYYSPSPKPAYKSSPPP---YVYSSPPPPYYSPAPKPVYKSPPPP---YVYNSPPPP 621

Query: 188 V-------KHYSPPP--VYHSPPP-------------PKKHYVYKSPPPPVKHYSPPPVY 301
                    + SPPP  VY SPPP             P   YVY SPPPP    SP P Y
Sbjct: 622 YYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTY 681

Query: 302 HSPPPPKKHYVY 337
            SPPPP   YVY
Sbjct: 682 KSPPPP---YVY 690

 Score =  114 bits (286), Expect = 3e-24
 Identities = 62/114 (54%), Positives = 64/114 (56%), Gaps = 9/114 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP  VY SPPPP   YVY SPPPP    SP P Y SPPPP   YVY SPPP
Sbjct: 465 SPPPPYYSPSPKVVYKSPPPP---YVYSSPPPPYYSPSPKPSYKSPPPP---YVYNSPPP 518

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP---------PPVYHSPPPP 319
           P    SP  +Y SPP P  H     PPPP   +SP         P VYHSPPPP
Sbjct: 519 PYYSPSPKVIYKSPPHP--HVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPPPP 570

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 57/114 (50%), Positives = 63/114 (55%), Gaps = 14/114 (12%)
 Frame = +2

Query: 38  PPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPP 211
           P  Y SPPPP    +Y SP P V + SPPP  VY SPPPP  +    SP P V + SPPP
Sbjct: 8   PYTYSSPPPP----LYDSPTPKVDYKSPPPPYVYSSPPPPLSY----SPSPKVDYKSPPP 59

Query: 212 --VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
             VY SPPP    P     YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 60  PYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 113

[26][TOP]
>UniRef100_Q9C669 Putative uncharacterized protein F28B23.9 n=1 Tax=Arabidopsis
           thaliana RepID=Q9C669_ARATH
          Length = 443

 Score =  136 bits (343), Expect = 6e-31
 Identities = 80/126 (63%), Positives = 81/126 (64%), Gaps = 15/126 (11%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYV 166
           PPPP  + SPPP   VY SPPPP   YVYKSPPPP   YS PP    VY SPPPP   YV
Sbjct: 101 PPPPYVYKSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSSPPPPPYVYSSPPPPP--YV 156

Query: 167 YKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPK 322
           YKSPPPP   YSPPP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP 
Sbjct: 157 YKSPPPPPYVYSPPPPPPYVYQSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 214

Query: 323 KHYVYK 340
             YVYK
Sbjct: 215 --YVYK 218

 Score =  135 bits (341), Expect = 1e-30
 Identities = 81/128 (63%), Positives = 81/128 (63%), Gaps = 16/128 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKK 157
           KSPPPP   YS PP    VY SPPPP   YVYKSPPPP   YSPPP    VY SPPPP  
Sbjct: 128 KSPPPPPYVYSSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSPPPPPPYVYQSPPPPP- 184

Query: 158 HYVYKSPPPPVKHY-SPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPP 313
            YVY SPPPP   Y SPPP   VY SPPPP   YVYKSPPPP   YS PP    VY SPP
Sbjct: 185 -YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSSPPPPPYVYKSPP 241

Query: 314 PPKKHYVY 337
           PP   YVY
Sbjct: 242 PPP--YVY 247

 Score =  135 bits (340), Expect = 1e-30
 Identities = 79/125 (63%), Positives = 81/125 (64%), Gaps = 15/125 (12%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKKHYV 166
           PPPP  + SPPP   VY+SPPPP   YVY SPPPP   Y SPPP   VY SPPPP   YV
Sbjct: 71  PPPPYVYSSPPPPPYVYNSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP--YV 126

Query: 167 YKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPK 322
           YKSPPPP   YS PP    VY SPPPP   YVYKSPPPP   YSPPP    VY SPPPP 
Sbjct: 127 YKSPPPPPYVYSSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSPPPPPPYVYQSPPPPP 184

Query: 323 KHYVY 337
             YVY
Sbjct: 185 --YVY 187

 Score =  134 bits (338), Expect = 2e-30
 Identities = 82/129 (63%), Positives = 82/129 (63%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKK 157
           KSPPPP   YSPPP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP  
Sbjct: 158 KSPPPPPYVYSPPPPPPYVYQSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP- 214

Query: 158 HYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPP 313
            YVYKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPP
Sbjct: 215 -YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPP 271

Query: 314 PPKKHYVYK 340
           PP   YVYK
Sbjct: 272 PPP--YVYK 278

 Score =  130 bits (328), Expect = 3e-29
 Identities = 81/129 (62%), Positives = 81/129 (62%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKK 157
           KSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP  
Sbjct: 218 KSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP- 274

Query: 158 HYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPP 313
            YVYKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPP
Sbjct: 275 -YVYKSPPPPPYVYSSPPPPPYVYSSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYTSPP 331

Query: 314 PPKKHYVYK 340
           PP   YVYK
Sbjct: 332 PPP--YVYK 338

 Score =  130 bits (326), Expect = 6e-29
 Identities = 77/125 (61%), Positives = 79/125 (63%), Gaps = 15/125 (12%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYV 166
           PPPP  + SPPP   VY SPPPP   YVYKSPPPP   YS PP    VY SPPPP   YV
Sbjct: 191 PPPPYVYKSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YV 246

Query: 167 YKSPPPP-VKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPK 322
           Y SPPPP   + SPPP   VY SPPPP   YVYKSPPPP   YS PP    VY SPPPP 
Sbjct: 247 YSSPPPPPYVYKSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSSPPPPPYVYSSPPPPP 304

Query: 323 KHYVY 337
             YVY
Sbjct: 305 --YVY 307

 Score =  127 bits (320), Expect = 3e-28
 Identities = 75/125 (60%), Positives = 78/125 (62%), Gaps = 14/125 (11%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYS---PPPVYHSPPPPKKHYVY 169
           PPPP  + SPPP   VY SPPPP   YVY SPPPP   Y    PPP  +SPPPP   YVY
Sbjct: 121 PPPPYVYKSPPPPPYVYSSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSPPPPPP-YVY 177

Query: 170 KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKK 325
           +SPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP  
Sbjct: 178 QSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP- 234

Query: 326 HYVYK 340
            YVYK
Sbjct: 235 -YVYK 238

 Score =  124 bits (311), Expect = 3e-27
 Identities = 75/130 (57%), Positives = 80/130 (61%), Gaps = 18/130 (13%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP-VYHSPPPPK-----KHYVYKSPPPPVKHYSPPP----VYHSPPPPK 154
           SP PP  + SPPP VY+SP PP        Y+Y SPPPP   YS PP    VY+SPPPP 
Sbjct: 35  SPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPP 94

Query: 155 KHYVYKSPPPP-VKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSP 310
             YVY SPPPP   + SPPP   VY SPPPP   YVYKSPPPP   YS PP    VY SP
Sbjct: 95  --YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSSPPPPPYVYSSP 150

Query: 311 PPPKKHYVYK 340
           PPP   YVYK
Sbjct: 151 PPPP--YVYK 158

 Score =  120 bits (300), Expect = 6e-26
 Identities = 71/127 (55%), Positives = 72/127 (56%), Gaps = 14/127 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYS---PPPVYHSPPPPKKH 160
           KSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y    PPP  +S PPP   
Sbjct: 238 KSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP- 294

Query: 161 YVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYS---PPPVYHSPPPP 319
           YVY SPPPP   YS PP    VY SPPPP   YVY SPPPP   Y    PPP   S  PP
Sbjct: 295 YVYSSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYTSPPPPPYVYKSPPPPPYVDSYSPP 352

Query: 320 KKHYVYK 340
              YVYK
Sbjct: 353 PAPYVYK 359

 Score =  119 bits (297), Expect = 1e-25
 Identities = 69/120 (57%), Positives = 72/120 (60%), Gaps = 9/120 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPKKHYVYKSPP 181
           SP P      PP VY+SPPP    YVY SP PP   Y PPP +Y SPPPP   YVY SPP
Sbjct: 28  SPTPTPYSPLPPYVYNSPPP----YVYNSPSPPPYVYKPPPYIYSSPPPPP--YVYSSPP 81

Query: 182 PPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVY 337
           PP   Y+ PP    VY SPPPP   YVYKSPPPP   YS PP    VY SPPPP   YVY
Sbjct: 82  PPPYVYNSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVY 137

 Score =  118 bits (296), Expect = 2e-25
 Identities = 76/138 (55%), Positives = 78/138 (56%), Gaps = 27/138 (19%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPP------- 145
           PPPP  + SPPP   VY SPPPP   YVY SPPPP   YS PP    VY SPP       
Sbjct: 271 PPPPYVYKSPPPPPYVYSSPPPPP--YVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYT 328

Query: 146 -PPKKHYVYKSPPPP--VKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPP---VYH 304
            PP   YVYKSPPPP  V  YSPPP  Y   PPP   YVYK PPP V +YSPPP   VY 
Sbjct: 329 SPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPP---YVYK-PPPYVYNYSPPPAPYVYK 384

Query: 305 SPP------PPKKHYVYK 340
            PP      PP   YVYK
Sbjct: 385 PPPYVYSYSPPPAPYVYK 402

 Score =  118 bits (296), Expect = 2e-25
 Identities = 77/147 (52%), Positives = 79/147 (53%), Gaps = 34/147 (23%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKK 157
           KSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP  
Sbjct: 278 KSPPPPPYVYSSPPPPPYVYSSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYTSPPPPP- 334

Query: 158 HYVYKSPPPP--VKHYSPPP----------VYHSPP------PPKKHYVYKSPP------ 265
            YVYKSPPPP  V  YSPPP          VY  PP      PP   YVYK PP      
Sbjct: 335 -YVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPPAPYVYKPPPYVYSYS 393

Query: 266 -PPVKH-YSPPPVYHSPPPPKKHYVYK 340
            PP  + Y PPP  +S  PP   YVYK
Sbjct: 394 PPPAPYVYKPPPYVYSYSPPPAPYVYK 420

 Score =  111 bits (278), Expect = 2e-23
 Identities = 70/134 (52%), Positives = 71/134 (52%), Gaps = 30/134 (22%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPP--VKHYSPPP----------VYHSP 142
           PPPP  + SPPP   VY SPPPP   YVYKSPPPP  V  YSPPP          VY  P
Sbjct: 311 PPPPYVYKSPPPPPYVYTSPPPPP--YVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPP 368

Query: 143 P------PPKKHYVYKSPPPPVKHYSPPP---VYHSPP------PPKKHYVYKSPPPPVK 277
           P      PP   YVYK PPP V  YSPPP   VY  PP      PP   YVYK PP    
Sbjct: 369 PYVYNYSPPPAPYVYK-PPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYS 427

Query: 278 HYSPPPVYHSPPPP 319
             SPPP Y SP PP
Sbjct: 428 SPSPPPYYSSPSPP 441

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/86 (54%), Positives = 51/86 (59%), Gaps = 10/86 (11%)
 Frame = +2

Query: 113 YSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPV 274
           YSP P  +SP PP  +     YVY SP PP   Y PPP +Y SPPPP   YVY SPPPP 
Sbjct: 27  YSPTPTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPP--YVYSSPPPPP 84

Query: 275 KHYSPPP----VYHSPPPPKKHYVYK 340
             Y+ PP    VY SPPPP   YVYK
Sbjct: 85  YVYNSPPPPPYVYSSPPPPP--YVYK 108

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 26/49 (53%), Positives = 27/49 (55%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 151
           SPPP    Y PPP  +S  PP   YVYK PP      SPPP Y SP PP
Sbjct: 393 SPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPPPYYSSPSPP 441

[27][TOP]
>UniRef100_Q06446 Extensin n=1 Tax=Solanum tuberosum RepID=Q06446_SOLTU
          Length = 291

 Score =  136 bits (343), Expect = 6e-31
 Identities = 79/131 (60%), Positives = 80/131 (61%), Gaps = 19/131 (14%)
 Frame = +2

Query: 2   KSPPPPVKHY-SPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP   Y SPPP   VY SPPPP    VYKSPPPPVK Y P PVY SPPPP    VY
Sbjct: 160 KSPPPPTPVYKSPPPPTPVYKSPPPPTP--VYKSPPPPVKPYHPAPVYKSPPPPTP--VY 215

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK-------HYSPPPVYHSPP----- 313
           KSPP  VK Y P PVY SPPPP    +YKSPPPPVK        Y P PVY SPP     
Sbjct: 216 KSPP--VKPYHPAPVYKSPPPPTP--IYKSPPPPVKPYHPSPTPYHPKPVYKSPPPPTPV 271

Query: 314 ---PPKKHYVY 337
              PP  HYVY
Sbjct: 272 YKSPPPTHYVY 282

 Score =  129 bits (323), Expect = 1e-28
 Identities = 78/140 (55%), Positives = 79/140 (56%), Gaps = 30/140 (21%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHY-SPPP-----------VYHS 139
           KSPPPP   + PP  PVY SPPP   H VYK PPPP   Y SPPP           VY S
Sbjct: 102 KSPPPPKTPHYPPHTPVYKSPPPHHHHPVYKFPPPPTPVYKSPPPPKDPHYPPHTPVYKS 161

Query: 140 PPPPKKHYVYKSPPPPVKHY-SPP---PVYHSPPPPKKHY----VYKSPP--------PP 271
           PPPP    VYKSPPPP   Y SPP   PVY SPPPP K Y    VYKSPP        PP
Sbjct: 162 PPPPTP--VYKSPPPPTPVYKSPPPPTPVYKSPPPPVKPYHPAPVYKSPPPPTPVYKSPP 219

Query: 272 VKHYSPPPVYHSPPPPKKHY 331
           VK Y P PVY SPPPP   Y
Sbjct: 220 VKPYHPAPVYKSPPPPTPIY 239

 Score =  128 bits (321), Expect = 2e-28
 Identities = 71/114 (62%), Positives = 74/114 (64%), Gaps = 4/114 (3%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVK Y P PVY SPPPP    VYKSPP  VK Y P PVY SPPPP    +YKSPP
Sbjct: 190 KSPPPPVKPYHPAPVYKSPPPPTP--VYKSPP--VKPYHPAPVYKSPPPPTP--IYKSPP 243

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPP---VYHSPPPPKKHY 331
           PPVK Y P P  + P P     VYKSPPPP   + SPPP   VY SPPPP  HY
Sbjct: 244 PPVKPYHPSPTPYHPKP-----VYKSPPPPTPVYKSPPPTHYVYSSPPPP-YHY 291

 Score =  126 bits (316), Expect = 9e-28
 Identities = 78/134 (58%), Positives = 80/134 (59%), Gaps = 24/134 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK-HY--- 163
           KSPPP  K + PP  PVY SPPP   H VYKSPPPP       PVY SPPPPK  HY   
Sbjct: 62  KSPPPSEKPHYPPHTPVYKSPPPHHHHPVYKSPPPPT------PVYKSPPPPKTPHYPPH 115

Query: 164 --VYKSPPP----PVKHYSPP--PVYHSPPPPK-KHY-----VYKSPPPPVKHY-SPP-- 292
             VYKSPPP    PV  + PP  PVY SPPPPK  HY     VYKSPPPP   Y SPP  
Sbjct: 116 TPVYKSPPPHHHHPVYKFPPPPTPVYKSPPPPKDPHYPPHTPVYKSPPPPTPVYKSPPPP 175

Query: 293 -PVYHSPPPPKKHY 331
            PVY SPPPP   Y
Sbjct: 176 TPVYKSPPPPTPVY 189

 Score =  125 bits (315), Expect = 1e-27
 Identities = 77/128 (60%), Positives = 79/128 (61%), Gaps = 19/128 (14%)
 Frame = +2

Query: 5   SPPPPVKHY--SPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYV 166
           SPPPPV H   SPP  PVY SPPP   H VYKSPPP  K + PP  PVY SPPP   H V
Sbjct: 32  SPPPPV-HVYPSPPHHPVYKSPPPHHHHPVYKSPPPSEKPHYPPHTPVYKSPPPHHHHPV 90

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPK-KHY-----VYKSPPP----PVKHYSPP--PVYHSP 310
           YKSPPPP       PVY SPPPPK  HY     VYKSPPP    PV  + PP  PVY SP
Sbjct: 91  YKSPPPPT------PVYKSPPPPKTPHYPPHTPVYKSPPPHHHHPVYKFPPPPTPVYKSP 144

Query: 311 PPPK-KHY 331
           PPPK  HY
Sbjct: 145 PPPKDPHY 152

 Score =  107 bits (267), Expect = 4e-22
 Identities = 61/106 (57%), Positives = 63/106 (59%), Gaps = 17/106 (16%)
 Frame = +2

Query: 74  HYVYKSPPPPVKHY-SPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPK 238
           +Y Y SPPPPV  Y SPP  PVY SPPP   H VYKSPPP  K + PP  PVY SPPP  
Sbjct: 27  NYQYSSPPPPVHVYPSPPHHPVYKSPPPHHHHPVYKSPPPSEKPHYPPHTPVYKSPPPHH 86

Query: 239 KHYVYKSPPPPVKHY-SPP-----------PVYHSPPPPKKHYVYK 340
            H VYKSPPPP   Y SPP           PVY SPPP   H VYK
Sbjct: 87  HHPVYKSPPPPTPVYKSPPPPKTPHYPPHTPVYKSPPPHHHHPVYK 132

[28][TOP]
>UniRef100_Q94ES7 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES7_PEA
          Length = 145

 Score =  136 bits (342), Expect = 8e-31
 Identities = 70/110 (63%), Positives = 70/110 (63%), Gaps = 10/110 (9%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPPP---KKHYVYKSPPPPVKH 196
           SPPP  HSPPPPK  Y Y SPPPP  H    P PVYHSPPPP   KK Y Y SPPPP  H
Sbjct: 34  SPPPPVHSPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPAH 93

Query: 197 Y--SPPPVYHSPPPP-KKHYVYKSPPPPVKHY--SPPPVYHSPPPPKKHY 331
               P PVYHSPPPP KK Y Y SPPPP  H    P PVYHSPPPP   Y
Sbjct: 94  TYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPAHTY 143

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/91 (63%), Positives = 58/91 (63%), Gaps = 10/91 (10%)
 Frame = +2

Query: 5   SPPPPVKHY--SPPPVYHSPPPP---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP-KKH 160
           SPPPP  H    P PVYHSPPPP   KK Y Y SPPPP  H    P PVYHSPPPP KK 
Sbjct: 53  SPPPPPAHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPAHTYPHPHPVYHSPPPPHKKP 112

Query: 161 YVYKSPPPP-VKHY-SPPPVYHSPPPPKKHY 247
           Y Y SPPPP V  Y  P PVYHSPPPP   Y
Sbjct: 113 YKYSSPPPPPVHTYPHPHPVYHSPPPPAHTY 143

 Score =  101 bits (252), Expect = 2e-20
 Identities = 57/95 (60%), Positives = 57/95 (60%), Gaps = 8/95 (8%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPPP---KK 241
           Y Y SPPPPV         HSPPPPK  Y Y SPPPP  H    P PVYHSPPPP   KK
Sbjct: 30  YSYSSPPPPV---------HSPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPTPHKK 80

Query: 242 HYVYKSPPPP-VKHY-SPPPVYHSPPPP-KKHYVY 337
            Y Y SPPPP    Y  P PVYHSPPPP KK Y Y
Sbjct: 81  PYKYPSPPPPPAHTYPHPHPVYHSPPPPHKKPYKY 115

[29][TOP]
>UniRef100_B9NAX9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NAX9_POPTR
          Length = 312

 Score =  135 bits (341), Expect = 1e-30
 Identities = 82/128 (64%), Positives = 83/128 (64%), Gaps = 20/128 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKK 157
           KSPPPP +  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPPPKK
Sbjct: 35  KSPPPPSQ--SPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKK--SPPPPYHYSSPPPPKK 90

Query: 158 H----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH- 304
                Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH 
Sbjct: 91  SPPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHY 146

Query: 305 -SPPPPKK 325
            SPPPPKK
Sbjct: 147 SSPPPPKK 154

 Score =  135 bits (341), Expect = 1e-30
 Identities = 82/127 (64%), Positives = 82/127 (64%), Gaps = 20/127 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH 160
           SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPPPKK 
Sbjct: 52  SPPPPKK--SPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKS 107

Query: 161 ----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH-- 304
               Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  
Sbjct: 108 PPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYS 163

Query: 305 SPPPPKK 325
           SPPPPKK
Sbjct: 164 SPPPPKK 170

 Score =  135 bits (341), Expect = 1e-30
 Identities = 82/127 (64%), Positives = 82/127 (64%), Gaps = 20/127 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH 160
           SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPPPKK 
Sbjct: 148 SPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYTSPPPPKKS 203

Query: 161 ----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH-- 304
               Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  
Sbjct: 204 PPPPYHYSSPPPPKK--SPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYS 259

Query: 305 SPPPPKK 325
           SPPPPKK
Sbjct: 260 SPPPPKK 266

 Score =  135 bits (341), Expect = 1e-30
 Identities = 82/127 (64%), Positives = 82/127 (64%), Gaps = 20/127 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH 160
           SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPPPKK 
Sbjct: 180 SPPPPKK--SPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYTSPPPPKKS 235

Query: 161 ----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH-- 304
               Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  
Sbjct: 236 PPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYS 291

Query: 305 SPPPPKK 325
           SPPPPKK
Sbjct: 292 SPPPPKK 298

 Score =  135 bits (339), Expect = 2e-30
 Identities = 82/127 (64%), Positives = 82/127 (64%), Gaps = 20/127 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH 160
           SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPPPKK 
Sbjct: 132 SPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKS 187

Query: 161 ----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH-- 304
               Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  
Sbjct: 188 PPPPYHYTSPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKK--SPPPPYHYS 243

Query: 305 SPPPPKK 325
           SPPPPKK
Sbjct: 244 SPPPPKK 250

 Score =  135 bits (339), Expect = 2e-30
 Identities = 82/127 (64%), Positives = 82/127 (64%), Gaps = 20/127 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH 160
           SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPPPKK 
Sbjct: 164 SPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKK--SPPPPYHYSSPPPPKKS 219

Query: 161 ----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH-- 304
               Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  
Sbjct: 220 PPPPYHYTSPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYS 275

Query: 305 SPPPPKK 325
           SPPPPKK
Sbjct: 276 SPPPPKK 282

 Score =  132 bits (333), Expect = 9e-30
 Identities = 84/141 (59%), Positives = 84/141 (59%), Gaps = 34/141 (24%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH 160
           SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPPPKK 
Sbjct: 68  SPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKS 123

Query: 161 ----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVK------HY--- 283
               Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K      HY   
Sbjct: 124 PPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSP 181

Query: 284 -----SPPPVYH--SPPPPKK 325
                SPPP YH  SPPPPKK
Sbjct: 182 PPPKKSPPPPYHYTSPPPPKK 202

 Score =  132 bits (333), Expect = 9e-30
 Identities = 84/141 (59%), Positives = 84/141 (59%), Gaps = 34/141 (24%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH 160
           SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPPPKK 
Sbjct: 84  SPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKS 139

Query: 161 ----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVK------HY--- 283
               Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K      HY   
Sbjct: 140 PPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSP 197

Query: 284 -----SPPPVYH--SPPPPKK 325
                SPPP YH  SPPPPKK
Sbjct: 198 PPPKKSPPPPYHYSSPPPPKK 218

 Score =  132 bits (332), Expect = 1e-29
 Identities = 84/141 (59%), Positives = 84/141 (59%), Gaps = 34/141 (24%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH 160
           SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPPPKK 
Sbjct: 100 SPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKS 155

Query: 161 ----YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVK------HY--- 283
               Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K      HY   
Sbjct: 156 PPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSP 213

Query: 284 -----SPPPVYH--SPPPPKK 325
                SPPP YH  SPPPPKK
Sbjct: 214 PPPKKSPPPPYHYTSPPPPKK 234

 Score =  128 bits (322), Expect = 2e-28
 Identities = 78/121 (64%), Positives = 78/121 (64%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH---- 160
           KSPPPP  HY SPPP   SPPPP   Y Y SPPPP K  SPPP YH  SPPPPKK     
Sbjct: 202 KSPPPPY-HYSSPPPPKKSPPPP---YHYTSPPPPKK--SPPPPYHYSSPPPPKKSPPPP 255

Query: 161 YVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPP 316
           Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPP
Sbjct: 256 YHYSSPPPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYTSPPP 311

Query: 317 P 319
           P
Sbjct: 312 P 312

 Score =  124 bits (311), Expect = 3e-27
 Identities = 73/117 (62%), Positives = 74/117 (63%), Gaps = 14/117 (11%)
 Frame = +2

Query: 17  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSP 178
           P  + SPPP   SPPPP   Y Y SPPPP K  SPPP YH  SPPPPKK     Y Y SP
Sbjct: 31  PYYYKSPPPPSQSPPPP---YHYSSPPPPKK--SPPPPYHYTSPPPPKKSPPPPYHYSSP 85

Query: 179 PPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH--SPPPPKK 325
           PPP K  SPPP YH  SPPPPKK     Y Y SPPPP K  SPPP YH  SPPPPKK
Sbjct: 86  PPPKK--SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK--SPPPPYHYSSPPPPKK 138

[30][TOP]
>UniRef100_Q43682 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43682_VIGUN
          Length = 280

 Score =  135 bits (340), Expect = 1e-30
 Identities = 73/125 (58%), Positives = 73/125 (58%), Gaps = 12/125 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP VY SPPPP       YVYKSPPPP     PP VY SPPPP      
Sbjct: 13  KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPP 72

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            YVYKSPPPP     PP VY SPPPP       YVYKSPPPP     PP VY SPPPP  
Sbjct: 73  PYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPP 132

Query: 326 HYVYK 340
            YVYK
Sbjct: 133 -YVYK 136

 Score =  135 bits (340), Expect = 1e-30
 Identities = 71/120 (59%), Positives = 73/120 (60%), Gaps = 8/120 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   YVYKSPPPP     PP VY SPPPP   YVYKSPPP
Sbjct: 85  SPPPPYVYKSPPPPSPSPPPP---YVYKSPPPPSPSPPPPYVYKSPPPPPP-YVYKSPPP 140

Query: 185 PVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 340
           P     PP VY SPPPP       YVYKSPPPP     PP +Y SPPPP       YVYK
Sbjct: 141 PSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYK 200

 Score =  135 bits (339), Expect = 2e-30
 Identities = 72/125 (57%), Positives = 73/125 (58%), Gaps = 12/125 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVY 169
           KSPPPP     PP VY SPPPP   YVYKSPPPP     PP VY SPPPP       YVY
Sbjct: 109 KSPPPPSPSPPPPYVYKSPPPPPP-YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVY 167

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 328
           KSPPPP     PP +Y SPPPP       YVYKSPPPP     PP VY SPPPP      
Sbjct: 168 KSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPP 227

Query: 329 -YVYK 340
            YVYK
Sbjct: 228 PYVYK 232

 Score =  129 bits (324), Expect = 1e-28
 Identities = 71/121 (58%), Positives = 72/121 (59%), Gaps = 9/121 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   YVYKSPPPP     PP VY SPPPP       YVYK
Sbjct: 53  SPPPPYVYKSPPPPSPSPPPP---YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYK 109

Query: 173 SPPPPVKHYSPPPVYH-SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVY 337
           SPPPP     PP VY   PPPP   YVYKSPPPP     PP VY SPPPP       YVY
Sbjct: 110 SPPPPSPSPPPPYVYKSPPPPPP--YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVY 167

Query: 338 K 340
           K
Sbjct: 168 K 168

 Score =  129 bits (323), Expect = 1e-28
 Identities = 72/122 (59%), Positives = 74/122 (60%), Gaps = 10/122 (8%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   YVYKSPPPP     PP VY SPPPP       YVYK
Sbjct: 69  SPPPPYVYKSPPPPSPSPPPP---YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYK 125

Query: 173 SPPPPVK-HY-SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YV 334
           SPPPP    Y SPPP   SPPPP   YVYKSPPPP     PP VY SPPPP       Y+
Sbjct: 126 SPPPPPPYVYKSPPPPSPSPPPP---YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYI 182

Query: 335 YK 340
           YK
Sbjct: 183 YK 184

 Score =  128 bits (321), Expect = 2e-28
 Identities = 71/124 (57%), Positives = 72/124 (58%), Gaps = 12/124 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SP PP   YVYKSPPPP     PP VY SPPPP       YVYK
Sbjct: 5   SPPPPYVYKSPPPP--SPSPPPP-YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYK 61

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 328
           SPPPP     PP VY SPPPP       YVYKSPPPP     PP VY SPPPP       
Sbjct: 62  SPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPP 121

Query: 329 YVYK 340
           YVYK
Sbjct: 122 YVYK 125

 Score =  125 bits (313), Expect = 2e-27
 Identities = 71/125 (56%), Positives = 72/125 (57%), Gaps = 14/125 (11%)
 Frame = +2

Query: 5   SPPPPV--KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YV 166
           SPPPP   K  SPPP   SPPPP   Y+YKSPPPP     PP VY SPPPP       YV
Sbjct: 160 SPPPPYVYK--SPPPPSPSPPPP---YIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYV 214

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH-- 328
           YKSPPPP     PP VY SPPPP       YVYKSPPPP     PP VY SPPPP     
Sbjct: 215 YKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPP 274

Query: 329 --YVY 337
             YVY
Sbjct: 275 PPYVY 279

 Score =  116 bits (291), Expect = 7e-25
 Identities = 64/112 (57%), Positives = 64/112 (57%), Gaps = 12/112 (10%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPP 208
           P   SPPPP   YVYKSPPPP     PP VY SPPPP       YVYKSPPPP     PP
Sbjct: 1   PPSPSPPPP---YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPP 57

Query: 209 PVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 340
            VY SPPPP       YVYKSPPPP     PP VY SPPPP       YVYK
Sbjct: 58  YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYK 109

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/84 (57%), Positives = 49/84 (58%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP     PP VY SPPPP       SPPPP  + SPPP   SPPPP   YVYKSPP
Sbjct: 216 KSPPPPSPSPPPPYVYKSPPPPS-----PSPPPPYVYKSPPPPSPSPPPP---YVYKSPP 267

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVY 253
           PP    SP     SPPPP   YVY
Sbjct: 268 PP----SP-----SPPPP---YVY 279

[31][TOP]
>UniRef100_Q94ES8 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES8_PEA
          Length = 195

 Score =  135 bits (339), Expect = 2e-30
 Identities = 73/122 (59%), Positives = 74/122 (60%), Gaps = 14/122 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPP-PVYHSPPPP---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP-KKHY 163
           SPPPPV  Y  P PVYHSPPPP   KK Y Y SPPPP  H    P PVYHSPPPP KK Y
Sbjct: 71  SPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPY 130

Query: 164 VYKSPPPPVKHY--SPPPVYHSPPP-----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
            Y SPPPP  H    P PVYHSPPP     P  H VY SPPPP   +  P  Y SPPPP 
Sbjct: 131 KYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPP 190

Query: 323 KH 328
            H
Sbjct: 191 AH 192

 Score =  134 bits (338), Expect = 2e-30
 Identities = 77/128 (60%), Positives = 77/128 (60%), Gaps = 19/128 (14%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV----YHSPPPPKKHY------VYKSPPPPVKHYSPP-PVYHSPPPP 151
           SPPPPV H  PPP     Y SPPPP  H       VY SPPPPV  Y  P PVYHSPPPP
Sbjct: 34  SPPPPV-HSPPPPKDPYHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPP 92

Query: 152 ---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP-KKHYVYKSPPPPVKHY--SPPPVYHS 307
              KK Y Y SPPPP  H    P PVYHSPPPP KK Y Y SPPPP  H    P PVYHS
Sbjct: 93  TPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHS 152

Query: 308 PPPPKKHY 331
           PPPP   Y
Sbjct: 153 PPPPVHTY 160

 Score =  119 bits (299), Expect = 8e-26
 Identities = 65/109 (59%), Positives = 65/109 (59%), Gaps = 7/109 (6%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP- 208
           SPPP  HSPPPPK  Y Y SPPPP  H  P P          H VY SPPPPV  Y  P 
Sbjct: 34  SPPPPVHSPPPPKDPYHYSSPPPPPVHTYPHP----------HPVYHSPPPPVHTYPHPH 83

Query: 209 PVYHSPPPP---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP-KKHYVY 337
           PVYHSPPPP   KK Y Y SPPPP  H    P PVYHSPPPP KK Y Y
Sbjct: 84  PVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKY 132

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 5/44 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPP-PVYHSPPPP----KKHYVYKSPPPPVKHYSP 121
           SPPPPV  Y  P PVYHSPPPP    KK Y Y SPPPP  H  P
Sbjct: 152 SPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYP 195

[32][TOP]
>UniRef100_Q94ES6 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES6_PEA
          Length = 181

 Score =  135 bits (339), Expect = 2e-30
 Identities = 77/129 (59%), Positives = 77/129 (59%), Gaps = 24/129 (18%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV----YHSPPPPKKHY------VYKSPPPPVKHYSPP-PVYHSPPPP 151
           SPPPPV H  PPP     Y SPPPP  H       VY SPPPPV  Y  P PVYHSPPPP
Sbjct: 34  SPPPPV-HSPPPPKDPHHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPP 92

Query: 152 ---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP----KKHYVYKSPPPPVKHYSPP---- 292
              KK Y Y SPPPP  H    P PVYHSPPPP    KK Y Y SPPPP  H  PP    
Sbjct: 93  TPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPT 152

Query: 293 PVYHSPPPP 319
           PVYHSPPPP
Sbjct: 153 PVYHSPPPP 161

 Score =  116 bits (291), Expect = 7e-25
 Identities = 64/112 (57%), Positives = 65/112 (58%), Gaps = 10/112 (8%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP- 208
           SPPP  HSPPPPK  + Y SPPPP  H  P P          H VY SPPPPV  Y  P 
Sbjct: 34  SPPPPVHSPPPPKDPHHYSSPPPPPVHTYPHP----------HPVYHSPPPPVHTYPHPH 83

Query: 209 PVYHSPPPP---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP----KKHYVY 337
           PVYHSPPPP   KK Y Y SPPPP  H    P PVYHSPPPP    KK Y Y
Sbjct: 84  PVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKY 135

 Score =  114 bits (285), Expect = 3e-24
 Identities = 67/130 (51%), Positives = 68/130 (52%), Gaps = 23/130 (17%)
 Frame = +2

Query: 8   PPPPVKHYSPP-PVYHSPPPP-----KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY-- 163
           PPPPV  Y  P PVYHSPPPP       H VY SPPPP  H  P   Y SPPPP  H   
Sbjct: 55  PPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYK-YPSPPPPPVHTYP 113

Query: 164 ----VYKSPPPPVKHYSPPPVYHSPPPPKKHY--------VYKSPPPPVKHYSPPP---V 298
               VY SPPPP   +  P  Y SPPPP  H         VY SPPPP   YSPPP    
Sbjct: 114 HPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPA--YSPPPPAYY 171

Query: 299 YHSPPPPKKH 328
           Y SPPPP  H
Sbjct: 172 YKSPPPPYHH 181

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 58/126 (46%), Positives = 59/126 (46%), Gaps = 26/126 (20%)
 Frame = +2

Query: 5   SPPPPVKHYSPP-PVYHSPPPPKKHY---------------------VYKSPPPPVKHYS 118
           SPPPPV  Y  P PVYHSPPPP  H                      VY SPPPP     
Sbjct: 71  SPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPP----- 125

Query: 119 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPP----PVYHSPPPPKKHYVYKSPPPPVKHYS 286
                  P P KK Y Y SPPPP  H  PP    PVYHSPPPP     Y  PPP   + S
Sbjct: 126 -------PTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP----AYSPPPPAYYYKS 174

Query: 287 PPPVYH 304
           PPP YH
Sbjct: 175 PPPPYH 180

[33][TOP]
>UniRef100_Q94ES9 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES9_PEA
          Length = 183

 Score =  134 bits (337), Expect = 3e-30
 Identities = 77/131 (58%), Positives = 77/131 (58%), Gaps = 26/131 (19%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV----YHSPPP--------PKKHYVYKSPPPPVKHY-SPPPVYHSPP 145
           SPPPPV H  PPP     Y SPPP        P  H VY SPPPPV  Y  P PVYHSPP
Sbjct: 34  SPPPPV-HSPPPPKDPHHYSSPPPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPP 92

Query: 146 PP---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP----KKHYVYKSPPPPVKHYSPP-- 292
           PP   KK Y Y SPPPP  H    P PVYHSPPPP    KK Y Y SPPPP  H  PP  
Sbjct: 93  PPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHV 152

Query: 293 --PVYHSPPPP 319
             PVYHSPPPP
Sbjct: 153 PTPVYHSPPPP 163

 Score =  122 bits (305), Expect = 2e-26
 Identities = 67/112 (59%), Positives = 69/112 (61%), Gaps = 10/112 (8%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-SPP 208
           SPPP  HSPPPPK  + Y SPPPP     PPPV+  P P   H VY SPPPPV  Y  P 
Sbjct: 34  SPPPPVHSPPPPKDPHHYSSPPPP-----PPPVHTYPHP---HPVYHSPPPPVHTYPHPH 85

Query: 209 PVYHSPPPP---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP----KKHYVY 337
           PVYHSPPPP   KK Y Y SPPPP  H    P PVYHSPPPP    KK Y Y
Sbjct: 86  PVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKY 137

 Score =  114 bits (285), Expect = 3e-24
 Identities = 67/130 (51%), Positives = 68/130 (52%), Gaps = 23/130 (17%)
 Frame = +2

Query: 8   PPPPVKHYSPP-PVYHSPPPP-----KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY-- 163
           PPPPV  Y  P PVYHSPPPP       H VY SPPPP  H  P   Y SPPPP  H   
Sbjct: 57  PPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYK-YPSPPPPPVHTYP 115

Query: 164 ----VYKSPPPPVKHYSPPPVYHSPPPPKKHY--------VYKSPPPPVKHYSPPP---V 298
               VY SPPPP   +  P  Y SPPPP  H         VY SPPPP   YSPPP    
Sbjct: 116 HPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPA--YSPPPPAYY 173

Query: 299 YHSPPPPKKH 328
           Y SPPPP  H
Sbjct: 174 YKSPPPPYHH 183

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 58/126 (46%), Positives = 59/126 (46%), Gaps = 26/126 (20%)
 Frame = +2

Query: 5   SPPPPVKHYSPP-PVYHSPPPPKKHY---------------------VYKSPPPPVKHYS 118
           SPPPPV  Y  P PVYHSPPPP  H                      VY SPPPP     
Sbjct: 73  SPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPP----- 127

Query: 119 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPP----PVYHSPPPPKKHYVYKSPPPPVKHYS 286
                  P P KK Y Y SPPPP  H  PP    PVYHSPPPP     Y  PPP   + S
Sbjct: 128 -------PTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP----AYSPPPPAYYYKS 176

Query: 287 PPPVYH 304
           PPP YH
Sbjct: 177 PPPPYH 182

[34][TOP]
>UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859A1
          Length = 377

 Score =  134 bits (336), Expect = 4e-30
 Identities = 76/130 (58%), Positives = 79/130 (60%), Gaps = 19/130 (14%)
 Frame = +2

Query: 8   PPPPVKHYS---PPPVYHSPPPPKKHYVYKSPPPP---VKHYSPPPV-----YHSPPPPK 154
           PPPPV  Y    PPP  HSPPPP   Y YKSPPPP    K+ SPPP      Y SPPPP 
Sbjct: 228 PPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPP 287

Query: 155 KHYVYKSPPPPVKHY-SPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPP---VYHSP 310
             Y YKSPPPP   Y SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP   +Y SP
Sbjct: 288 --YKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPYMYKSP 345

Query: 311 PPPKKHYVYK 340
           PPP   Y YK
Sbjct: 346 PPPPPVYKYK 355

 Score =  129 bits (324), Expect = 1e-28
 Identities = 72/133 (54%), Positives = 77/133 (57%), Gaps = 25/133 (18%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV-----YHSPPPPKKHYVYKSPPPP-VKHYSPPPV------------- 130
           PPPP K+ SPPP      Y SPPPP   Y YKSPPPP  K+ SPPP              
Sbjct: 250 PPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYK 309

Query: 131 YHSPPPPKKHYVYKSPPPPV-KHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
           Y SPPPP   Y YKSPPPPV K+ SPPP   +Y SPPPP   Y YKSPPPP     PP  
Sbjct: 310 YKSPPPPPPVYKYKSPPPPVYKYKSPPPPPYMYKSPPPPPPVYKYKSPPPP-----PPKY 364

Query: 299 YHS--PPPPKKHY 331
           Y+S  PPPP  HY
Sbjct: 365 YYSSPPPPPPHHY 377

 Score =  121 bits (304), Expect = 2e-26
 Identities = 73/141 (51%), Positives = 77/141 (54%), Gaps = 32/141 (22%)
 Frame = +2

Query: 5   SPP--PPVKHYSPPPV-----YHSPPPP-KKHYVYKSPPPP------------VKHYSPP 124
           SPP  PP K+ SPPP      Y SPPPP KK Y YKSPPPP             ++ SPP
Sbjct: 160 SPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPP 219

Query: 125 PV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV-----YHSPPPPKKHYVYKSPPPPVKHYS 286
           P  Y SPPPP   Y YKSPPPP   +SPPP      Y SPPPP   Y YKSPPPP   Y 
Sbjct: 220 PYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYK 279

Query: 287 ----PPPVYH--SPPPPKKHY 331
               PPP Y   SPPPP   Y
Sbjct: 280 YKSPPPPPYKYKSPPPPPLQY 300

 Score =  119 bits (298), Expect = 1e-25
 Identities = 70/139 (50%), Positives = 75/139 (53%), Gaps = 29/139 (20%)
 Frame = +2

Query: 2   KSPPPP------------VKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV---- 130
           KSPPPP             ++ SPPP  Y SPPPP   Y YKSPPPP   +SPPP     
Sbjct: 195 KSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPY 254

Query: 131 -YHSPPPPKKHYVYKSPPPP---VKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSP 289
            Y SPPPP   Y YKSPPPP    K+ SPPP    Y SPPPP   Y    PPPP K+ SP
Sbjct: 255 KYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYK-SPPPPPYKYKSP 313

Query: 290 PP-----VYHSPPPPKKHY 331
           PP      Y SPPPP   Y
Sbjct: 314 PPPPPVYKYKSPPPPVYKY 332

 Score =  117 bits (292), Expect = 5e-25
 Identities = 70/133 (52%), Positives = 70/133 (52%), Gaps = 20/133 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPP-- 151
           KSPPPP   YSPP      Y SPPPP   Y YKSPPPP   YSPP      Y SPPPP  
Sbjct: 58  KSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPP 117

Query: 152 ------KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP----VY 301
                    Y YKSPPPP   YSPP   H PP     Y YKSPPPP   YSPP      Y
Sbjct: 118 VYSPPHHPPYKYKSPPPPPPVYSPP---HHPP-----YKYKSPPPPPPVYSPPHHPPYKY 169

Query: 302 HSPPPPKKHYVYK 340
            SPPPP   Y YK
Sbjct: 170 KSPPPPPPVYKYK 182

 Score =  116 bits (291), Expect = 7e-25
 Identities = 76/162 (46%), Positives = 79/162 (48%), Gaps = 49/162 (30%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--------------PVYHSPPPPKKHYVYKSPPPPVKHYS------- 118
           KSPPPP   YSPP              PVY   PP    Y YKSPPPP   YS       
Sbjct: 110 KSPPPPPPVYSPPHHPPYKYKSPPPPPPVYS--PPHHPPYKYKSPPPPPPVYSPPHHPPY 167

Query: 119 -------PPPV--YHSPPPP-KKHYVYKSPPPP------------VKHYSPPPV-YHSPP 229
                  PPPV  Y SPPPP KK Y YKSPPPP             ++ SPPP  Y SPP
Sbjct: 168 KYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPP 227

Query: 230 PPKKHYVYKSPPPPVKHYSPPP-----VYHSPPPPKKHYVYK 340
           PP   Y YKSPPPP   +SPPP      Y SPPPP   Y YK
Sbjct: 228 PPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYK 269

 Score =  114 bits (285), Expect = 3e-24
 Identities = 66/125 (52%), Positives = 66/125 (52%), Gaps = 23/125 (18%)
 Frame = +2

Query: 26  HYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPP 184
           HYS PP    Y SPPPP   Y YKSPPPP   YSPP      Y SPPPP   Y YKSPPP
Sbjct: 35  HYSSPPPPYYYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPP 94

Query: 185 PVKHYSPPP----VYHSPPPP--------KKHYVYKSPPPPVKHYSPPP----VYHSPPP 316
           P   YSPP      Y SPPPP           Y YKSPPPP   YSPP      Y SPPP
Sbjct: 95  PPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPP 154

Query: 317 PKKHY 331
           P   Y
Sbjct: 155 PPPVY 159

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/100 (51%), Positives = 52/100 (52%), Gaps = 8/100 (8%)
 Frame = +2

Query: 56  PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHS 223
           P     +Y Y SPPPP         Y SPPPP   Y YKSPPPP   YSPP      Y S
Sbjct: 27  PSETSANYHYSSPPPPY-------YYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKS 79

Query: 224 PPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHY 331
           PPPP   Y YKSPPPP   YSPP      Y SPPPP   Y
Sbjct: 80  PPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVY 119

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 38/68 (55%), Positives = 40/68 (58%), Gaps = 2/68 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKS 175
           KSPPPPV  Y  PP    PPP    Y+YKSPPP      PPPV  Y SPPPP   Y Y S
Sbjct: 323 KSPPPPVYKYKSPP----PPP----YMYKSPPP------PPPVYKYKSPPPPPPKYYYSS 368

Query: 176 PPPPVKHY 199
           PPPP  H+
Sbjct: 369 PPPPPPHH 376

[35][TOP]
>UniRef100_Q76KW3 Hydroxyproline-rich glycoprotein-2 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW3_PEA
          Length = 155

 Score =  133 bits (335), Expect = 5e-30
 Identities = 74/124 (59%), Positives = 79/124 (63%), Gaps = 12/124 (9%)
 Frame = +2

Query: 5   SPPPPVKHY---SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYV 166
           SPPPP K Y   SPPP  HSPPPP   Y Y SPPPPV  +SPPP YH    PPPPKK Y 
Sbjct: 35  SPPPPPKPYYYQSPPPPVHSPPPP---YHYSSPPPPV--HSPPPPYHYSSPPPPPKKSYK 89

Query: 167 YKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVK---HYS--PPPVYHSPPPPKKH 328
           Y SPPPP+ K+ SPPP  HSPPPP   Y Y SPPPP K    YS  PPPVY    P ++ 
Sbjct: 90  YSSPPPPIYKYKSPPPPVHSPPPP---YHYSSPPPPPKKSYKYSSPPPPVYKYKSPHQQV 146

Query: 329 YVYK 340
           Y YK
Sbjct: 147 YKYK 150

 Score =  113 bits (283), Expect = 6e-24
 Identities = 61/105 (58%), Positives = 66/105 (62%), Gaps = 17/105 (16%)
 Frame = +2

Query: 74  HYVYKSPPPPVK--HY-SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPP 235
           +Y+Y SPPPP K  +Y SPPP  HSPPPP   Y Y SPPPPV  +SPPP YH    PPPP
Sbjct: 30  NYLYSSPPPPPKPYYYQSPPPPVHSPPPP---YHYSSPPPPV--HSPPPPYHYSSPPPPP 84

Query: 236 KKHYVYKSPPPPVKHY--------SPPPVYH---SPPPPKKHYVY 337
           KK Y Y SPPPP+  Y        SPPP YH    PPPPKK Y Y
Sbjct: 85  KKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKY 129

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 28/43 (65%), Positives = 30/43 (69%), Gaps = 2/43 (4%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHS--PPPPKKHYVYKSPPPPVKHYSPP 124
           KSPPPPV H  PPP ++S  PPPPKK Y Y SPPPPV  Y  P
Sbjct: 101 KSPPPPV-HSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSP 142

[36][TOP]
>UniRef100_Q8H9E0 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Solanum
           tuberosum RepID=Q8H9E0_SOLTU
          Length = 217

 Score =  132 bits (332), Expect = 1e-29
 Identities = 72/125 (57%), Positives = 72/125 (57%), Gaps = 12/125 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHY 163
           KSPPPPV  Y     PPPVY    PP   Y YKSPPPPV  Y   PPPVY    PP   Y
Sbjct: 49  KSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 108

Query: 164 VYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPPKK 325
            YKSPPPPV  Y   PPPVY    PP   Y YKSPPPPV  Y   PPPV  Y SPPPP  
Sbjct: 109 KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPP 168

Query: 326 HYVYK 340
            Y YK
Sbjct: 169 VYKYK 173

 Score =  130 bits (326), Expect = 6e-29
 Identities = 67/118 (56%), Positives = 69/118 (58%), Gaps = 8/118 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVY 169
           KSPPPPV  Y   PPPVY    PP   Y YKSPPPPV  Y   PPPVY    PP   Y Y
Sbjct: 101 KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKY 160

Query: 170 KSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           KSPPPP   Y     PPPVY    PP   Y YKSPPPPV H SP P Y++ PPP  HY
Sbjct: 161 KSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV-HKSPAPYYYTSPPPPSHY 217

 Score =  126 bits (316), Expect = 9e-28
 Identities = 68/123 (55%), Positives = 68/123 (55%), Gaps = 10/123 (8%)
 Frame = +2

Query: 2   KSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVY 169
           KSPPPPV  Y   PPPVY    PP   Y YKSPPPPV  Y   PPPVY    PP   Y Y
Sbjct: 71  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKY 130

Query: 170 KSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKKHY 331
           KSPPPPV  Y   PPPVY    PP   Y YKSPPPP   Y     PPPVY    PP   Y
Sbjct: 131 KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVY 190

Query: 332 VYK 340
            YK
Sbjct: 191 KYK 193

 Score =  124 bits (310), Expect = 4e-27
 Identities = 71/133 (53%), Positives = 71/133 (53%), Gaps = 20/133 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPV------------Y 133
           KSPPPPV  Y  PP    PPPP   Y YKSPPPPV  Y     PPPV            Y
Sbjct: 5   KSPPPPVYKYKSPP----PPPPV--YKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKY 58

Query: 134 HSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVY 301
            SPPPP   Y YKSPPPPV  Y   PPPVY    PP   Y YKSPPPPV  Y   PPPVY
Sbjct: 59  KSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 118

Query: 302 HSPPPPKKHYVYK 340
               PP   Y YK
Sbjct: 119 KYKSPPPPVYKYK 131

 Score =  112 bits (279), Expect = 2e-23
 Identities = 62/110 (56%), Positives = 63/110 (57%), Gaps = 12/110 (10%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPP---VKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYS-- 202
           Y SPPPP   Y YKSPPPP    K+ SPPP    Y SPPPP   Y YKSPPPPV  Y   
Sbjct: 4   YKSPPPPV--YKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSP 61

Query: 203 --PPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYK 340
             PPPVY    PP   Y YKSPPPPV  Y   PPPVY    PP   Y YK
Sbjct: 62  PPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK 111

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/100 (56%), Positives = 57/100 (57%), Gaps = 12/100 (12%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPP---VKHYSPPP---VYHSP 226
           Y YKSPPPPV  Y     PPPVY    PP   Y YKSPPPP    K+ SPPP    Y SP
Sbjct: 2   YKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSP 61

Query: 227 PPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYK 340
           PPP   Y YKSPPPPV  Y   PPPVY    PP   Y YK
Sbjct: 62  PPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK 101

[37][TOP]
>UniRef100_Q39599 Extensin n=1 Tax=Catharanthus roseus RepID=Q39599_CATRO
          Length = 225

 Score =  132 bits (332), Expect = 1e-29
 Identities = 80/135 (59%), Positives = 80/135 (59%), Gaps = 22/135 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPV-KHYS------PPPVYHS-PP 145
           K PPPP   Y     PPPVY SPPPP   Y YKSPPPP  K Y       PPPVY S PP
Sbjct: 41  KYPPPPPPFYKSPPPPPPVYKSPPPPP--YKYKSPPPPPHKPYKYKSPPPPPPVYKSPPP 98

Query: 146 PPKKHYVYKSPPPPVKHYSPPPVYHSPPPP---KKHYVYKSPPPP--VKHY---SPPPVY 301
           PP K Y YKSPPPP      P  Y SPPPP   K  YVYKSPPPP  V  Y   SPPPVY
Sbjct: 99  PPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVY 158

Query: 302 HSP--PPPKKHYVYK 340
            SP  PPPKK Y YK
Sbjct: 159 KSPPSPPPKKPYKYK 173

 Score =  131 bits (330), Expect = 2e-29
 Identities = 80/143 (55%), Positives = 81/143 (56%), Gaps = 33/143 (23%)
 Frame = +2

Query: 8   PPPPVKHYS------PPPVYHSPPPPK-KHYVYKSPPPPVKHYSPPPVYHSPPPP---KK 157
           PPPP K Y       PPPVY SPPPP  K Y YKSPPPP      P  Y SPPPP   K 
Sbjct: 74  PPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKP 133

Query: 158 HYVYKSPPPP--VKHY---SPPPVYHSP--PPPKKHYVYKSPPPPVKH------------ 280
            YVYKSPPPP  V  Y   SPPPVY SP  PPPKK Y YKSPPPP  H            
Sbjct: 134 PYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPPPKKPYKYKSPPPPPIHKSPLPSPPKKPY 193

Query: 281 ---YSPP-PVYHSPPPPKKHYVY 337
              Y PP PVY SPPPP  HY+Y
Sbjct: 194 KYKYPPPTPVYKSPPPP-HHYLY 215

 Score =  125 bits (314), Expect = 1e-27
 Identities = 74/127 (58%), Positives = 75/127 (59%), Gaps = 15/127 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKKHYVYK 172
           SPPPP  HYSPP  Y SPPPP    V+K PPPP   Y     PPPVY SPPPP   Y YK
Sbjct: 18  SPPPP--HYSPPYHYKSPPPPPP--VHKYPPPPPPFYKSPPPPPPVYKSPPPPP--YKYK 71

Query: 173 SPPPPV-KHYS------PPPVYHS-PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP--- 319
           SPPPP  K Y       PPPVY S PPPP K Y YKSPPPP      P  Y SPPPP   
Sbjct: 72  SPPPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVY 131

Query: 320 KKHYVYK 340
           K  YVYK
Sbjct: 132 KPPYVYK 138

 Score =  122 bits (306), Expect = 1e-26
 Identities = 70/120 (58%), Positives = 72/120 (60%), Gaps = 14/120 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPP---KKHYVYKSPPPP--VKHY---SPPPVYHSP--PPP 151
           KSPPPP      P  Y SPPPP   K  YVYKSPPPP  V  Y   SPPPVY SP  PPP
Sbjct: 107 KSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPPP 166

Query: 152 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH----SPPPP 319
           KK Y YKSPPPP  H SP      P PPKK Y YK PPP   + SPPP +H    SPPPP
Sbjct: 167 KKPYKYKSPPPPPIHKSP-----LPSPPKKPYKYKYPPPTPVYKSPPPPHHYLYTSPPPP 221

 Score =  102 bits (253), Expect = 2e-20
 Identities = 59/101 (58%), Positives = 61/101 (60%), Gaps = 12/101 (11%)
 Frame = +2

Query: 74  HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKK 241
           +Y Y SPPPP  HYSPP  Y SPPPP    V+K PPPP   Y     PPPVY SPPPP  
Sbjct: 13  NYHYSSPPPP--HYSPPYHYKSPPPPPP--VHKYPPPPPPFYKSPPPPPPVYKSPPPPP- 67

Query: 242 HYVYKSPPPPV-KHYS------PPPVYHS-PPPPKKHYVYK 340
            Y YKSPPPP  K Y       PPPVY S PPPP K Y YK
Sbjct: 68  -YKYKSPPPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYKYK 107

[38][TOP]
>UniRef100_Q39864 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39864_SOYBN
          Length = 199

 Score =  132 bits (331), Expect = 2e-29
 Identities = 74/128 (57%), Positives = 78/128 (60%), Gaps = 16/128 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 58  KSPPPPYKYPSPPPPPYKYPSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKY 115

Query: 170 KSPPPPVKHYS--PPPVYH--SPPPPKKH-------YVYKSPPPPV-KHYSPPPVYHSPP 313
            SPPPPV  Y   PPPVY   SPPPP K+       Y Y SPPPPV K+ SPPP Y  P 
Sbjct: 116 PSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPS 175

Query: 314 PPKKHYVY 337
           PP   Y Y
Sbjct: 176 PPPPPYKY 183

 Score =  131 bits (329), Expect = 3e-29
 Identities = 72/118 (61%), Positives = 76/118 (64%), Gaps = 11/118 (9%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPPKKHYVY 169
           PPPP K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP    Y SPPPP   Y Y
Sbjct: 31  PPPPYKYPSPPPPVYKYKSPPPPV--YKYKSPPPPYKYPSPPPPPYKYPSPPPPV--YKY 86

Query: 170 KSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPPKKH 328
           KSPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPV  Y SPPPP K+
Sbjct: 87  KSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKY 144

 Score =  128 bits (321), Expect = 2e-28
 Identities = 76/138 (55%), Positives = 80/138 (57%), Gaps = 28/138 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 19  KSPPPPYKYPSPPPPPYKYPSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKY 76

Query: 170 KSPPPPVKHYS--PPPVYH--SPPPPKKH-----------------YVYKSPPPPV-KHY 283
            SPPPPV  Y   PPPVY   SPPPP K+                 Y YKSPPPPV K+ 
Sbjct: 77  PSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 136

Query: 284 SPPP--VYHSPPPPKKHY 331
           SPPP   Y SPPPP   Y
Sbjct: 137 SPPPPHKYPSPPPPPYKY 154

 Score =  127 bits (318), Expect = 5e-28
 Identities = 73/130 (56%), Positives = 77/130 (59%), Gaps = 22/130 (16%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSPPPV-------------YHS 139
           PPPP K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP              Y S
Sbjct: 70  PPPPYKYPSPPPPVYKYKSPPPPV--YKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 127

Query: 140 PPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP---VY 301
           PPPP   Y YKSPPPP K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP    Y
Sbjct: 128 PPPPV--YKYKSPPPPHKYPSPPPPPYKYPSPPPPV--YKYKSPPPPYKYPSPPPPPYKY 183

Query: 302 HSPPPPKKHY 331
            SPPPP   Y
Sbjct: 184 PSPPPPVYKY 193

 Score =  125 bits (315), Expect = 1e-27
 Identities = 73/122 (59%), Positives = 76/122 (62%), Gaps = 12/122 (9%)
 Frame = +2

Query: 2   KSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYH--SPPPPKKHYV 166
           KSPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPVY   SPPPP   Y 
Sbjct: 48  KSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP---YK 104

Query: 167 YKSPPPP-VKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKK 325
           Y SPPPP  K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP    Y SPPPP  
Sbjct: 105 YPSPPPPPYKYPSPPPPVYKYKSPPPPV--YKYKSPPPPHKYPSPPPPPYKYPSPPPPVY 162

Query: 326 HY 331
            Y
Sbjct: 163 KY 164

 Score =  124 bits (312), Expect = 2e-27
 Identities = 72/121 (59%), Positives = 75/121 (61%), Gaps = 12/121 (9%)
 Frame = +2

Query: 5   SPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYH--SPPPPKKHYVY 169
           SPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPVY   SPPPP   Y Y
Sbjct: 10  SPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP---YKY 66

Query: 170 KSPPPP-VKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKKH 328
            SPPPP  K+ SPPP    Y SPPPP   Y YKSPPPP K+ SPPP    Y SPPPP   
Sbjct: 67  PSPPPPPYKYPSPPPPVYKYKSPPPPV--YKYKSPPPPYKYPSPPPPPYKYPSPPPPVYK 124

Query: 329 Y 331
           Y
Sbjct: 125 Y 125

 Score =  121 bits (304), Expect = 2e-26
 Identities = 65/111 (58%), Positives = 69/111 (62%), Gaps = 5/111 (4%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP +  P PP   Y Y
Sbjct: 97  KSPPPPYKYPSPPPPPYKYPSPPPPV--YKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKY 154

Query: 170 KSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            SPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y       SPPPP
Sbjct: 155 PSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYK------SPPPP 199

 Score =  119 bits (299), Expect = 8e-26
 Identities = 67/119 (56%), Positives = 70/119 (58%), Gaps = 9/119 (7%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPPPKKHYVYK 172
           P  P K+ SPPP    Y SPPPP   Y Y SPPPP   Y   PPPVY    PP   Y YK
Sbjct: 2   PKKPYKYPSPPPPVYKYKSPPPP---YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 58

Query: 173 SPPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVY 337
           SPPPP K+ SPPP    Y SPPPP   Y YKSPPPPV K+ SPPP Y  P PP   Y Y
Sbjct: 59  SPPPPYKYPSPPPPPYKYPSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKY 115

 Score =  117 bits (294), Expect = 3e-25
 Identities = 67/113 (59%), Positives = 70/113 (61%), Gaps = 8/113 (7%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPPKKHYVYKSPPP 184
           PP K Y     Y SPPPP   Y YKSPPPP K+ SPPP    Y SPPPP   Y YKSPPP
Sbjct: 1   PPKKPYK----YPSPPPPV--YKYKSPPPPYKYPSPPPPPYKYPSPPPPV--YKYKSPPP 52

Query: 185 PV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPPKKH 328
           PV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPV  Y SPPPP K+
Sbjct: 53  PVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKY 105

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/100 (58%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = +2

Query: 62  PPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYH--SP 226
           PPKK Y Y SPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y   PPPVY   SP
Sbjct: 1   PPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP 60

Query: 227 PPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYK 340
           PPP   Y Y SPPPP   Y   PPPVY    PP   Y YK
Sbjct: 61  PPP---YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 97

[39][TOP]
>UniRef100_Q9FSG0 Extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG0_NICSY
          Length = 161

 Score =  131 bits (330), Expect = 2e-29
 Identities = 74/129 (57%), Positives = 75/129 (58%), Gaps = 18/129 (13%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPP-----VYHSPPPPKKHY- 163
           SPPPP K Y    VY SPPPP   Y YKSPPPPV KH SPPP      Y SPPPP   Y 
Sbjct: 32  SPPPPTKKY----VYSSPPPPV--YKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYK 85

Query: 164 -------VYKSPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 310
                  VYKSPPPP+  Y     PPPVY SPPPP   Y    PPPPV    PPPVY SP
Sbjct: 86  SPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSP 145

Query: 311 PPPKKHYVY 337
           PPP  HY Y
Sbjct: 146 PPP-YHYYY 153

 Score =  131 bits (330), Expect = 2e-29
 Identities = 75/123 (60%), Positives = 76/123 (61%), Gaps = 14/123 (11%)
 Frame = +2

Query: 5   SPPPPVKHYS--PPPVYH--SPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKKH 160
           SPPPPV  Y   PPPVY   SPPPP   Y YKSPPPPV  Y     PPPVY SPPPP   
Sbjct: 44  SPPPPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYK 103

Query: 161 YVYKSPPPPVKHYSPPPVYH--SPPPPKKHYVYKSPPPPVKHYSPPPVYH----SPPPPK 322
           Y    PPPPV    PPPVY   SPPPP    VYKSPPPPV + SPPP YH    SPPPP 
Sbjct: 104 YKSPPPPPPVYKSPPPPVYKYKSPPPPPP--VYKSPPPPV-YKSPPPPYHYYYTSPPPP- 159

Query: 323 KHY 331
            HY
Sbjct: 160 -HY 161

 Score =  129 bits (323), Expect = 1e-28
 Identities = 71/118 (60%), Positives = 71/118 (60%), Gaps = 20/118 (16%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHYS--PPPVYH--SPPPPKKHYVYKSPPPPVKHYS---- 202
           Y SPPPP K YVY SPPPPV  Y   PPPVY   SPPPP   Y YKSPPPPV  Y     
Sbjct: 30  YSSPPPPTKKYVYSSPPPPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPP 89

Query: 203 PPPVYHSPPPPKKHY--------VYKSPPPPVKHYS----PPPVYHSPPPPKKHYVYK 340
           PPPVY SPPPP   Y        VYKSPPPPV  Y     PPPVY SPPPP    VYK
Sbjct: 90  PPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPP----VYK 143

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 47/76 (61%), Positives = 48/76 (63%), Gaps = 9/76 (11%)
 Frame = +2

Query: 131 YHSPPP-PKKHYVYKSPPPPVKHYS--PPPVY--HSPPPPKKHYVYKSPPPPVKHYS--- 286
           Y+S PP P K YVY SPPPPV  Y   PPPVY   SPPPP   Y YKSPPPPV  Y    
Sbjct: 29  YYSSPPPPTKKYVYSSPPPPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPP 88

Query: 287 -PPPVYHSPPPPKKHY 331
            PPPVY SPPPP   Y
Sbjct: 89  PPPPVYKSPPPPIYKY 104

[40][TOP]
>UniRef100_Q9C668 Putative uncharacterized protein F28B23.10 n=1 Tax=Arabidopsis
           thaliana RepID=Q9C668_ARATH
          Length = 478

 Score =  131 bits (330), Expect = 2e-29
 Identities = 80/129 (62%), Positives = 82/129 (63%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKK 157
           KSPPPP   YS PP    +Y SPPPP   YVY SPPPP   Y SPPP   VY+SPPPP  
Sbjct: 88  KSPPPPPYVYSSPPPPPYIYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYNSPPPPP- 144

Query: 158 HYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPP 313
            YVYKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPP
Sbjct: 145 -YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPP 201

Query: 314 PPKKHYVYK 340
           PP   YVYK
Sbjct: 202 PPP--YVYK 208

 Score =  131 bits (329), Expect = 3e-29
 Identities = 81/129 (62%), Positives = 81/129 (62%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKK 157
           KSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP  
Sbjct: 108 KSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYNSPPPPPYVYKSPPPPPYVYSSPPPPP- 164

Query: 158 HYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPP 313
            YVYKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPP
Sbjct: 165 -YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPP 221

Query: 314 PPKKHYVYK 340
           PP   YVYK
Sbjct: 222 PPP--YVYK 228

 Score =  131 bits (329), Expect = 3e-29
 Identities = 81/129 (62%), Positives = 81/129 (62%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKK 157
           KSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP  
Sbjct: 188 KSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP- 244

Query: 158 HYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPP 313
            YVYKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPP
Sbjct: 245 -YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPP 301

Query: 314 PPKKHYVYK 340
           PP   YVYK
Sbjct: 302 PPP--YVYK 308

 Score =  130 bits (327), Expect = 5e-29
 Identities = 79/134 (58%), Positives = 81/134 (60%), Gaps = 23/134 (17%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPK---- 154
           PPPP  + SPPP   VY+SPPPP   YVYKSPPPP   YS PP    VY SPPPP     
Sbjct: 321 PPPPYVYKSPPPPPYVYNSPPPPP--YVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYS 378

Query: 155 ----KHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---V 298
                 YVYKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   V
Sbjct: 379 SPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYV 436

Query: 299 YHSPPPPKKHYVYK 340
           Y SPPPP   YVYK
Sbjct: 437 YSSPPPPP--YVYK 448

 Score =  130 bits (326), Expect = 6e-29
 Identities = 79/126 (62%), Positives = 80/126 (63%), Gaps = 15/126 (11%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKKHYV 166
           PPPP  + SPPP   VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP   YV
Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP--YV 186

Query: 167 YKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPK 322
           YKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP 
Sbjct: 187 YKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 244

Query: 323 KHYVYK 340
             YVYK
Sbjct: 245 --YVYK 248

 Score =  129 bits (325), Expect = 8e-29
 Identities = 79/129 (61%), Positives = 81/129 (62%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKK 157
           KSPPPP   YS PP    +Y SPPPP   YVY SPPPP   Y SPPP   VY SPPPP  
Sbjct: 68  KSPPPPPYVYSSPPPPPYIYKSPPPPP--YVYSSPPPPPYIYKSPPPPPYVYSSPPPPP- 124

Query: 158 HYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPP 313
            YVYKSPPPP   Y+ PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPP
Sbjct: 125 -YVYKSPPPPPYVYNSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPP 181

Query: 314 PPKKHYVYK 340
           PP   YVYK
Sbjct: 182 PPP--YVYK 188

 Score =  129 bits (325), Expect = 8e-29
 Identities = 80/136 (58%), Positives = 81/136 (59%), Gaps = 24/136 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPP--------PPKKHYVYKSPPPPVKHYSPPP----VY 133
           KSPPPP   YS PP    VY SPP        PP   YVYKSPPPP   YS PP    VY
Sbjct: 248 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 307

Query: 134 HSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP-- 295
            SPPPP   YVY SPPPP   Y SPPP   VY+SPPPP   YVYKSPPPP   YS PP  
Sbjct: 308 KSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYNSPPPPP--YVYKSPPPPPYVYSSPPPS 363

Query: 296 --VYHSPPPPKKHYVY 337
             VY SPPPP   YVY
Sbjct: 364 PYVYKSPPPPP--YVY 377

 Score =  129 bits (323), Expect = 1e-28
 Identities = 78/134 (58%), Positives = 80/134 (59%), Gaps = 23/134 (17%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPK---- 154
           PPPP  + SPPP   VY SPPPP   YVYKSPPPP   Y+ PP    VY SPPPP     
Sbjct: 301 PPPPYVYKSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYS 358

Query: 155 ----KHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---V 298
                 YVYKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   V
Sbjct: 359 SPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYV 416

Query: 299 YHSPPPPKKHYVYK 340
           Y SPPPP   YVYK
Sbjct: 417 YSSPPPPP--YVYK 428

 Score =  129 bits (323), Expect = 1e-28
 Identities = 80/136 (58%), Positives = 80/136 (58%), Gaps = 24/136 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPP--------PPKKHYVYKSPPPPVKHYSPPP----VY 133
           KSPPPP   YS PP    VY SPP        PP   YVYKSPPPP   YS PP    VY
Sbjct: 308 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVY 367

Query: 134 HSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP-- 295
            SPPPP   YVY SPPPP   Y SPPP   VY SPPPP   YVYKSPPPP   YS PP  
Sbjct: 368 KSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSSPPPP 423

Query: 296 --VYHSPPPPKKHYVY 337
             VY SPPPP   YVY
Sbjct: 424 PYVYKSPPPPP--YVY 437

 Score =  128 bits (322), Expect = 2e-28
 Identities = 78/128 (60%), Positives = 80/128 (62%), Gaps = 16/128 (12%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKKH 160
           SPPPP   YS PP    +Y SPPPP   YVY SPPPP   Y SPPP   VY SPPPP   
Sbjct: 49  SPPPPPYVYSSPPPPPYIYKSPPPPP--YVYSSPPPPPYIYKSPPPPPYVYSSPPPPP-- 104

Query: 161 YVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPP 316
           Y+YKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPP
Sbjct: 105 YIYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYNSPPPPPYVYKSPPPPPYVYSSPPP 162

Query: 317 PKKHYVYK 340
           P   YVYK
Sbjct: 163 PP--YVYK 168

 Score =  127 bits (319), Expect = 4e-28
 Identities = 77/128 (60%), Positives = 78/128 (60%), Gaps = 15/128 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYS---PPPVYHSPPPPKKH 160
           KSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y    PPP  +S PPP   
Sbjct: 148 KSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP- 204

Query: 161 YVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPP 316
           YVYKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPP
Sbjct: 205 YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPP 262

Query: 317 PKKHYVYK 340
           P   YVYK
Sbjct: 263 PP--YVYK 268

 Score =  127 bits (319), Expect = 4e-28
 Identities = 77/128 (60%), Positives = 78/128 (60%), Gaps = 15/128 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYS---PPPVYHSPPPPKKH 160
           KSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y    PPP  +S PPP   
Sbjct: 208 KSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP- 264

Query: 161 YVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPP 316
           YVYKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPP
Sbjct: 265 YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPP 322

Query: 317 PKKHYVYK 340
           P   YVYK
Sbjct: 323 PP--YVYK 328

 Score =  127 bits (319), Expect = 4e-28
 Identities = 75/127 (59%), Positives = 76/127 (59%), Gaps = 15/127 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKK 157
           KSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP  
Sbjct: 348 KSPPPPPYVYSSPPPSPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP- 404

Query: 158 HYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY---SPPPVYHSPPP 316
            YVYKSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y   SPPP  +  PP
Sbjct: 405 -YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPSPPPYVYKSPP 461

Query: 317 PKKHYVY 337
           P   Y Y
Sbjct: 462 PPPSYSY 468

 Score =  127 bits (318), Expect = 5e-28
 Identities = 77/126 (61%), Positives = 78/126 (61%), Gaps = 15/126 (11%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYV 166
           PPPP  + SPPP   VY SPPP    YVYKSPPPP   YS PP    VY SPPPP   YV
Sbjct: 341 PPPPYVYKSPPPPPYVYSSPPPSP--YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YV 396

Query: 167 YKSPPPPVKHY-SPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPK 322
           Y SPPPP   Y SPPP   VY SPPPP   YVYKSPPPP   YS PP    VY SP PP 
Sbjct: 397 YSSPPPPPYVYKSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSSPPPPPYVYKSPSPPP 454

Query: 323 KHYVYK 340
             YVYK
Sbjct: 455 --YVYK 458

 Score =  124 bits (310), Expect = 4e-27
 Identities = 74/124 (59%), Positives = 78/124 (62%), Gaps = 13/124 (10%)
 Frame = +2

Query: 8   PPPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKKHYVYK 172
           P PP   Y PP  +Y SPPPP   YVY SPPPP   Y SPPP   VY SPPPP   Y+YK
Sbjct: 33  PSPPSYVYKPPTHIYSSPPPPP--YVYSSPPPPPYIYKSPPPPPYVYSSPPPPP--YIYK 88

Query: 173 SPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKKH 328
           SPPPP   YS PP    +Y SPPPP   YVY SPPPP   Y SPPP   VY+SPPPP   
Sbjct: 89  SPPPPPYVYSSPPPPPYIYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYNSPPPPP-- 144

Query: 329 YVYK 340
           YVYK
Sbjct: 145 YVYK 148

 Score =  119 bits (298), Expect = 1e-25
 Identities = 73/121 (60%), Positives = 74/121 (61%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKK 157
           KSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y SPPP   VY SPPPP  
Sbjct: 368 KSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPPPPPYVYSSPPPPP- 424

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP-PPPVKHYSPPP------VYHSPPP 316
            YVYKSPPP      PP VY SPPPP   YVYKSP PPP  + SPPP       Y SPPP
Sbjct: 425 -YVYKSPPP------PPYVYSSPPPPP--YVYKSPSPPPYVYKSPPPPPSYSYSYSSPPP 475

Query: 317 P 319
           P
Sbjct: 476 P 476

 Score =  108 bits (269), Expect = 2e-22
 Identities = 59/101 (58%), Positives = 62/101 (61%), Gaps = 12/101 (11%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYV 166
           PPPP  + SPPP   VY SPPPP   YVYKSPPPP   YS PP    VY SPPPP   YV
Sbjct: 381 PPPPYVYKSPPPPPYVYSSPPPPP--YVYKSPPPPPYVYSSPPPPPYVYKSPPPPP--YV 436

Query: 167 YKSPPPPVKHY---SPPPVYHS--PPPPKKHYVYKSPPPPV 274
           Y SPPPP   Y   SPPP  +   PPPP   Y Y SPPPP+
Sbjct: 437 YSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPPPI 477

 Score =  100 bits (248), Expect = 7e-20
 Identities = 60/113 (53%), Positives = 63/113 (55%), Gaps = 8/113 (7%)
 Frame = +2

Query: 26  HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 205
           H S    Y  P PP   YVYK P        PPP  +S PPP   Y+YKSPPPP   YS 
Sbjct: 23  HTSAQYTYSPPSPPS--YVYKPPTHIYSSPPPPPYVYSSPPPPP-YIYKSPPPPPYVYSS 79

Query: 206 PP----VYHSPPPPKKHYVYKSPPPPVKHY-SPPP---VYHSPPPPKKHYVYK 340
           PP    +Y SPPPP   YVY SPPPP   Y SPPP   VY SPPPP   YVYK
Sbjct: 80  PPPPPYIYKSPPPPP--YVYSSPPPPPYIYKSPPPPPYVYSSPPPPP--YVYK 128

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 41/72 (56%), Positives = 43/72 (59%), Gaps = 9/72 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHY---SPPPVYHS--PPPPK 154
           KSPPPP   YS PP    VY SPPPP   YVY SPPPP   Y   SPPP  +   PPPP 
Sbjct: 408 KSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYSSPPPPPYVYKSPSPPPYVYKSPPPPPS 465

Query: 155 KHYVYKSPPPPV 190
             Y Y SPPPP+
Sbjct: 466 YSYSYSSPPPPI 477

[41][TOP]
>UniRef100_B9IAD8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAD8_POPTR
          Length = 379

 Score =  130 bits (327), Expect = 5e-29
 Identities = 68/129 (52%), Positives = 71/129 (55%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP  Y SPPPP  H    YVYKSPPPP     PP +Y SPPPP      
Sbjct: 50  KSPPPPSPSPPPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPP 109

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            Y YKSPPPP     PP +Y SPPPP       YVYKSPPPP     PP +Y SPPPP  
Sbjct: 110 PYEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSP 169

Query: 326 H----YVYK 340
                Y YK
Sbjct: 170 SPPPPYYYK 178

 Score =  129 bits (325), Expect = 8e-29
 Identities = 67/124 (54%), Positives = 71/124 (57%), Gaps = 12/124 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP  H  P  VY SPPPP       Y+YK
Sbjct: 42  SPPPPYVYKSPPPPSPSPPPP---YEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYIYK 98

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 328
           SPPPP     PP  Y SPPPP       Y+YKSPPPP     PP VY SPPPP       
Sbjct: 99  SPPPPSPSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPP 158

Query: 329 YVYK 340
           Y+YK
Sbjct: 159 YIYK 162

 Score =  124 bits (312), Expect = 2e-27
 Identities = 66/117 (56%), Positives = 68/117 (58%), Gaps = 10/117 (8%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YV 166
           SPPPP  + SPPP   SPPPP   Y Y+SPPPP    SPPP YH  SPPPP       Y 
Sbjct: 250 SPPPPYHYKSPPPPSPSPPPP---YYYRSPPPPSS--SPPPPYHYSSPPPPSPSPPPPYY 304

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           YKSPPPP     PP  Y SPPPP       YVYKSPPPP     PP  YHSPPP  K
Sbjct: 305 YKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYHSPPPAMK 361

 Score =  124 bits (311), Expect = 3e-27
 Identities = 67/125 (53%), Positives = 71/125 (56%), Gaps = 13/125 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP +Y SPPPP       YVYK
Sbjct: 90  SPPPPYIYKSPPPPSPSPPPP---YEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYK 146

Query: 173 SPPPPVKHYSPPPVYHSPPPP-----KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 328
           SPPPP     PP +Y SPPPP       +Y YKSPPPP     PP VY SPPPP      
Sbjct: 147 SPPPPSPSPPPPYIYKSPPPPSPSPPPPYY-YKSPPPPSPSPPPPYVYKSPPPPSSSPPP 205

Query: 329 -YVYK 340
            Y YK
Sbjct: 206 PYYYK 210

 Score =  121 bits (303), Expect = 3e-26
 Identities = 67/118 (56%), Positives = 70/118 (59%), Gaps = 13/118 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP VY SPPPP       Y YK
Sbjct: 154 SPPPPYIYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYK 210

Query: 173 -------SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPP 319
                  SPPPP  + SPPP+  SPPPP   Y YKSPPPP    SPPP YH  SPPPP
Sbjct: 211 SPSPPSSSPPPPYYYKSPPPLSPSPPPP---YYYKSPPPP--DPSPPPPYHYKSPPPP 263

 Score =  120 bits (302), Expect = 4e-26
 Identities = 63/116 (54%), Positives = 67/116 (57%), Gaps = 4/116 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y+YKSPPPP     PP  Y SPPPP       YVYK
Sbjct: 138 SPPPPYVYKSPPPPSPSPPPP---YIYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYK 194

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           SPPPP     PP  Y SP PP       SPPPP  + SPPP+  SPPPP   Y YK
Sbjct: 195 SPPPPSSSPPPPYYYKSPSPPS-----SSPPPPYYYKSPPPLSPSPPPP---YYYK 242

 Score =  120 bits (301), Expect = 5e-26
 Identities = 64/116 (55%), Positives = 66/116 (56%), Gaps = 4/116 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       SPPP
Sbjct: 234 SPPPPYYYKSPPPPDPSPPPP---YHYKSPPPPSPSPPPPYYYRSPPPPS-----SSPPP 285

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 340
           P  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       YVYK
Sbjct: 286 PYHYSSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYK 338

 Score =  119 bits (298), Expect = 1e-25
 Identities = 72/136 (52%), Positives = 75/136 (55%), Gaps = 23/136 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYK-------SPPPPVKHYSPPPVYHSPPP 148
           KSPPPP     PP VY SPPPP       Y YK       SPPPP  + SPPP+  SPPP
Sbjct: 178 KSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYKSPPPLSPSPPP 237

Query: 149 PKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVKHYSPPPVYH-- 304
           P   Y YKSPPPP    SPPP YH  SPPPP       Y Y+SPPPP    SPPP YH  
Sbjct: 238 P---YYYKSPPPP--DPSPPPPYHYKSPPPPSPSPPPPYYYRSPPPPSS--SPPPPYHYS 290

Query: 305 SPPPPKKH----YVYK 340
           SPPPP       Y YK
Sbjct: 291 SPPPPSPSPPPPYYYK 306

 Score =  118 bits (296), Expect = 2e-25
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 12/111 (10%)
 Frame = +2

Query: 44  VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPP 211
           VY SPPPP   YVYKSPPPP     PP  Y SPPPP  H    YVYKSPPPP     PP 
Sbjct: 39  VYSSPPPP---YVYKSPPPPSPSPPPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPY 95

Query: 212 VYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 340
           +Y SPPPP       Y YKSPPPP     PP +Y SPPPP       YVYK
Sbjct: 96  IYKSPPPPSPSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYK 146

 Score =  116 bits (290), Expect = 9e-25
 Identities = 64/116 (55%), Positives = 66/116 (56%), Gaps = 11/116 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   YVYKSPPPP     PP  Y SP PP       Y YK
Sbjct: 170 SPPPPYYYKSPPPPSPSPPPP---YVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYK 226

Query: 173 SPPP-----PVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPP     P  +Y  SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP
Sbjct: 227 SPPPLSPSPPPPYYYKSPPPPDPSPPPP---YHYKSPPPPSPSPPPPYYYRSPPPP 279

 Score =  112 bits (281), Expect = 1e-23
 Identities = 62/116 (53%), Positives = 65/116 (56%), Gaps = 11/116 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y Y SPPPP     PP  Y SPPPP       Y YK
Sbjct: 266 SPPPPYYYRSPPPPSSSPPPP---YHYSSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 322

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPP---PVYHSPPPP 319
           SPPPP     PP VY SPPPP       Y Y SPPP +K  SPP    +Y SPPPP
Sbjct: 323 SPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYHSPPPAMK--SPPLSVYIYASPPPP 376

 Score =  111 bits (277), Expect = 3e-23
 Identities = 57/102 (55%), Positives = 60/102 (58%), Gaps = 9/102 (8%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       YVYK
Sbjct: 282 SPPPPYHYSSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYK 338

Query: 173 SPPPPVKHYSPPPVYHSPP-----PPKKHYVYKSPPPPVKHY 283
           SPPPP     PP  YHSPP     PP   Y+Y SPPPP+ HY
Sbjct: 339 SPPPPSPSPPPPYYYHSPPPAMKSPPLSVYIYASPPPPI-HY 379

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 37/64 (57%), Positives = 39/64 (60%), Gaps = 4/64 (6%)
 Frame = +2

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 328
           YVY SPPPP  + SPPP   SPPPP   Y YKSPPPP  H  P  VY SPPPP       
Sbjct: 38  YVYSSPPPPYVYKSPPPPSPSPPPP---YEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPP 94

Query: 329 YVYK 340
           Y+YK
Sbjct: 95  YIYK 98

[42][TOP]
>UniRef100_Q9LJK0 Genomic DNA, chromosome 3, P1 clone: MZN14 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LJK0_ARATH
          Length = 1018

 Score =  129 bits (324), Expect = 1e-28
 Identities = 69/118 (58%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP  VY SPPPP   Y
Sbjct: 486 KSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP---Y 542

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP  VY SPPPP   YVY SPPPP    SP  VY SPPPP   YVY
Sbjct: 543 VYSSPPPPYYSPSPKVVYKSPPPP---YVYSSPPPPYYSPSPKVVYKSPPPP---YVY 594

 Score =  129 bits (323), Expect = 1e-28
 Identities = 68/118 (57%), Positives = 72/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
            KSPPPP  + SPPP Y+SP P     VYKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 703  KSPPPPYVYSSPPPPYYSPSPK---VVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPY 759

Query: 164  VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
            VY SPPPP    SP  VY SPPPP   YVY SPPPP    SP  VY SPPPP   YVY
Sbjct: 760  VYSSPPPPYYSPSPKVVYKSPPPP---YVYSSPPPPYYSPSPKVVYKSPPPP---YVY 811

 Score =  128 bits (321), Expect = 2e-28
 Identities = 68/118 (57%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP  +Y SPPPP   Y
Sbjct: 461 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPP---Y 517

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP  VY SPPPP   YVY SPPPP    SP  VY SPPPP   YVY
Sbjct: 518 VYSSPPPPYYSPSPKVVYKSPPPP---YVYSSPPPPYYSPSPKVVYKSPPPP---YVY 569

 Score =  128 bits (321), Expect = 2e-28
 Identities = 66/118 (55%), Positives = 74/118 (62%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPPP  + SPPP Y+SP P     VYKSPPPP  + SPPP Y+SP P     VYKSPP
Sbjct: 778  KSPPPPYVYSSPPPPYYSPSPK---VVYKSPPPPYVYSSPPPPYYSPSP---KVVYKSPP 831

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
            PP  + SPPP Y+SP P     VYKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 832  PPYVYSSPPPPYYSPSP---KVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 886

 Score =  127 bits (320), Expect = 3e-28
 Identities = 67/118 (56%), Positives = 72/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P     VYKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 436 KSPPPPYVYSSPPPPYYSPSPK---VVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 492

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP  +Y SPPPP   YVY SPPPP    SP  VY SPPPP   YVY
Sbjct: 493 VYSSPPPPYYSPSPKVLYKSPPPP---YVYSSPPPPYYSPSPKVVYKSPPPP---YVY 544

 Score =  127 bits (319), Expect = 4e-28
 Identities = 66/118 (55%), Positives = 73/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P     VYKSPPPP  + SPPP Y++P P     VYKSPP
Sbjct: 361 KSPPPPYVYSSPPPPYYSPSPK---IVYKSPPPPYVYSSPPPPYYTPSP---KVVYKSPP 414

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY SPPPP    SP  VY SPPPP   YVY
Sbjct: 415 PPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP---YVY 469

 Score =  126 bits (317), Expect = 7e-28
 Identities = 62/105 (59%), Positives = 70/105 (66%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P     VYKSPPPP  + SPPP Y+SP P     VYKSPP
Sbjct: 511 KSPPPPYVYSSPPPPYYSPSPK---VVYKSPPPPYVYSSPPPPYYSPSP---KVVYKSPP 564

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           PP  + SPPP Y+SP P     VYKSPPPP  + SPPP Y+SP P
Sbjct: 565 PPYVYSSPPPPYYSPSP---KVVYKSPPPPYVYSSPPPPYYSPSP 606

 Score =  126 bits (316), Expect = 9e-28
 Identities = 72/137 (52%), Positives = 77/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
            KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP  VY SPPPP   Y
Sbjct: 728  KSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP---Y 784

Query: 164  VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
            VY SPPPP       V + SPPP  VY SPPP    P    VYKSPPPP  + SPPP Y+
Sbjct: 785  VYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYY 844

Query: 305  SPPP------PKKHYVY 337
            SP P      P   YVY
Sbjct: 845  SPSPKVVYKSPPPPYVY 861

 Score =  125 bits (315), Expect = 1e-27
 Identities = 65/118 (55%), Positives = 73/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P     VYKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 186 KSPPPPYVYSSPPPPYYSPSPK---VVYKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 239

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P     VYKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 240 PPYVYSSPPPPYYSPSP---KIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 294

 Score =  125 bits (315), Expect = 1e-27
 Identities = 66/118 (55%), Positives = 72/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P     VYKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 286 KSPPPPYVYSSPPPPYYSPSPK---VVYKSPPPPYVYSSPPPPYYSPTPKVD---YKSPP 339

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY SPPPP    SP  VY SPPPP   YVY
Sbjct: 340 PPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPP---YVY 394

 Score =  125 bits (313), Expect = 2e-27
 Identities = 66/118 (55%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y++P P     VYKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 386 KSPPPPYVYSSPPPPYYTPSPK---VVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 442

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP  VY SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 443 VYSSPPPPYYSPSPKVVYKSPPPP---YVYSSPPPPYYSPSPKVDYKSPPPP---YVY 494

 Score =  124 bits (311), Expect = 3e-27
 Identities = 72/137 (52%), Positives = 78/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
            KS PPP  + SPPP YHSP P K HY  KSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 653  KSSPPPYVYSSPPPPYHSPSP-KVHY--KSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPY 709

Query: 164  VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
            VY SPPPP       V + SPPP  VY SPPP    P    VYKSPPPP  + SPPP Y+
Sbjct: 710  VYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYY 769

Query: 305  SPPP------PKKHYVY 337
            SP P      P   YVY
Sbjct: 770  SPSPKVVYKSPPPPYVY 786

 Score =  124 bits (310), Expect = 4e-27
 Identities = 70/137 (51%), Positives = 77/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY 
Sbjct: 236 KSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYS 295

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           SPPP    P    VYKSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+
Sbjct: 296 SPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVD---YKSPPPPYVYSSPPPPYY 352

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 353 SPSPKVDYKSPPPPYVY 369

 Score =  124 bits (310), Expect = 4e-27
 Identities = 71/137 (51%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
            KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP  VY SPPPP   Y
Sbjct: 803  KSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP---Y 859

Query: 164  VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
            VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 860  VYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 919

Query: 305  SPPP------PKKHYVY 337
            SP P      P   YVY
Sbjct: 920  SPSPKVDYKSPPPPYVY 936

 Score =  123 bits (308), Expect = 7e-27
 Identities = 69/137 (50%), Positives = 77/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 311 KSPPPPYVYSSPPPPYYSPTPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 367

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       + + SPPP  VY SPPP    P    VYKSPPPP  + SPPP Y+
Sbjct: 368 VYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYY 427

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 428 SPSPKVDYKSPPPPYVY 444

 Score =  121 bits (304), Expect = 2e-26
 Identities = 65/118 (55%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  +   YKSPP P  + SPPP Y+SP P      P   Y
Sbjct: 136 KSPPPPYVYSSPPPPYYSPSPKVE---YKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPPY 192

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP  VY SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 193 VYSSPPPPYYSPSPKVVYKSPPPP---YVYSSPPPPYYSPSPKVDYKSPPPP---YVY 244

 Score =  121 bits (303), Expect = 3e-26
 Identities = 69/139 (49%), Positives = 76/139 (54%), Gaps = 27/139 (19%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP+   SP   Y SPPPP   Y
Sbjct: 86  KSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPP---Y 142

Query: 164 VYKSPPPPVKHYSPPP-----------VYHSPPP----PKKHYVYKSPPPPVKHYSPPPV 298
           VY SPPPP  +YSP P           VY+SPPP    P     YKSPPPP  + SPPP 
Sbjct: 143 VYSSPPPP--YYSPSPKVEYKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPPPP 200

Query: 299 YHSPPP------PKKHYVY 337
           Y+SP P      P   YVY
Sbjct: 201 YYSPSPKVVYKSPPPPYVY 219

 Score =  121 bits (303), Expect = 3e-26
 Identities = 63/118 (53%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 853  KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 906

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
            PP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 907  PPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPPYVY 961

 Score =  120 bits (301), Expect = 5e-26
 Identities = 66/131 (50%), Positives = 74/131 (56%), Gaps = 19/131 (14%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 878  KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 931

Query: 182  PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPPVYHSPPP-- 316
            PP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP Y+SP P  
Sbjct: 932  PPYVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKV 991

Query: 317  ----PKKHYVY 337
                P   YVY
Sbjct: 992  DYKSPPPPYVY 1002

 Score =  117 bits (293), Expect = 4e-25
 Identities = 70/146 (47%), Positives = 77/146 (52%), Gaps = 36/146 (24%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPPVYHSP 142
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPP  YH+P
Sbjct: 561 KSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAP 620

Query: 143 -----------------PPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 253
                            PPP   Y      VYKS PPP  + SPPP YHS P PK H  Y
Sbjct: 621 SPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHS-PSPKVH--Y 677

Query: 254 KSPPPPVKHYSPPPVYHSPPPPKKHY 331
           KSPPPP  + SPPP Y+S P PK HY
Sbjct: 678 KSPPPPYVYSSPPPPYYS-PSPKVHY 702

 Score =  117 bits (292), Expect = 5e-25
 Identities = 63/115 (54%), Positives = 70/115 (60%), Gaps = 9/115 (7%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 903  KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPAPKVD---YKSPP 956

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPPP 319
            PP  + SPPP Y+SP P      YKSPPPP       V + SPPP  VY SPPPP
Sbjct: 957  PPYVYSSPPPPYYSPSPKVD---YKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 1008

 Score =  116 bits (290), Expect = 9e-25
 Identities = 71/157 (45%), Positives = 76/157 (48%), Gaps = 45/157 (28%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSP---------------------------------PPPKKHY- 79
            KSPPPP  + SPPP Y+SP                                 PPP   Y 
Sbjct: 586  KSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCPPPPPCYS 645

Query: 80   -----VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP---- 232
                 VYKS PPP  + SPPP YHS P PK H  YKSPPPP  + SPPP Y+SP P    
Sbjct: 646  PSPKVVYKSSPPPYVYSSPPPPYHS-PSPKVH--YKSPPPPYVYSSPPPPYYSPSPKVHY 702

Query: 233  --PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
              P   YVY SPPPP    SP  VY SPPPP   YVY
Sbjct: 703  KSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP---YVY 736

 Score =  115 bits (287), Expect = 2e-24
 Identities = 62/117 (52%), Positives = 68/117 (58%), Gaps = 6/117 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYV 166
           SP P V + SPPP Y+SP P  +   YKSPPPP  + SPPP Y+SP P      P   YV
Sbjct: 62  SPAPKVDYKSPPPPYYSPSPKVE---YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV 118

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           Y SPPPP+   SP   Y SPPPP   YVY SPPPP    SP   Y SPP P   YVY
Sbjct: 119 YSSPPPPIYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVEYKSPPSP---YVY 169

 Score =  110 bits (276), Expect = 4e-23
 Identities = 62/112 (55%), Positives = 64/112 (57%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPP P  + SPPP     P PK  Y  KSPPPP    SP   Y SPPPP   YVY SPP
Sbjct: 44  KSPPLPDVYSSPPPPLEYSPAPKVDY--KSPPPPYYSPSPKVEYKSPPPP---YVYNSPP 98

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP    SP   Y SPPPP   YVY SPPPP+   SP   Y SPPPP   YVY
Sbjct: 99  PPYYSPSPKVDYKSPPPP---YVYSSPPPPIYSPSPKVDYKSPPPP---YVY 144

 Score =  105 bits (263), Expect = 1e-21
 Identities = 56/98 (57%), Positives = 60/98 (61%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 928  KSPPPPYVYSSPPPPYYSPAPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 981

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 295
            PP    SP   Y SPPPP   YVY SPPPP   YSP P
Sbjct: 982  PPYYSPSPKVDYKSPPPP---YVYSSPPPP--SYSPSP 1014

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 52/110 (47%), Positives = 57/110 (51%), Gaps = 11/110 (10%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPPP- 211
           P   S PPP     Y  P P V++ SPP   VY SPPPP ++    SP P V + SPPP 
Sbjct: 25  PYTDSSPPP-----YSVPLPKVEYKSPPLPDVYSSPPPPLEY----SPAPKVDYKSPPPP 75

Query: 212 V--------YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
                    Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 76  YYSPSPKVEYKSPPPP---YVYNSPPPPYYSPSPKVDYKSPPPP---YVY 119

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 29/66 (43%), Positives = 35/66 (53%), Gaps = 13/66 (19%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP-------------PKKHYVYKSPPPPVKHYSPPPVYHSP 142
            KSPPPP  + SPPP Y+SP P             P     YKSPPPP  + SPPP  +SP
Sbjct: 953  KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPSYSP 1012

Query: 143  PPPKKH 160
             P  ++
Sbjct: 1013 SPKTEY 1018

[43][TOP]
>UniRef100_Q8H9E1 Extensin (Fragment) n=1 Tax=Solanum tuberosum RepID=Q8H9E1_SOLTU
          Length = 152

 Score =  129 bits (323), Expect = 1e-28
 Identities = 70/113 (61%), Positives = 71/113 (62%), Gaps = 8/113 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP    VYKSPPP
Sbjct: 26  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPPP--VYKSPPP 80

Query: 185 PVKHYS--PPPV--YHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPP 319
           PV  Y   PPPV  Y SPPPP   Y YKSPPPPV  Y   PPPV  Y SPPPP
Sbjct: 81  PVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 133

 Score =  127 bits (318), Expect = 5e-28
 Identities = 65/115 (56%), Positives = 68/115 (59%), Gaps = 6/115 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSP 178
           SPPPP  + SPPP   SPPPP   Y YKSPPPP   Y   PPPVY    PP   Y YKSP
Sbjct: 42  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSP 98

Query: 179 PPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           PPP   Y     PPPVY    PP   Y YKSPPPPV H SP P Y++ PPP  HY
Sbjct: 99  PPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV-HKSPAPYYYTSPPPPSHY 152

 Score =  125 bits (313), Expect = 2e-27
 Identities = 68/117 (58%), Positives = 69/117 (58%), Gaps = 4/117 (3%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP     PP VY SPPPP       SPPPP  + SPPP   SPPPP   Y YKSPP
Sbjct: 2   KSPPPPSPSLPPPYVYKSPPPPSP-----SPPPPYYYKSPPPPSPSPPPP---YYYKSPP 53

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV--YHSPPPPKKHYVYK 340
           PP     PP  Y SPPPP    VYKSPPPPV  Y   PPPV  Y SPPPP   Y YK
Sbjct: 54  PPSPSPPPPYYYKSPPPPPP--VYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYK 108

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/66 (53%), Positives = 35/66 (53%), Gaps = 8/66 (12%)
 Frame = +2

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH-- 328
           YKSPPPP     PP VY SPPPP       Y YKSPPPP     PP  Y SPPPP     
Sbjct: 1   YKSPPPPSPSLPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP 60

Query: 329 --YVYK 340
             Y YK
Sbjct: 61  PPYYYK 66

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 32/54 (59%), Positives = 34/54 (62%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPPV  Y       SPPPP   Y YKSPPPPV H SP P Y++ PPP  HY
Sbjct: 108 KSPPPPVYKYK------SPPPPV--YKYKSPPPPV-HKSPAPYYYTSPPPPSHY 152

[44][TOP]
>UniRef100_Q40415 Extensin (Fragment) n=1 Tax=Nicotiana sylvestris RepID=Q40415_NICSY
          Length = 131

 Score =  128 bits (322), Expect = 2e-28
 Identities = 65/105 (61%), Positives = 68/105 (64%), Gaps = 8/105 (7%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPV-KHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYS---- 202
           Y SPPPP K YVY SPPPPV K+ SPP   P+Y SPPPP   Y YKSPPPP+  Y     
Sbjct: 22  YSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPV--YKYKSPPPPIYKYKSPPP 79

Query: 203 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PPPVY SPPPP   Y    PPPPV    PPPVY SPPPP  HY Y
Sbjct: 80  PPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSPPPP-YHYYY 123

 Score =  122 bits (307), Expect = 9e-27
 Identities = 70/117 (59%), Positives = 74/117 (63%), Gaps = 8/117 (6%)
 Frame = +2

Query: 5   SPPPPV-KHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPPPKKH 160
           SPPPPV K+ SPPP   +Y SPPPP   Y YKSPPPP+  Y     PPPVY SPPPP   
Sbjct: 36  SPPPPVYKYKSPPPPLPIYRSPPPPV--YKYKSPPPPIYKYKSPPPPPPVYKSPPPPV-- 91

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           Y YKSPPP      PPPVY SPPPP    VYKSPPPP  +Y     Y SPPPP  HY
Sbjct: 92  YKYKSPPP------PPPVYKSPPPP----VYKSPPPPYHYY-----YTSPPPP--HY 131

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 36/65 (55%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = +2

Query: 152 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKK 325
           K +Y Y SPPPP K Y    VY SPPPP   Y YKSPPPP+  Y   PPPVY    PP  
Sbjct: 17  KANYYYSSPPPPTKKY----VYSSPPPPV--YKYKSPPPPLPIYRSPPPPVYKYKSPPPP 70

Query: 326 HYVYK 340
            Y YK
Sbjct: 71  IYKYK 75

[45][TOP]
>UniRef100_O24099 MtN12 protein (Fragment) n=1 Tax=Medicago truncatula
           RepID=O24099_MEDTR
          Length = 113

 Score =  128 bits (321), Expect = 2e-28
 Identities = 67/112 (59%), Positives = 71/112 (63%), Gaps = 7/112 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           SPPPPV H  P PVYHSPPPP   Y     VY SPPPPV  Y P PVYHSPPPP   YV 
Sbjct: 4   SPPPPVHHTYPKPVYHSPPPPVHTYPHPKPVYHSPPPPVHTY-PKPVYHSPPPPVHTYV- 61

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPP 319
             P P   ++SPPP  H+ PP   H VY SPPPPV H  PPP Y+  SPPPP
Sbjct: 62  --PHPKPVYHSPPPPVHTYPPHVPHPVYHSPPPPV-HSPPPPHYYYKSPPPP 110

 Score =  120 bits (300), Expect = 6e-26
 Identities = 67/112 (59%), Positives = 68/112 (60%), Gaps = 13/112 (11%)
 Frame = +2

Query: 44  VYHSPPPPKKHY----VYKSPPPPVKHYS-PPPVYHSPPPPKKHY---VYKSPPPPVKHY 199
           VYHSPPPP  H     VY SPPPPV  Y  P PVYHSPPPP   Y   VY SPPPPV  Y
Sbjct: 1   VYHSPPPPVHHTYPKPVYHSPPPPVHTYPHPKPVYHSPPPPVHTYPKPVYHSPPPPVHTY 60

Query: 200 --SPPPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPVYHSPPPPKKHYVYK 340
              P PVYHSPPPP   Y     PP V H   +SPPP  HSPPPP  HY YK
Sbjct: 61  VPHPKPVYHSPPPPVHTY-----PPHVPHPVYHSPPPPVHSPPPP--HYYYK 105

[46][TOP]
>UniRef100_B9GU80 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9GU80_POPTR
          Length = 153

 Score =  128 bits (321), Expect = 2e-28
 Identities = 65/115 (56%), Positives = 66/115 (57%), Gaps = 8/115 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       Y YK
Sbjct: 24  SPPPPYHYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 80

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           SPPPP     PP  Y SPPPP       YVYKSPPPP     PP  YHSPPPP K
Sbjct: 81  SPPPPSPSPPPPYYYKSPPPPSSSPPPPYVYKSPPPPSPSPPPPYYYHSPPPPVK 135

 Score =  124 bits (311), Expect = 3e-27
 Identities = 68/120 (56%), Positives = 70/120 (58%), Gaps = 11/120 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       Y YK
Sbjct: 40  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 96

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPP---VYHSPPPPKKHY 331
           SPPPP     PP VY SPPPP       Y Y SPPPPVK  SPPP   +Y SPPPP  HY
Sbjct: 97  SPPPPSSSPPPPYVYKSPPPPSPSPPPPYYYHSPPPPVK--SPPPPVYIYASPPPP-THY 153

 Score =  119 bits (299), Expect = 8e-26
 Identities = 64/124 (51%), Positives = 67/124 (54%), Gaps = 13/124 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       Y YK
Sbjct: 8   SPPPPYYYKSPPPPSPSPPPP---YHYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 64

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPK-----K 325
           SPPPP     PP  Y SPPPP       Y YKSPPPP     PP VY SPPPP       
Sbjct: 65  SPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSSSPPPPYVYKSPPPPSPSPPPP 124

Query: 326 HYVY 337
           +Y +
Sbjct: 125 YYYH 128

 Score =  118 bits (295), Expect = 2e-25
 Identities = 62/117 (52%), Positives = 62/117 (52%), Gaps = 12/117 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 160
           SPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP       
Sbjct: 1   SPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 60

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
           Y YKSPPPP     PP  Y SPPPP       Y YKSPPPP     PP VY SPPPP
Sbjct: 61  YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSSSPPPPYVYKSPPPP 117

 Score =  112 bits (281), Expect = 1e-23
 Identities = 64/117 (54%), Positives = 64/117 (54%), Gaps = 14/117 (11%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH----YVYKSPPPPVK 193
           SPPP   SPPPP   Y YKSPPPP    SPPP YH  SPPPP       Y YKSPPPP  
Sbjct: 1   SPPPPSPSPPPP---YYYKSPPPPSP--SPPPPYHYKSPPPPSPSPPPPYYYKSPPPPSP 55

Query: 194 HYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 340
              PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP       YVYK
Sbjct: 56  SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSSSPPPPYVYK 112

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 38/66 (57%), Positives = 41/66 (62%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP     PP VY SPPPP       SPPPP  ++SPPP   SPPPP   Y+Y SPP
Sbjct: 96  KSPPPPSSSPPPPYVYKSPPPPS-----PSPPPPYYYHSPPPPVKSPPPPV--YIYASPP 148

Query: 182 PPVKHY 199
           PP  HY
Sbjct: 149 PPT-HY 153

[47][TOP]
>UniRef100_Q9FG07 Gb|AAD23015.1 n=2 Tax=Arabidopsis thaliana RepID=Q9FG07_ARATH
          Length = 434

 Score =  127 bits (319), Expect = 4e-28
 Identities = 68/119 (57%), Positives = 77/119 (64%), Gaps = 6/119 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P   +  YKSPPPP  + SPPP Y+S P PK H  YKSPP
Sbjct: 321 KSPPPPYVYSSPPPPYYSPSP---NVYYKSPPPPYVYSSPPPPYYS-PSPKVH--YKSPP 374

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVYK 340
           PP  + SPPP Y+S P PK H  YKSPPPP  + SPPP Y+SP P      P   YVYK
Sbjct: 375 PPYVYSSPPPPYYS-PSPKVH--YKSPPPPYVYSSPPPPYYSPSPKVTYKSPPPPYVYK 430

 Score =  124 bits (312), Expect = 2e-27
 Identities = 69/118 (58%), Positives = 78/118 (66%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P  K Y YKSPP
Sbjct: 71  KSPPPPYVYNSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPP 124

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP+Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 125 PPYVYSSPPPLYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 179

 Score =  124 bits (312), Expect = 2e-27
 Identities = 69/118 (58%), Positives = 78/118 (66%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP+Y+SP P  K Y YKSPP
Sbjct: 96  KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPLYYSPSP--KVY-YKSPP 149

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 150 PPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 204

 Score =  124 bits (310), Expect = 4e-27
 Identities = 70/129 (54%), Positives = 78/129 (60%), Gaps = 19/129 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 246 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPY 302

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P  +  YKSPPPP  + SPPP Y+
Sbjct: 303 VYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPYY 362

Query: 305 SPPPPKKHY 331
           S P PK HY
Sbjct: 363 S-PSPKVHY 370

 Score =  123 bits (309), Expect = 6e-27
 Identities = 71/137 (51%), Positives = 79/137 (57%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP+Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 121 KSPPPPYVYSSPPPLYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPY 177

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 178 VYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 237

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 238 SPSPKVYYKSPPPPYVY 254

 Score =  123 bits (309), Expect = 6e-27
 Identities = 69/118 (58%), Positives = 77/118 (65%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P  K Y YKSPP
Sbjct: 171 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPP 224

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 225 PPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 279

 Score =  122 bits (306), Expect = 1e-26
 Identities = 71/137 (51%), Positives = 78/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY 
Sbjct: 221 KSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYS 280

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           SPPP    P     YKSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+
Sbjct: 281 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYY 337

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 338 SPSPNVYYKSPPPPYVY 354

 Score =  111 bits (278), Expect = 2e-23
 Identities = 63/115 (54%), Positives = 73/115 (63%), Gaps = 6/115 (5%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           P P  + SPPP Y+  P PK +  YKSPPPP  + SPPP Y+SP P  K Y YKSPPPP 
Sbjct: 49  PKPYVYSSPPPPYY-TPSPKVN--YKSPPPPYVYNSPPPPYYSPSP--KVY-YKSPPPPY 102

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
            + SPPP Y+SP P  K Y YKSPPPP  + SPPP+Y+SP P      P   YVY
Sbjct: 103 VYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVY 154

 Score =  107 bits (268), Expect = 3e-22
 Identities = 56/96 (58%), Positives = 64/96 (66%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P K HY  KSPPPP  + SPPP Y+SP P K HY  KSPP
Sbjct: 346 KSPPPPYVYSSPPPPYYSPSP-KVHY--KSPPPPYVYSSPPPPYYSPSP-KVHY--KSPP 399

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 289
           PP  + SPPP Y+SP P      YKSPPPP  + +P
Sbjct: 400 PPYVYSSPPPPYYSPSPK---VTYKSPPPPYVYKTP 432

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/112 (49%), Positives = 62/112 (55%), Gaps = 9/112 (8%)
 Frame = +2

Query: 29  YSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-VKHY 199
           YS P  P Y SP    K   Y   P P  + SPPP Y++P P      YKSPPPP V + 
Sbjct: 25  YSSPHTPAYDSPSYEHKGPKYAPHPKPYVYSSPPPPYYTPSPKVN---YKSPPPPYVYN- 80

Query: 200 SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 81  SPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 129

[48][TOP]
>UniRef100_Q94ES3 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES3_PEA
          Length = 137

 Score =  127 bits (319), Expect = 4e-28
 Identities = 72/127 (56%), Positives = 73/127 (57%), Gaps = 20/127 (15%)
 Frame = +2

Query: 8   PPPPVKHYSPP-PVYHSPPPP-KKHYVYKSPPPPVKHY--SPPPVYHSPPPP-----KKH 160
           PPPPV  Y  P PVYHSPPPP KK Y Y SPPPP  H    P PVYHSPPPP       H
Sbjct: 13  PPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPH 72

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--------VYKSPPPPVKHYSPPP---VYHS 307
            VY SPPPP   +  P  Y SPPPP  H         VY SPPPPV  YSPPP    Y S
Sbjct: 73  PVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPV--YSPPPPAYYYKS 130

Query: 308 PPPPKKH 328
           PPPP  H
Sbjct: 131 PPPPYHH 137

 Score =  113 bits (282), Expect = 7e-24
 Identities = 64/116 (55%), Positives = 65/116 (56%), Gaps = 30/116 (25%)
 Frame = +2

Query: 62  PPKKHYVYKSPPPPVKHY--SPPPVYHSPPPP-KKHYVYKSPPPPVKH---------YSP 205
           P KK Y Y SPPPP  H    P PVYHSPPPP KK Y Y SPPPP  H         +SP
Sbjct: 2   PHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSP 61

Query: 206 P----------PVYHSPPPP----KKHYVYKSPPPPVKHYSPP----PVYHSPPPP 319
           P          PVYHSPPPP    KK Y Y SPPPP  H  PP    PVYHSPPPP
Sbjct: 62  PPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP 117

 Score =  109 bits (272), Expect = 1e-22
 Identities = 60/109 (55%), Positives = 61/109 (55%), Gaps = 9/109 (8%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-SPPPVYHSPPPP----KKHYVY 169
           SPPPP  H  P P          H VY SPPPPV  Y  P PVYHSPPPP    KK Y Y
Sbjct: 42  SPPPPPVHTYPHP----------HPVYHSPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKY 91

Query: 170 KSPPPPVKHYSPP----PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
            SPPPP  H  PP    PVYHSPPPP    VY  PPP   + SPPP YH
Sbjct: 92  PSPPPPPAHTYPPHVPTPVYHSPPPP----VYSPPPPAYYYKSPPPPYH 136

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/81 (58%), Positives = 47/81 (58%), Gaps = 17/81 (20%)
 Frame = +2

Query: 5   SPPPPVKHYSPP-PVYHSPPPP----KKHYVYKSPPPP------------VKHYSPPPVY 133
           SPPPPV  Y  P PVYHSPPPP    KK Y Y SPPPP            V H  PPPVY
Sbjct: 60  SPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVY 119

Query: 134 HSPPPPKKHYVYKSPPPPVKH 196
            SPPPP   Y YKSPPPP  H
Sbjct: 120 -SPPPPA--YYYKSPPPPYHH 137

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 42/67 (62%), Positives = 42/67 (62%), Gaps = 5/67 (7%)
 Frame = +2

Query: 146 PPKKHYVYKSPPPPVKHY--SPPPVYHSPPPP-KKHYVYKSPPPPVKHY--SPPPVYHSP 310
           P KK Y Y SPPPP  H    P PVYHSPPPP KK Y Y SPPPP  H    P PVYHSP
Sbjct: 2   PHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSP 61

Query: 311 PPPKKHY 331
           PPP   Y
Sbjct: 62  PPPVHTY 68

[49][TOP]
>UniRef100_Q01943 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01943_SOLLC
          Length = 181

 Score =  127 bits (319), Expect = 4e-28
 Identities = 68/125 (54%), Positives = 69/125 (55%), Gaps = 12/125 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVY 169
           KSPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       Y Y
Sbjct: 1   KSPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY 57

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 328
           KSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPPKK    
Sbjct: 58  KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYSSPPPPKKSPPP 117

Query: 329 -YVYK 340
            Y YK
Sbjct: 118 PYYYK 122

 Score =  122 bits (305), Expect = 2e-26
 Identities = 63/113 (55%), Positives = 64/113 (56%), Gaps = 8/113 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPPKK     Y YK
Sbjct: 66  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYSSPPPPKKSPPPPYYYK 122

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP     PP  Y SPPPP       Y YKS PPP     PP  Y SPPPP
Sbjct: 123 SPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSSPPPSPSPPPPYYYKSPPPP 175

 Score =  115 bits (287), Expect = 2e-24
 Identities = 63/117 (53%), Positives = 66/117 (56%), Gaps = 5/117 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP-----KKHYVY 169
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       +Y Y
Sbjct: 50  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY-Y 105

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
            SPPPP K   PP  Y SPPPP       SPPPP  + SPPP   SPPPP   Y YK
Sbjct: 106 SSPPPPKKSPPPPYYYKSPPPPS-----PSPPPPYYYKSPPPPSPSPPPP---YYYK 154

 Score =  105 bits (263), Expect = 1e-21
 Identities = 60/110 (54%), Positives = 62/110 (56%), Gaps = 13/110 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y Y SPPPP K   PP  Y SPPPP       Y YK
Sbjct: 82  SPPPPYYYKSPPPPSPSPPPP---YYYSSPPPPKKSPPPPYYYKSPPPPSPSPPPPYYYK 138

Query: 173 SPPPPVKHYSPPPVYH---------SPPPPKKHYVYKSPPPPVKHYSPPP 295
           SPPPP    SPPP Y+         SPPPP   Y YKSPPPP    SPPP
Sbjct: 139 SPPPPSP--SPPPPYYYKSSPPPSPSPPPP---YYYKSPPPPSP--SPPP 181

[50][TOP]
>UniRef100_Q9ZWT0 Extensin n=1 Tax=Adiantum capillus-veneris RepID=Q9ZWT0_ADICA
          Length = 207

 Score =  127 bits (318), Expect = 5e-28
 Identities = 68/115 (59%), Positives = 72/115 (62%), Gaps = 10/115 (8%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y+YKSPPPP     PP +Y SPPPP       Y+YK
Sbjct: 95  SPPPPYIYKSPPPPSPSPPPP---YIYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYIYK 151

Query: 173 SPPPPVKHYSPPPV-YHSPPPPKKH----YVYKSPPPPVKHYSPPP-VYHSPPPP 319
           SPPPP    SPPP  Y SPPPP       Y YKSPPPP  H SPPP VY SPPPP
Sbjct: 152 SPPPPPCTPSPPPYFYSSPPPPSPSPPPPYQYKSPPPP-SHPSPPPYVYKSPPPP 205

 Score =  123 bits (308), Expect = 7e-27
 Identities = 67/131 (51%), Positives = 72/131 (54%), Gaps = 18/131 (13%)
 Frame = +2

Query: 2   KSPPP-----PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-- 160
           KSPPP     P K+ SPPP   SPPPP   Y+YKSPPPP     PP +Y SPPPP     
Sbjct: 73  KSPPPSPSSPPYKYKSPPPPSPSPPPP---YIYKSPPPPSPSPPPPYIYKSPPPPSPSPP 129

Query: 161 --YVYKSPPPPVKHYSPPPVYHSPPPP-----KKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             Y+YKSPPPP     PP +Y SPPPP        Y Y SPPPP     PP  Y SPPPP
Sbjct: 130 PPYLYKSPPPPSPSPPPPYIYKSPPPPPCTPSPPPYFYSSPPPPSPSPPPPYQYKSPPPP 189

Query: 320 K----KHYVYK 340
                  YVYK
Sbjct: 190 SHPSPPPYVYK 200

 Score =  113 bits (282), Expect = 7e-24
 Identities = 57/110 (51%), Positives = 63/110 (57%), Gaps = 8/110 (7%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPP 181
           P   H SPPP   SPP     Y YKSPPPP     PP +Y SPPPP       Y+YKSPP
Sbjct: 68  PHYPHKSPPPSPSSPP-----YKYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYIYKSPP 122

Query: 182 PPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP     PP +Y SPPPP       Y+YKSPPPP    SPPP ++S PPP
Sbjct: 123 PPSPSPPPPYLYKSPPPPSPSPPPPYIYKSPPPPPCTPSPPPYFYSSPPP 172

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/109 (49%), Positives = 62/109 (56%), Gaps = 11/109 (10%)
 Frame = +2

Query: 26  HYSPPPVYHSPP--PPKKHYVYKSPPP-----PVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           H+  P  +H     P   HY +KSPPP     P K+ SPPP   SPPPP   Y+YKSPPP
Sbjct: 51  HWRHPHYHHHKQRTPWHPHYPHKSPPPSPSSPPYKYKSPPPPSPSPPPP---YIYKSPPP 107

Query: 185 PVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PP +Y SPPPP       Y+YKSPPPP     PP +Y SPPPP
Sbjct: 108 PSPSPPPPYIYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYIYKSPPPP 156

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 51/120 (42%), Positives = 59/120 (49%), Gaps = 15/120 (12%)
 Frame = +2

Query: 26  HYSPPPVYHSPP-----PPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           HY   P +H        P   H+  ++P  P   H SPPP   SPP     Y YKSPPPP
Sbjct: 38  HYHHVPYHHHHDSHWRHPHYHHHKQRTPWHPHYPHKSPPPSPSSPP-----YKYKSPPPP 92

Query: 188 VKHYSPPPVYH-SPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 340
                PPP  + SPPPP       Y+YKSPPPP     PP +Y SPPPP       Y+YK
Sbjct: 93  SPS-PPPPYIYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYIYK 151

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 36/62 (58%), Positives = 40/62 (64%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP    SPPP ++S PPP       SPPPP ++ SPPP  H  PPP   YVYKSPP
Sbjct: 151 KSPPPPPCTPSPPPYFYSSPPPPS----PSPPPPYQYKSPPPPSHPSPPP---YVYKSPP 203

Query: 182 PP 187
           PP
Sbjct: 204 PP 205

[51][TOP]
>UniRef100_B9GF15 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GF15_POPTR
          Length = 152

 Score =  126 bits (317), Expect = 7e-28
 Identities = 66/124 (53%), Positives = 70/124 (56%), Gaps = 18/124 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPP------- 148
           KSPPPP     PP +Y SPPPP       YVY SPPPP     PP +Y SPPP       
Sbjct: 19  KSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPPSPSPPPPYIYKSPPPPPPPPSP 78

Query: 149 -PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPP--VYHS 307
            P   YVYKSPPPP     PP VY+SPPPP       YVY SPPPP    SPPP  +Y S
Sbjct: 79  SPPPPYVYKSPPPPSPSPPPPYVYNSPPPPSPSPPPPYVYNSPPPPPSSPSPPPPYIYKS 138

Query: 308 PPPP 319
           PPPP
Sbjct: 139 PPPP 142

 Score =  121 bits (304), Expect = 2e-26
 Identities = 70/135 (51%), Positives = 75/135 (55%), Gaps = 22/135 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP +Y SPPPP       Y+YKSPPPP     PP VY SPPPP      
Sbjct: 3   KSPPPPSTSPPPPYIYKSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPPSPSPPP 62

Query: 161 -YVYKSPPPPVK--HYSPPP--VYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPP 313
            Y+YKSPPPP      SPPP  VY SPPPP       YVY SPPPP     PP VY+SPP
Sbjct: 63  PYIYKSPPPPPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYNSPPPPSPSPPPPYVYNSPP 122

Query: 314 PPKKH------YVYK 340
           PP         Y+YK
Sbjct: 123 PPPSSPSPPPPYIYK 137

 Score =  121 bits (304), Expect = 2e-26
 Identities = 66/120 (55%), Positives = 69/120 (57%), Gaps = 11/120 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   Y+YKSPPPP     PPP   SPPPP   YVYKSPPP
Sbjct: 43  SPPPPYVYMSPPPPSPSPPPP---YIYKSPPPP-----PPPPSPSPPPP---YVYKSPPP 91

Query: 185 PVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVY-------HSPPPPKKHY 331
           P     PP VY+SPPPP       YVY SPPPP    SPPP Y        SP PP   Y
Sbjct: 92  PSPSPPPPYVYNSPPPPSPSPPPPYVYNSPPPPPSSPSPPPPYIYKSPPPPSPSPPPPPY 151

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 52/95 (54%), Positives = 56/95 (58%), Gaps = 8/95 (8%)
 Frame = +2

Query: 80  VYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH- 244
           +YKSPPPP     PP +Y SPPPP       Y+YKSPPPP     PP VY SPPPP    
Sbjct: 1   MYKSPPPPSTSPPPPYIYKSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPPSPSP 60

Query: 245 ---YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
              Y+YKSPPPP     PPP   SPPPP   YVYK
Sbjct: 61  PPPYIYKSPPPP-----PPPPSPSPPPP---YVYK 87

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 50/93 (53%), Positives = 51/93 (54%), Gaps = 11/93 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVY 169
           KSPPPP     PPP   SPPPP   YVYKSPPPP     PP VY+SPPPP       YVY
Sbjct: 67  KSPPPP-----PPPPSPSPPPP---YVYKSPPPPSPSPPPPYVYNSPPPPSPSPPPPYVY 118

Query: 170 KSPPPPVKHYSPPPVY-------HSPPPPKKHY 247
            SPPPP    SPPP Y        SP PP   Y
Sbjct: 119 NSPPPPPSSPSPPPPYIYKSPPPPSPSPPPPPY 151

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/77 (55%), Positives = 46/77 (59%), Gaps = 6/77 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH------YV 166
           SPPPP  + SPPP   SPPPP   YVY SPPPP     PP VY+SPPPP         Y+
Sbjct: 79  SPPPPYVYKSPPPPSPSPPPP---YVYNSPPPPSPSPPPPYVYNSPPPPPSSPSPPPPYI 135

Query: 167 YKSPPPPVKHYSPPPVY 217
           YKSPPPP     PPP Y
Sbjct: 136 YKSPPPPSPSPPPPPYY 152

[52][TOP]
>UniRef100_Q9M1H0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9M1H0_ARATH
          Length = 951

 Score =  125 bits (315), Expect = 1e-27
 Identities = 68/118 (57%), Positives = 76/118 (64%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP YHSP P  +   YKSPP
Sbjct: 560 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYHSPSPKVQ---YKSPP 613

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 614 PPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 668

 Score =  125 bits (315), Expect = 1e-27
 Identities = 69/121 (57%), Positives = 74/121 (61%), Gaps = 8/121 (6%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
            KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 827  KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 883

Query: 164  VYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
            VY SPPPP  +YSP PV  Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 884  VYSSPPPP--YYSPSPVVDYKSPPPP---YVYSSPPPPYYSPSPKVEYKSPPPP---YVY 935

Query: 338  K 340
            K
Sbjct: 936  K 936

 Score =  124 bits (311), Expect = 3e-27
 Identities = 73/139 (52%), Positives = 80/139 (57%), Gaps = 27/139 (19%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
            KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V++ SPPP  VY 
Sbjct: 777  KSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYS 836

Query: 137  SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYS 286
            SPPP    P     YKSPPPP  + SPPP Y+SP P      P   YVY SPPPP  +YS
Sbjct: 837  SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP--YYS 894

Query: 287  PPPV--YHSPPPPKKHYVY 337
            P PV  Y SPPPP   YVY
Sbjct: 895  PSPVVDYKSPPPP---YVY 910

 Score =  122 bits (306), Expect = 1e-26
 Identities = 67/128 (52%), Positives = 73/128 (57%), Gaps = 16/128 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 469 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPY 525

Query: 164 VYKSPPPPVKHYSPPPVYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPP----- 316
           VY SPPPP    SP   Y SPPP    P     YKSPPPP  + SPPP Y+SP P     
Sbjct: 526 VYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 585

Query: 317 -PKKHYVY 337
            P   YVY
Sbjct: 586 SPPPPYVY 593

 Score =  120 bits (301), Expect = 5e-26
 Identities = 66/124 (53%), Positives = 71/124 (57%), Gaps = 19/124 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   Y
Sbjct: 419 KSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP---Y 475

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 476 VYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 535

Query: 305 SPPP 316
           SP P
Sbjct: 536 SPSP 539

 Score =  120 bits (301), Expect = 5e-26
 Identities = 69/133 (51%), Positives = 78/133 (58%), Gaps = 21/133 (15%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP------------- 142
            KSPPPP  + SPPP ++SP P  K Y YKSPPPP  + SPPP Y+SP             
Sbjct: 711  KSPPPPYVYSSPPPPHYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPY 767

Query: 143  --PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
              P PK H  YKSPPPP  + SPPP Y+S P PK H  YKSPPPP  + SPPP Y+SP P
Sbjct: 768  YAPTPKVH--YKSPPPPYVYSSPPPPYYS-PSPKVH--YKSPPPPYVYSSPPPPYYSPSP 822

Query: 317  ------PKKHYVY 337
                  P   YVY
Sbjct: 823  KVEYKSPPPPYVY 835

 Score =  120 bits (300), Expect = 6e-26
 Identities = 68/124 (54%), Positives = 71/124 (57%), Gaps = 18/124 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---------YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 154
           KSPPPP  + SPPP          Y SPPPP   YVY SPPPP    SP   Y SPPPP 
Sbjct: 94  KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPP- 149

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHS 307
             YVY SPPPP    SP   Y SPPPP   YVY SPPPP       V++ SPPP  VY S
Sbjct: 150 --YVYSSPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPPYVYSS 204

Query: 308 PPPP 319
           PPPP
Sbjct: 205 PPPP 208

 Score =  120 bits (300), Expect = 6e-26
 Identities = 68/124 (54%), Positives = 71/124 (57%), Gaps = 18/124 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---------YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 154
           KSPPPP  + SPPP          Y SPPPP   YVY SPPPP    SP   Y SPPPP 
Sbjct: 119 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPP- 174

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHS 307
             YVY SPPPP    SP   Y SPPPP   YVY SPPPP       V++ SPPP  VY S
Sbjct: 175 --YVYSSPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPYYSPSPKVEYKSPPPPYVYSS 229

Query: 308 PPPP 319
           PPPP
Sbjct: 230 PPPP 233

 Score =  120 bits (300), Expect = 6e-26
 Identities = 71/140 (50%), Positives = 76/140 (54%), Gaps = 28/140 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   Y
Sbjct: 294 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP---Y 350

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPP--- 295
           VY SPPPP       V++ SPPP  VY SPPP    P     YKSPPPP  + SPPP   
Sbjct: 351 VYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTY 410

Query: 296 ------VYHSPPPPKKHYVY 337
                  Y SPPPP   YVY
Sbjct: 411 SPSPKVEYKSPPPP---YVY 427

 Score =  120 bits (300), Expect = 6e-26
 Identities = 68/124 (54%), Positives = 71/124 (57%), Gaps = 18/124 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---------YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 154
           KSPPPP  + SPPP          Y SPPPP   YVY SPPPP    SP   Y SPPPP 
Sbjct: 344 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPP- 399

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHS 307
             YVY SPPPP    SP   Y SPPPP   YVY SPPPP       V++ SPPP  VY S
Sbjct: 400 --YVYSSPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPYYSPSPKVEYKSPPPPYVYSS 454

Query: 308 PPPP 319
           PPPP
Sbjct: 455 PPPP 458

 Score =  120 bits (300), Expect = 6e-26
 Identities = 72/150 (48%), Positives = 79/150 (52%), Gaps = 38/150 (25%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPPVYHSP 142
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP Y+SP
Sbjct: 494 KSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSP 553

Query: 143 PP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPP 265
            P      P   YVY SPPPP       V + SPPP  VY SPPP    P     YKSPP
Sbjct: 554 SPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPP 613

Query: 266 PPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY
Sbjct: 614 PPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 643

 Score =  119 bits (299), Expect = 8e-26
 Identities = 66/121 (54%), Positives = 70/121 (57%), Gaps = 9/121 (7%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV---------YHSPPPPK 154
           KSPPPP  + SPPP Y+SP P  +   YKSPPPP  + SPPP          Y SPPPP 
Sbjct: 244 KSPPPPYVYSSPPPPYYSPSPKVE---YKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP- 299

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
             YVY SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YV
Sbjct: 300 --YVYSSPPPPYYSPSPKVDYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPP---YV 351

Query: 335 Y 337
           Y
Sbjct: 352 Y 352

 Score =  119 bits (299), Expect = 8e-26
 Identities = 64/118 (54%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP  +SP P  +   YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 394 KSPPPPYVYSSPPPPTYSPSPKVE---YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPY 450

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 451 VYSSPPPPTYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVYYKSPPPP---YVY 502

 Score =  119 bits (299), Expect = 8e-26
 Identities = 68/121 (56%), Positives = 72/121 (59%), Gaps = 9/121 (7%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP-------PKKH 160
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P       P  H
Sbjct: 635 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPH 691

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYV 334
                PPPP    SP  VY SPPPP   YVY SPPPP  HYSP P   Y SPPPP   YV
Sbjct: 692 VCVCPPPPPCYSPSPKVVYKSPPPP---YVYSSPPPP--HYSPSPKVYYKSPPPP---YV 743

Query: 335 Y 337
           Y
Sbjct: 744 Y 744

 Score =  119 bits (298), Expect = 1e-25
 Identities = 65/121 (53%), Positives = 72/121 (59%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP  +SP P  +   YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 169 KSPPPPYVYSSPPPPTYSPSPKVE---YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPY 225

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           VY SPPPP    SP   Y SPPPP   YVY SPPPP       V++ SPPP  VY SPPP
Sbjct: 226 VYSSPPPPTYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPP 282

Query: 317 P 319
           P
Sbjct: 283 P 283

 Score =  119 bits (298), Expect = 1e-25
 Identities = 64/118 (54%), Positives = 68/118 (57%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP  +SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 269 KSPPPPYVYSSPPPPTYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 325

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 326 VYSSPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPP---YVY 377

 Score =  119 bits (297), Expect = 1e-25
 Identities = 68/124 (54%), Positives = 70/124 (56%), Gaps = 18/124 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---------YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 154
           KSPPPP  + SPPP          Y SPPPP   YVY SPPPP    SP   Y SPPPP 
Sbjct: 144 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPP- 199

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHS 307
             YVY SPPPP    SP   Y SPPPP   YVY SPPPP       V + SPPP  VY S
Sbjct: 200 --YVYSSPPPPYYSPSPKVEYKSPPPP---YVYSSPPPPTYSPSPKVDYKSPPPPYVYSS 254

Query: 308 PPPP 319
           PPPP
Sbjct: 255 PPPP 258

 Score =  117 bits (294), Expect = 3e-25
 Identities = 72/141 (51%), Positives = 77/141 (54%), Gaps = 29/141 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP YHSP P  +   YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 585 KSPPPPYVYSSPPPPYHSPSPKVQ---YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPY 641

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSP--------PPPVKH 280
           VY SPPPP       V + SPPP  VY SPPP    P     YKSP        PPP   
Sbjct: 642 VYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPC 701

Query: 281 YSPPP--VYHSPPPPKKHYVY 337
           YSP P  VY SPPPP   YVY
Sbjct: 702 YSPSPKVVYKSPPPP---YVY 719

 Score =  117 bits (292), Expect = 5e-25
 Identities = 72/143 (50%), Positives = 76/143 (53%), Gaps = 31/143 (21%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV---------YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 154
           KSPPPP  + SPPP          Y SPPPP   YVY SPPPP    SP   Y SPPPP 
Sbjct: 69  KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPP- 124

Query: 155 KHYVYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPP 295
             YVY SPPPP       V++ SPPP  VY SPPP    P     YKSPPPP  + SPPP
Sbjct: 125 --YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPP 182

Query: 296 ---------VYHSPPPPKKHYVY 337
                     Y SPPPP   YVY
Sbjct: 183 PTYSPSPKVEYKSPPPP---YVY 202

 Score =  117 bits (292), Expect = 5e-25
 Identities = 58/109 (53%), Positives = 69/109 (63%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 852  KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPVVD---YKSPP 905

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
            PP  + SPPP Y+SP P  +   YKSPPPP  + SPPP  +SP P  ++
Sbjct: 906  PPYVYSSPPPPYYSPSPKVE---YKSPPPPYVYKSPPPPSYSPSPKTEY 951

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/120 (54%), Positives = 66/120 (55%), Gaps = 8/120 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYH--------SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 157
           K+PP P    SPPP Y         SPPPP   YVY SPPPP    SP   Y SPPPP  
Sbjct: 45  KTPPLPYIDSSPPPTYSPAPEVEYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPP-- 99

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
            YVY SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 100 -YVYSSPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPP---YVY 152

 Score =  115 bits (287), Expect = 2e-24
 Identities = 70/148 (47%), Positives = 74/148 (50%), Gaps = 38/148 (25%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP-------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 160
            KSPPPP  + SPPP Y+SP P       P  H     PPPP    SP  VY SPPPP   
Sbjct: 660  KSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP--- 716

Query: 161  YVYKSPPPPVKHYSPPP-----------VYHSPPP------PKKHYV------------- 250
            YVY SPPPP  HYSP P           VY SPPP      PK HY              
Sbjct: 717  YVYSSPPPP--HYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKV 774

Query: 251  -YKSPPPPVKHYSPPPVYHSPPPPKKHY 331
             YKSPPPP  + SPPP Y+S P PK HY
Sbjct: 775  HYKSPPPPYVYSSPPPPYYS-PSPKVHY 801

 Score =  101 bits (252), Expect = 2e-20
 Identities = 59/115 (51%), Positives = 62/115 (53%), Gaps = 8/115 (6%)
 Frame = +2

Query: 17  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--------YHSPPPPKKHYVYK 172
           P    SPPP+Y SP P  +   YK+PP P    SPPP         Y SPPPP   YVY 
Sbjct: 25  PYTDSSPPPLYSSPLPKIE---YKTPPLPYIDSSPPPTYSPAPEVEYKSPPPP---YVYS 78

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 79  SPPPPTYSPSPKVEYKSPPPP---YVYSSPPPPTYSPSPKVEYKSPPPP---YVY 127

[53][TOP]
>UniRef100_UPI0001739340 ATHRGP1 (HYDROXYPROLINE-RICH GLYCOPROTEIN); structural constituent
           of cell wall n=1 Tax=Arabidopsis thaliana
           RepID=UPI0001739340
          Length = 699

 Score =  125 bits (313), Expect = 2e-27
 Identities = 68/110 (61%), Positives = 76/110 (69%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P  K Y YKSPP
Sbjct: 425 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPP 478

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           PP  + SPPP Y+S P PK H  YKSPPPP  + SPPP Y+S P PK HY
Sbjct: 479 PPYVYSSPPPPYYS-PSPKVH--YKSPPPPYVYSSPPPPYYS-PSPKVHY 524

 Score =  125 bits (313), Expect = 2e-27
 Identities = 68/118 (57%), Positives = 74/118 (62%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P K HY  KSPPPP  + SPPP Y+SP P K HY  KSPP
Sbjct: 475 KSPPPPYVYSSPPPPYYSPSP-KVHY--KSPPPPYVYSSPPPPYYSPSP-KVHY--KSPP 528

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 529 PPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP---YVY 583

 Score =  124 bits (311), Expect = 3e-27
 Identities = 68/118 (57%), Positives = 74/118 (62%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P K HY  KSPP
Sbjct: 450 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP-KVHY--KSPP 503

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 504 PPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP---YVY 558

 Score =  123 bits (308), Expect = 7e-27
 Identities = 70/129 (54%), Positives = 77/129 (59%), Gaps = 19/129 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 375 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPY 431

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 432 VYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 491

Query: 305 SPPPPKKHY 331
           S P PK HY
Sbjct: 492 S-PSPKVHY 499

 Score =  122 bits (305), Expect = 2e-26
 Identities = 63/118 (53%), Positives = 72/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  +   YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 150 KSPPPPYVYSSPPPPYYSPSPKVE---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 203

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 204 PPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 258

 Score =  121 bits (304), Expect = 2e-26
 Identities = 64/118 (54%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 225 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 278

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 279 PPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP---YVY 333

 Score =  121 bits (303), Expect = 3e-26
 Identities = 69/137 (50%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 175 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 231

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 232 VYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 291

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 292 SPSPKVDYKSPPPPYVY 308

 Score =  120 bits (300), Expect = 6e-26
 Identities = 68/118 (57%), Positives = 76/118 (64%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP  +SP P  K Y YKSPPPP  + SPPP Y+SP P  K Y YKSPP
Sbjct: 350 KSPPPPYVYSSPPPPTYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPP 403

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 404 PPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 458

 Score =  119 bits (299), Expect = 8e-26
 Identities = 64/118 (54%), Positives = 68/118 (57%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP  +SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 300 KSPPPPYVYSSPPPPTYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPY 356

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 357 VYSSPPPPTYSPSPKVYYKSPPPP---YVYSSPPPPYYSPSPKVYYKSPPPP---YVY 408

 Score =  119 bits (297), Expect = 1e-25
 Identities = 70/140 (50%), Positives = 76/140 (54%), Gaps = 28/140 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 250 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 306

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPP--- 295
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP   
Sbjct: 307 VYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTY 366

Query: 296 ------VYHSPPPPKKHYVY 337
                  Y SPPPP   YVY
Sbjct: 367 SPSPKVYYKSPPPP---YVY 383

 Score =  118 bits (295), Expect = 2e-25
 Identities = 64/121 (52%), Positives = 72/121 (59%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP  +SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 75  KSPPPPYVYSSPPPPTYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 128

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           PP  + SPPP Y+SP P      P   YVY SPPPP       V++ SPPP  VY SPPP
Sbjct: 129 PPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPP 188

Query: 317 P 319
           P
Sbjct: 189 P 189

 Score =  114 bits (285), Expect = 3e-24
 Identities = 70/153 (45%), Positives = 78/153 (50%), Gaps = 43/153 (28%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY 
Sbjct: 525 KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYS 584

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSP-PPVYHSPPP---------------PKKHYVYK 256
           SPPP    P     YKSPPPP  +YSP P VY+  PP               P    VYK
Sbjct: 585 SPPPPYYSPSPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYK 642

Query: 257 SPPPPVKHYSPPPVYHSP--------PPPKKHY 331
           SPPPP  + SPPP Y+SP        PPP  +Y
Sbjct: 643 SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYY 675

 Score =  113 bits (283), Expect = 6e-24
 Identities = 70/144 (48%), Positives = 77/144 (53%), Gaps = 38/144 (26%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPPVYHSP 142
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP Y+SP
Sbjct: 550 KSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSP 609

Query: 143 -----------------PPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 253
                            PPP   Y      VYKSPPPP  + SPPP Y+SP P  K Y Y
Sbjct: 610 SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP--KVY-Y 666

Query: 254 KSPPPPVKHYSPPP--VYHSPPPP 319
           KSPPPP  +YSP P   Y SPPPP
Sbjct: 667 KSPPPP-SYYSPSPKVEYKSPPPP 689

 Score =  107 bits (268), Expect = 3e-22
 Identities = 66/140 (47%), Positives = 73/140 (52%), Gaps = 28/140 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV---------YHSPPPPK 154
           K+PP P    SPPP Y   P  +    YKSPPPP  + SPPP          Y SPPPP 
Sbjct: 51  KTPPLPYVDSSPPPTYTPAPEVE----YKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP- 105

Query: 155 KHYVYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPP 295
             YVY SPPPP       V + SPPP  VY+SPPP    P     YKSPPPP  + SPPP
Sbjct: 106 --YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 163

Query: 296 VYHSPPP------PKKHYVY 337
            Y+SP P      P   YVY
Sbjct: 164 PYYSPSPKVEYKSPPPPYVY 183

 Score =  104 bits (260), Expect = 3e-21
 Identities = 61/132 (46%), Positives = 68/132 (51%), Gaps = 23/132 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP-------------PKKHYVYKSPP--------PPVKHYS 118
           KSPPPP  + SPPP Y+SP P             P     YKSPP        PP   YS
Sbjct: 575 KSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS 634

Query: 119 PPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 292
           P P  VY SPPPP   YVY SPPPP    SP   Y SPPPP     Y SP P V++ SPP
Sbjct: 635 PSPKVVYKSPPPP---YVYNSPPPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPP 687

Query: 293 PVYHSPPPPKKH 328
           P  +SP P  ++
Sbjct: 688 PPSYSPSPKTEY 699

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/118 (50%), Positives = 66/118 (55%), Gaps = 17/118 (14%)
 Frame = +2

Query: 17  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--------YHSPPPPKKHYVYK 172
           P  + SPPP+Y SP P  +   YK+PP P    SPPP         Y SPPPP   YVY 
Sbjct: 31  PETYASPPPLYSSPLPEVE---YKTPPLPYVDSSPPPTYTPAPEVEYKSPPPP---YVYS 84

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPPP 319
           SPPPP    SP   Y SPPPP   YVY SPPPP       V + SPPP  VY+SPPPP
Sbjct: 85  SPPPPTYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP 139

[54][TOP]
>UniRef100_Q41707 Extensin class 1 protein n=1 Tax=Vigna unguiculata
           RepID=Q41707_VIGUN
          Length = 489

 Score =  125 bits (313), Expect = 2e-27
 Identities = 67/124 (54%), Positives = 68/124 (54%), Gaps = 12/124 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   YVYKSPPPP     PP  Y SPPPP       Y YK
Sbjct: 135 SPPPPYYYKSPPPPSPSPPPP---YVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 191

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 328
           SPPPP     PP  Y SPPPP       YVYKSPPPP     PP  Y SPPPP       
Sbjct: 192 SPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 251

Query: 329 YVYK 340
           Y YK
Sbjct: 252 YYYK 255

 Score =  125 bits (313), Expect = 2e-27
 Identities = 67/124 (54%), Positives = 68/124 (54%), Gaps = 12/124 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP VY SPPPP       Y YK
Sbjct: 311 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYK 367

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 328
           SPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP       
Sbjct: 368 SPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 427

Query: 329 YVYK 340
           YVYK
Sbjct: 428 YVYK 431

 Score =  123 bits (308), Expect = 7e-27
 Identities = 66/124 (53%), Positives = 67/124 (54%), Gaps = 12/124 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       YVYK
Sbjct: 295 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYK 351

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 328
           SPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP       
Sbjct: 352 SPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 411

Query: 329 YVYK 340
           Y YK
Sbjct: 412 YYYK 415

 Score =  122 bits (307), Expect = 9e-27
 Identities = 67/129 (51%), Positives = 67/129 (51%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP VY SPPPP       Y YKSPPPP     PP  Y SPPPP      
Sbjct: 335 KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 394

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            Y YKSPPPP     PP  Y SPPPP       YVYKSPPPP     PP  Y SPPPP  
Sbjct: 395 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSP 454

Query: 326 H----YVYK 340
                Y YK
Sbjct: 455 SPPPPYYYK 463

 Score =  122 bits (306), Expect = 1e-26
 Identities = 63/115 (54%), Positives = 66/115 (57%), Gaps = 4/115 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       YVYK
Sbjct: 375 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYK 431

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           SPPPP     PP  Y SPPPP       SPPPP  + SPPP   SPPPP   Y+Y
Sbjct: 432 SPPPPSPSPPPPYYYKSPPPPSP-----SPPPPYYYKSPPPPSPSPPPPYYPYLY 481

 Score =  121 bits (304), Expect = 2e-26
 Identities = 69/127 (54%), Positives = 71/127 (55%), Gaps = 15/127 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHY--SPPPVYHSPPPPKKHY 163
           SPPPP  + SPPP   SPPPP   Y YKSPPPP       +Y  SPPP   SPPPP   Y
Sbjct: 103 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP---Y 156

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH- 328
           VYKSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP    
Sbjct: 157 VYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSP 216

Query: 329 ---YVYK 340
              YVYK
Sbjct: 217 PPPYVYK 223

 Score =  121 bits (303), Expect = 3e-26
 Identities = 65/124 (52%), Positives = 66/124 (53%), Gaps = 12/124 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       Y YK
Sbjct: 215 SPPPPYVYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 271

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH---- 328
           SPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP       
Sbjct: 272 SPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 331

Query: 329 YVYK 340
           Y YK
Sbjct: 332 YYYK 335

 Score =  120 bits (302), Expect = 4e-26
 Identities = 66/129 (51%), Positives = 66/129 (51%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP      
Sbjct: 159 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 218

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            YVYKSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP  
Sbjct: 219 PYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSP 278

Query: 326 H----YVYK 340
                Y YK
Sbjct: 279 SPPPPYYYK 287

 Score =  120 bits (302), Expect = 4e-26
 Identities = 66/129 (51%), Positives = 66/129 (51%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP      
Sbjct: 271 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 330

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            Y YKSPPPP     PP VY SPPPP       Y YKSPPPP     PP  Y SPPPP  
Sbjct: 331 PYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSP 390

Query: 326 H----YVYK 340
                Y YK
Sbjct: 391 SPPPPYYYK 399

 Score =  119 bits (298), Expect = 1e-25
 Identities = 66/125 (52%), Positives = 68/125 (54%), Gaps = 13/125 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP-----KKHYVY 169
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP VY SPPPP       +Y Y
Sbjct: 183 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYY-Y 238

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 328
           KSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP      
Sbjct: 239 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 298

Query: 329 -YVYK 340
            Y YK
Sbjct: 299 PYYYK 303

 Score =  119 bits (298), Expect = 1e-25
 Identities = 66/125 (52%), Positives = 68/125 (54%), Gaps = 13/125 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP-----KKHYVY 169
           SPPPP  + SPPP   SPPPP   YVYKSPPPP     PP  Y SPPPP       +Y Y
Sbjct: 199 SPPPPYYYKSPPPPSPSPPPP---YVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY-Y 254

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 328
           KSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP      
Sbjct: 255 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 314

Query: 329 -YVYK 340
            Y YK
Sbjct: 315 PYYYK 319

 Score =  119 bits (298), Expect = 1e-25
 Identities = 66/125 (52%), Positives = 68/125 (54%), Gaps = 13/125 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP-----KKHYVY 169
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       +Y Y
Sbjct: 263 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY-Y 318

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 328
           KSPPPP     PP  Y SPPPP       YVYKSPPPP     PP  Y SPPPP      
Sbjct: 319 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 378

Query: 329 -YVYK 340
            Y YK
Sbjct: 379 PYYYK 383

 Score =  119 bits (297), Expect = 1e-25
 Identities = 63/114 (55%), Positives = 65/114 (57%), Gaps = 9/114 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP-----KKHYVY 169
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       +Y Y
Sbjct: 359 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY-Y 414

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
           KSPPPP     PP VY SPPPP       Y YKSPPPP     PP  Y SPPPP
Sbjct: 415 KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 468

 Score =  117 bits (294), Expect = 3e-25
 Identities = 63/110 (57%), Positives = 67/110 (60%), Gaps = 5/110 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP VY SPPPP       SPPP
Sbjct: 391 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYVYKSPPPPSP-----SPPP 442

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-----VYHSPPPP 319
           P  + SPPP   SPPPP   Y YKSPPPP    SPPP     +Y+SPPPP
Sbjct: 443 PYYYKSPPPPSPSPPPP---YYYKSPPPPSP--SPPPPYYPYLYNSPPPP 487

 Score =  115 bits (289), Expect = 1e-24
 Identities = 64/126 (50%), Positives = 65/126 (51%), Gaps = 17/126 (13%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPK-----KHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YV 166
           PP  + SPPP   SPPPP        Y YKSPPPP     PP VY SPPPP       Y 
Sbjct: 50  PPYYYKSPPPPSPSPPPPPYVHKYPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYY 109

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH-- 328
           YKSPPPP     PP  Y SPPPP       Y YKSPPPP     PP VY SPPPP     
Sbjct: 110 YKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPP 169

Query: 329 --YVYK 340
             Y YK
Sbjct: 170 PPYYYK 175

 Score =  114 bits (286), Expect = 3e-24
 Identities = 66/130 (50%), Positives = 67/130 (51%), Gaps = 17/130 (13%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYH-SPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH-- 160
           KSPPPP     PPP  + SPPPP       Y YKSPPPP     PP  Y SPPPP     
Sbjct: 79  KSPPPPSPS-PPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP 137

Query: 161 --YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPK 322
             Y YKSPPPP     PP VY SPPPP       Y YKSPPPP     PP  Y SPPPP 
Sbjct: 138 PPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 197

Query: 323 KH----YVYK 340
                 Y YK
Sbjct: 198 PSPPPPYYYK 207

 Score =  104 bits (260), Expect = 3e-21
 Identities = 59/121 (48%), Positives = 61/121 (50%), Gaps = 20/121 (16%)
 Frame = +2

Query: 38  PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--------SPPPPKKH----YVYKSPP 181
           PP Y++ PP    Y YKSPPPP     PPP  H        SPPPP       YVYKSPP
Sbjct: 43  PPYYYNAPP----YYYKSPPPPSPSPPPPPYVHKYPPYYYKSPPPPSPSPPPPYVYKSPP 98

Query: 182 PPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVY 337
           PP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP       YVY
Sbjct: 99  PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVY 158

Query: 338 K 340
           K
Sbjct: 159 K 159

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 47/106 (44%), Positives = 49/106 (46%), Gaps = 20/106 (18%)
 Frame = +2

Query: 83  YKSPPPPVKHYSPPPVYHSPPPPKKH------------YVYKSPPPPVKHYSPPPVYHSP 226
           Y    PP  + +PP  Y SPPPP               Y YKSPPPP     PP VY SP
Sbjct: 38  YPKQTPPYYYNAPPYYYKSPPPPSPSPPPPPYVHKYPPYYYKSPPPPSPSPPPPYVYKSP 97

Query: 227 PPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 340
           PPP       Y YKSPPPP     PP  Y SPPPP       Y YK
Sbjct: 98  PPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 143

[55][TOP]
>UniRef100_Q9M1G9 Extensin-2 n=1 Tax=Arabidopsis thaliana RepID=EXTN2_ARATH
          Length = 743

 Score =  125 bits (313), Expect = 2e-27
 Identities = 68/110 (61%), Positives = 76/110 (69%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P  K Y YKSPP
Sbjct: 469 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPP 522

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           PP  + SPPP Y+S P PK H  YKSPPPP  + SPPP Y+S P PK HY
Sbjct: 523 PPYVYSSPPPPYYS-PSPKVH--YKSPPPPYVYSSPPPPYYS-PSPKVHY 568

 Score =  125 bits (313), Expect = 2e-27
 Identities = 68/118 (57%), Positives = 74/118 (62%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P K HY  KSPPPP  + SPPP Y+SP P K HY  KSPP
Sbjct: 519 KSPPPPYVYSSPPPPYYSPSP-KVHY--KSPPPPYVYSSPPPPYYSPSP-KVHY--KSPP 572

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 573 PPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP---YVY 627

 Score =  124 bits (311), Expect = 3e-27
 Identities = 68/118 (57%), Positives = 74/118 (62%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P K HY  KSPP
Sbjct: 494 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP-KVHY--KSPP 547

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 548 PPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP---YVY 602

 Score =  123 bits (308), Expect = 7e-27
 Identities = 70/129 (54%), Positives = 77/129 (59%), Gaps = 19/129 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 419 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPY 475

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 476 VYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 535

Query: 305 SPPPPKKHY 331
           S P PK HY
Sbjct: 536 S-PSPKVHY 543

 Score =  122 bits (307), Expect = 9e-27
 Identities = 63/118 (53%), Positives = 73/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  +   YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 144 KSPPPPYVYSSPPPPYYSPSPKVE---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 197

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P  +   YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 198 PPYVYSSPPPPYYSPSPKVE---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 252

 Score =  122 bits (305), Expect = 2e-26
 Identities = 66/121 (54%), Positives = 72/121 (59%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 294 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 350

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           VY SPPPP    SP   Y SPPPP   YVY SPPPP       V++ SPPP  VY SPPP
Sbjct: 351 VYSSPPPPTYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPP 407

Query: 317 P 319
           P
Sbjct: 408 P 408

 Score =  121 bits (304), Expect = 2e-26
 Identities = 70/137 (51%), Positives = 75/137 (54%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   Y
Sbjct: 169 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP---Y 225

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 226 VYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 285

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 286 SPSPKVDYKSPPPPYVY 302

 Score =  121 bits (303), Expect = 3e-26
 Identities = 63/118 (53%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 219 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 272

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 273 PPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 327

 Score =  120 bits (302), Expect = 4e-26
 Identities = 65/121 (53%), Positives = 72/121 (59%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 269 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 322

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           PP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY SPPP
Sbjct: 323 PPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPP 382

Query: 317 P 319
           P
Sbjct: 383 P 383

 Score =  120 bits (302), Expect = 4e-26
 Identities = 66/121 (54%), Positives = 70/121 (57%), Gaps = 9/121 (7%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP---------VYHSPPPPK 154
           KSPPPP  + SPPP Y+SP P  +   YKSPPPP  + SPPP          Y SPPPP 
Sbjct: 369 KSPPPPYVYSSPPPPYYSPSPKVE---YKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPP- 424

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
             YVY SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YV
Sbjct: 425 --YVYSSPPPPYYSPSPKVYYKSPPPP---YVYSSPPPPYYSPSPKVYYKSPPPP---YV 476

Query: 335 Y 337
           Y
Sbjct: 477 Y 477

 Score =  120 bits (300), Expect = 6e-26
 Identities = 68/118 (57%), Positives = 76/118 (64%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP  +SP P  K Y YKSPPPP  + SPPP Y+SP P  K Y YKSPP
Sbjct: 394 KSPPPPYVYSSPPPPTYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPP 447

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 448 PPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 502

 Score =  118 bits (295), Expect = 2e-25
 Identities = 64/121 (52%), Positives = 72/121 (59%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP  +SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 69  KSPPPPYVYSSPPPPTYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 122

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           PP  + SPPP Y+SP P      P   YVY SPPPP       V++ SPPP  VY SPPP
Sbjct: 123 PPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPP 182

Query: 317 P 319
           P
Sbjct: 183 P 183

 Score =  118 bits (295), Expect = 2e-25
 Identities = 70/140 (50%), Positives = 76/140 (54%), Gaps = 28/140 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 244 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 300

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPV-- 298
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP   
Sbjct: 301 VYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTY 360

Query: 299 -------YHSPPPPKKHYVY 337
                  Y SPPPP   YVY
Sbjct: 361 SPSPKVDYKSPPPP---YVY 377

 Score =  114 bits (285), Expect = 3e-24
 Identities = 70/153 (45%), Positives = 78/153 (50%), Gaps = 43/153 (28%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
            KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY 
Sbjct: 569  KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYS 628

Query: 137  SPPP----PKKHYVYKSPPPPVKHYSP-PPVYHSPPP---------------PKKHYVYK 256
            SPPP    P     YKSPPPP  +YSP P VY+  PP               P    VYK
Sbjct: 629  SPPPPYYSPSPKVYYKSPPPP--YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYK 686

Query: 257  SPPPPVKHYSPPPVYHSP--------PPPKKHY 331
            SPPPP  + SPPP Y+SP        PPP  +Y
Sbjct: 687  SPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYY 719

 Score =  113 bits (283), Expect = 6e-24
 Identities = 70/144 (48%), Positives = 77/144 (53%), Gaps = 38/144 (26%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPPVYHSP 142
            KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP Y+SP
Sbjct: 594  KSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSP 653

Query: 143  -----------------PPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 253
                             PPP   Y      VYKSPPPP  + SPPP Y+SP P  K Y Y
Sbjct: 654  SPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSP--KVY-Y 710

Query: 254  KSPPPPVKHYSPPP--VYHSPPPP 319
            KSPPPP  +YSP P   Y SPPPP
Sbjct: 711  KSPPPP-SYYSPSPKVEYKSPPPP 733

 Score =  107 bits (268), Expect = 3e-22
 Identities = 66/140 (47%), Positives = 73/140 (52%), Gaps = 28/140 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV---------YHSPPPPK 154
           K+PP P    SPPP Y   P  +    YKSPPPP  + SPPP          Y SPPPP 
Sbjct: 45  KTPPLPYVDSSPPPTYTPAPEVE----YKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP- 99

Query: 155 KHYVYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPP 295
             YVY SPPPP       V + SPPP  VY+SPPP    P     YKSPPPP  + SPPP
Sbjct: 100 --YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 157

Query: 296 VYHSPPP------PKKHYVY 337
            Y+SP P      P   YVY
Sbjct: 158 PYYSPSPKVEYKSPPPPYVY 177

 Score =  104 bits (260), Expect = 3e-21
 Identities = 61/132 (46%), Positives = 68/132 (51%), Gaps = 23/132 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP-------------PKKHYVYKSPP--------PPVKHYS 118
           KSPPPP  + SPPP Y+SP P             P     YKSPP        PP   YS
Sbjct: 619 KSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYS 678

Query: 119 PPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 292
           P P  VY SPPPP   YVY SPPPP    SP   Y SPPPP     Y SP P V++ SPP
Sbjct: 679 PSPKVVYKSPPPP---YVYNSPPPPYYSPSPKVYYKSPPPPS----YYSPSPKVEYKSPP 731

Query: 293 PVYHSPPPPKKH 328
           P  +SP P  ++
Sbjct: 732 PPSYSPSPKTEY 743

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/118 (50%), Positives = 66/118 (55%), Gaps = 17/118 (14%)
 Frame = +2

Query: 17  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--------YHSPPPPKKHYVYK 172
           P  + SPPP+Y SP P  +   YK+PP P    SPPP         Y SPPPP   YVY 
Sbjct: 25  PETYASPPPLYSSPLPEVE---YKTPPLPYVDSSPPPTYTPAPEVEYKSPPPP---YVYS 78

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPPP 319
           SPPPP    SP   Y SPPPP   YVY SPPPP       V + SPPP  VY+SPPPP
Sbjct: 79  SPPPPTYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP 133

[56][TOP]
>UniRef100_Q9SK35 Putative uncharacterized protein At2g24980 n=1 Tax=Arabidopsis
           thaliana RepID=Q9SK35_ARATH
          Length = 559

 Score =  124 bits (312), Expect = 2e-27
 Identities = 72/138 (52%), Positives = 79/138 (57%), Gaps = 25/138 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 421 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSY 477

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPPP----KKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPPP         YKSPPPP  + SPPP Y+
Sbjct: 478 VYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 537

Query: 305 SPPP------PKKHYVYK 340
           SP P      P   YVYK
Sbjct: 538 SPSPKVTYKSPPPPYVYK 555

 Score =  123 bits (309), Expect = 6e-27
 Identities = 69/118 (58%), Positives = 77/118 (65%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P  K Y YKSPP
Sbjct: 171 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPP 224

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 225 PPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 279

 Score =  123 bits (309), Expect = 6e-27
 Identities = 69/118 (58%), Positives = 77/118 (65%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P  K Y YKSPP
Sbjct: 246 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPP 299

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 300 PPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 354

 Score =  123 bits (309), Expect = 6e-27
 Identities = 69/118 (58%), Positives = 77/118 (65%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P  K Y YKSPP
Sbjct: 321 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPP 374

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 375 PPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVY 429

 Score =  122 bits (307), Expect = 9e-27
 Identities = 71/137 (51%), Positives = 78/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 346 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPY 402

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 403 VYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 462

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 463 SPSPKVYYKSPPPSYVY 479

 Score =  122 bits (307), Expect = 9e-27
 Identities = 69/119 (57%), Positives = 77/119 (64%), Gaps = 7/119 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P  K Y YKSPP
Sbjct: 396 KSPPPPYVYNSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSP--KVY-YKSPP 449

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSP-PPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY SPPPP  +YSP P VY+  PPP   YVY
Sbjct: 450 PPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPP--YYSPSPKVYYKSPPPS--YVY 504

 Score =  122 bits (306), Expect = 1e-26
 Identities = 71/137 (51%), Positives = 78/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 196 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPY 252

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 253 VYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 312

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 313 SPSPKVYYKSPPPPYVY 329

 Score =  122 bits (306), Expect = 1e-26
 Identities = 71/137 (51%), Positives = 78/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 271 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPY 327

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 328 VYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 387

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 388 SPSPKVYYKSPPPPYVY 404

 Score =  122 bits (305), Expect = 2e-26
 Identities = 64/118 (54%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 96  KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 149

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 150 PPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP---YVY 204

 Score =  121 bits (304), Expect = 2e-26
 Identities = 69/137 (50%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 121 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPY 177

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 178 VYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 237

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 238 SPSPKVYYKSPPPPYVY 254

 Score =  114 bits (284), Expect = 4e-24
 Identities = 68/133 (51%), Positives = 76/133 (57%), Gaps = 21/133 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 148
           KS PPP ++Y+P P   Y SPPPP   YVY SPPPP       V + SPPP  VY SPPP
Sbjct: 54  KSSPPP-QYYTPSPKVNYKSPPPP---YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 109

Query: 149 ----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
               P     YKSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P
Sbjct: 110 PYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYNSPPPPYYSPSP 166

Query: 317 ------PKKHYVY 337
                 P   YVY
Sbjct: 167 KVDYKSPPPPYVY 179

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/118 (51%), Positives = 69/118 (58%), Gaps = 15/118 (12%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           P P    SPPP Y+  P PK +  YKSPPPP  + SPPP Y+SP P      YKSPPPP 
Sbjct: 49  PKPYVKSSPPPQYY-TPSPKVN--YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPY 102

Query: 191 KHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPPP 319
            + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY+SPPPP
Sbjct: 103 VYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP 160

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/115 (50%), Positives = 65/115 (56%), Gaps = 19/115 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY 
Sbjct: 446 KSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYS 505

Query: 137 SPPPP----KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 289
           SPPPP         YKSPPPP  + SPPP Y+SP P      YKSPPPP  + +P
Sbjct: 506 SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP---KVTYKSPPPPYVYKTP 557

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/111 (50%), Positives = 57/111 (51%), Gaps = 3/111 (2%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPP---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           P    Y+ P   H  P   P  K YV  SPPP     SP   Y SPPPP   YVY SPPP
Sbjct: 28  PQTPSYNSPSYEHKGPKYAPHPKPYVKSSPPPQYYTPSPKVNYKSPPPP---YVYSSPPP 84

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           P    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 85  PYYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVDYKSPPPP---YVY 129

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 44/90 (48%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYHSPP---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 247
           Y Y SP  P   Y+ P   H  P   P  K YV  SPPP     SP   Y SPPPP   Y
Sbjct: 23  YPYSSPQTP--SYNSPSYEHKGPKYAPHPKPYVKSSPPPQYYTPSPKVNYKSPPPP---Y 77

Query: 248 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP   Y SPPPP   YVY
Sbjct: 78  VYSSPPPPYYSPSPKVDYKSPPPP---YVY 104

[57][TOP]
>UniRef100_Q41120 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q41120_PHAVU
          Length = 154

 Score =  124 bits (312), Expect = 2e-27
 Identities = 64/119 (53%), Positives = 69/119 (57%), Gaps = 8/119 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK----KHYVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  YHSPPPP       Y YK
Sbjct: 32  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYHSPPPPSPTPHPPYYYK 88

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           SPPPP  +  PP  Y SPPPP       Y YKSPPPP    +P  +Y SPPPP   Y+Y
Sbjct: 89  SPPPPTSYPPPPYHYVSPPPPSPSPPPPYYYKSPPPPSPAPAPKYIYKSPPPPA--YIY 145

 Score =  118 bits (295), Expect = 2e-25
 Identities = 63/121 (52%), Positives = 65/121 (53%), Gaps = 12/121 (9%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPP 181
           PP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       Y YKSPP
Sbjct: 3   PPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 59

Query: 182 PPVKHYSPPPVYHSPPPPK----KHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVY 337
           PP     PP  YHSPPPP       Y YKSPPPP  +  PP  Y SPPPP       Y Y
Sbjct: 60  PPSPSPPPPYYYHSPPPPSPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPPPYYY 119

Query: 338 K 340
           K
Sbjct: 120 K 120

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/125 (50%), Positives = 67/125 (53%), Gaps = 13/125 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK-----KHYVY 169
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       +Y Y
Sbjct: 16  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY-Y 71

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPK----K 325
            SPPPP     PP  Y SPPPP  +    Y Y SPPPP     PP  Y SPPPP      
Sbjct: 72  HSPPPPSPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPPPYYYKSPPPPSPAPAP 131

Query: 326 HYVYK 340
            Y+YK
Sbjct: 132 KYIYK 136

 Score =  107 bits (268), Expect = 3e-22
 Identities = 53/99 (53%), Positives = 58/99 (58%), Gaps = 8/99 (8%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP  YHSPPPP       Y YKSPPPP  +  PP  Y SPPPP      
Sbjct: 56  KSPPPPSPSPPPPYYYHSPPPPSPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPP 115

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
            Y YKSPPPP    +P  +Y SPPPP   Y+Y SPPPP+
Sbjct: 116 PYYYKSPPPPSPAPAPKYIYKSPPPPA--YIYSSPPPPI 152

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 48/84 (57%), Positives = 49/84 (58%)
 Frame = +2

Query: 68  KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 247
           K  Y YKSPPPP     PP  Y SPPPP       SPPPP  + SPPP   SPPPP   Y
Sbjct: 2   KPPYYYKSPPPPSPSPPPPYYYKSPPPPS-----PSPPPPYYYKSPPPPSPSPPPP---Y 53

Query: 248 VYKSPPPPVKHYSPPPVYHSPPPP 319
            YKSPPPP     PP  YHSPPPP
Sbjct: 54  YYKSPPPPSPSPPPPYYYHSPPPP 77

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = +2

Query: 152 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPPPKK 325
           K  Y YKSPPPP     PP  Y SPPPP       SP PP  +Y  SPPP   SPPPP  
Sbjct: 2   KPPYYYKSPPPPSPSPPPPYYYKSPPPP-------SPSPPPPYYYKSPPPPSPSPPPP-- 52

Query: 326 HYVYK 340
            Y YK
Sbjct: 53  -YYYK 56

[58][TOP]
>UniRef100_Q94ES4 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES4_PEA
          Length = 120

 Score =  124 bits (310), Expect = 4e-27
 Identities = 71/118 (60%), Positives = 71/118 (60%), Gaps = 11/118 (9%)
 Frame = +2

Query: 8   PPPPVKHYSPP-PVYHSPPPP-KKHYVYKSPPPPVKHY--SPPPVYHSPPPP----KKHY 163
           PPPPV  Y  P PVYHSPPPP KK Y Y SPPPP  H    P PVYHSPPPP    KK Y
Sbjct: 13  PPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPY 72

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKKH 328
            Y SPPPP  H  PP   H P P     VY SPPPPV  YSPPP    Y SPPPP  H
Sbjct: 73  KYPSPPPPPAHTYPP---HVPTP-----VYHSPPPPV--YSPPPPAYYYKSPPPPYHH 120

 Score =  119 bits (299), Expect = 8e-26
 Identities = 66/118 (55%), Positives = 68/118 (57%), Gaps = 22/118 (18%)
 Frame = +2

Query: 17  PVKHYSPP-----------PVYHSPPPP-KKHYVYKSPPPPVKHY--SPPPVYHSPPPP- 151
           P K+ SPP           PVYHSPPPP KK Y Y SPPPP  H    P PVYHSPPPP 
Sbjct: 6   PYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPP 65

Query: 152 ---KKHYVYKSPPPPVKHYSPP----PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
              KK Y Y SPPPP  H  PP    PVYHSPPPP    VY  PPP   + SPPP YH
Sbjct: 66  TPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP----VYSPPPPAYYYKSPPPPYH 119

 Score =  115 bits (287), Expect = 2e-24
 Identities = 63/99 (63%), Positives = 63/99 (63%), Gaps = 13/99 (13%)
 Frame = +2

Query: 62  PPKKHYVYKSPPPP-VKHY-SPPPVYHSPPPP-KKHYVYKSPPPPVKHY--SPPPVYHSP 226
           P KK Y Y SPPPP V  Y  P PVYHSPPPP KK Y Y SPPPP  H    P PVYHSP
Sbjct: 2   PHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSP 61

Query: 227 PPP----KKHYVYKSPPPPVKHYSPP----PVYHSPPPP 319
           PPP    KK Y Y SPPPP  H  PP    PVYHSPPPP
Sbjct: 62  PPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP 100

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/82 (58%), Positives = 49/82 (59%), Gaps = 10/82 (12%)
 Frame = +2

Query: 5   SPPPPVKHY--SPPPVYHSPPPP----KKHYVYKSPPPPVKHYSPP----PVYHSPPPPK 154
           SPPPP  H    P PVYHSPPPP    KK Y Y SPPPP  H  PP    PVYHSPPPP 
Sbjct: 42  SPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP- 100

Query: 155 KHYVYKSPPPPVKHYSPPPVYH 220
              VY  PPP   + SPPP YH
Sbjct: 101 ---VYSPPPPAYYYKSPPPPYH 119

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/80 (51%), Positives = 42/80 (52%), Gaps = 16/80 (20%)
 Frame = +2

Query: 146 PPKKHYVYKSPPPPVKHYSPPPVYH---------SPPPP-KKHYVYKSPPPPVKHY--SP 289
           P KK Y Y SPPPP       PV+          SPPPP KK Y Y SPPPP  H    P
Sbjct: 2   PHKKPYKYPSPPPP-------PVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHP 54

Query: 290 PPVYHSPPPP----KKHYVY 337
            PVYHSPPPP    KK Y Y
Sbjct: 55  HPVYHSPPPPPTPHKKPYKY 74

[59][TOP]
>UniRef100_Q41983 Extensin precusor (Fragment) n=1 Tax=Arabidopsis thaliana
           RepID=Q41983_ARATH
          Length = 99

 Score =  123 bits (309), Expect = 6e-27
 Identities = 63/107 (58%), Positives = 68/107 (63%)
 Frame = +2

Query: 20  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 199
           V + +P  VY SP PP   YVYKSPPPP    +P  VY SPPPP   YVYKSPPPP    
Sbjct: 4   VSNLAPTYVYKSPXPPTPTYVYKSPPPP----TPTYVYKSPPPPTPTYVYKSPPPP---- 55

Query: 200 SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           +P  VY SPPPP   YVYKSPPPP    +P  VY SPPPP   YVYK
Sbjct: 56  TPTYVYKSPPPPTPKYVYKSPPPP----TPTYVYKSPPPPTPKYVYK 98

 Score =  112 bits (281), Expect = 1e-23
 Identities = 57/94 (60%), Positives = 58/94 (61%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSP PP   Y    VY SPPPP   YVYKSPPPP    +P  VY SPPPP   YVYKSPP
Sbjct: 14  KSPXPPTPTY----VYKSPPPPTPTYVYKSPPPP----TPTYVYKSPPPPTPTYVYKSPP 65

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
           PP   Y    VY SPPPP   YVYKSPPPP   Y
Sbjct: 66  PPTPKY----VYKSPPPPTPTYVYKSPPPPTPKY 95

[60][TOP]
>UniRef100_Q9FG06 Genomic DNA, chromosome 5, BAC clone:F15M7 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FG06_ARATH
          Length = 689

 Score =  123 bits (308), Expect = 7e-27
 Identities = 69/137 (50%), Positives = 78/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V++ SPPP  VY+
Sbjct: 126 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYN 185

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           SPPP    P     YKSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+
Sbjct: 186 SPPPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYNSPPPPYY 242

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 243 SPSPKVDYKSPPPPYVY 259

 Score =  123 bits (308), Expect = 7e-27
 Identities = 71/137 (51%), Positives = 78/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 301 KSPPPPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 357

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 358 VYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYY 417

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 418 SPSPKVAYKSPPPPYVY 434

 Score =  122 bits (307), Expect = 9e-27
 Identities = 67/121 (55%), Positives = 71/121 (58%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   Y
Sbjct: 376 KSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPP---Y 432

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           VY SPPPP    SP   Y SPPPP   YVY SPPPP       V++ SPPP  VY SPPP
Sbjct: 433 VYSSPPPPYYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPP 489

Query: 317 P 319
           P
Sbjct: 490 P 490

 Score =  122 bits (306), Expect = 1e-26
 Identities = 69/137 (50%), Positives = 78/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 101 KSPPPPNVYNSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 157

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V++ SPPP  VY+SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 158 VYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPPPPYY 217

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 218 SPSPKVDYKSPPPPYVY 234

 Score =  122 bits (306), Expect = 1e-26
 Identities = 69/137 (50%), Positives = 77/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY 
Sbjct: 201 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYS 260

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           SPPP    P     YKSPPPP  + SPPP Y+SP P  +   YKSPPPP  + SPPP Y+
Sbjct: 261 SPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVE---YKSPPPPYVYSSPPPPYY 317

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 318 SPSPKVYYKSPPPPYVY 334

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/118 (55%), Positives = 74/118 (62%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y SP P  +   YKSPPPP  + SPPP Y+SP P  +   YKSPP
Sbjct: 251 KSPPPPYVYSSPPPPYFSPSPKVE---YKSPPPPYVYNSPPPPYYSPSPKVE---YKSPP 304

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P  K Y YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 305 PPYVYSSPPPPYYSPSP--KVY-YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 359

 Score =  122 bits (305), Expect = 2e-26
 Identities = 66/121 (54%), Positives = 71/121 (58%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 351 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPY 407

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           VY SPPPP    SP   Y SPPPP   YVY SPPPP       V + SPPP  VY SPPP
Sbjct: 408 VYSSPPPPYYSPSPKVAYKSPPPP---YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 464

Query: 317 P 319
           P
Sbjct: 465 P 465

 Score =  122 bits (305), Expect = 2e-26
 Identities = 63/118 (53%), Positives = 72/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  +   YKSPPPP  + SPPP Y+SP P  +   YKSPP
Sbjct: 451 KSPPPPYVYSSPPPPYYSPSPKVE---YKSPPPPYVYSSPPPPYYSPSPKVE---YKSPP 504

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP YHSP P      YKSPPPP  + S PP Y+SP P      P   YVY
Sbjct: 505 PPYVYSSPPPPYHSPSPKVN---YKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPPYVY 559

 Score =  121 bits (304), Expect = 2e-26
 Identities = 63/118 (53%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P  +   YKSPPPP  + SPPP YHSP P      YKSPP
Sbjct: 476 KSPPPPYVYSSPPPPYYSPSPKVE---YKSPPPPYVYSSPPPPYHSPSPKVN---YKSPP 529

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + S PP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 530 PPYVYSSHPPPYYSPSPKVN---YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVY 584

 Score =  120 bits (302), Expect = 4e-26
 Identities = 65/121 (53%), Positives = 72/121 (59%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 326 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 379

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           PP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY SPPP
Sbjct: 380 PPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPPP 439

Query: 317 P 319
           P
Sbjct: 440 P 440

 Score =  116 bits (291), Expect = 7e-25
 Identities = 65/141 (46%), Positives = 72/141 (51%), Gaps = 28/141 (19%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP----------- 148
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P           
Sbjct: 551 KSPPPPYVYSSPPPPYYSPSPKVN---YKSPPPPYVYSSPPPPYYSPSPMVDYKSTPPPY 607

Query: 149 -----------PKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVK 277
                      P     YKSPP P  + SPPP+Y+SP P      P   YVY SPPPP  
Sbjct: 608 VYSFPPLPYYSPSPKVDYKSPPLPYVYSSPPPLYYSPSPKVHYKSPPPPYVYNSPPPPYY 667

Query: 278 HYSPPPVYHSPPPPKKHYVYK 340
             SP   Y SPPPP   YVYK
Sbjct: 668 SPSPKVTYKSPPPP---YVYK 685

 Score =  110 bits (276), Expect = 4e-23
 Identities = 66/137 (48%), Positives = 72/137 (52%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP YHSP P      YKSPPPP  + S PP Y+SP P      P   Y
Sbjct: 501 KSPPPPYVYSSPPPPYHSPSPKVN---YKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPPY 557

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKS PPP  +  PP  Y+
Sbjct: 558 VYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPPLPYY 617

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 618 SPSPKVDYKSPPLPYVY 634

 Score =  110 bits (274), Expect = 6e-23
 Identities = 60/118 (50%), Positives = 70/118 (59%), Gaps = 15/118 (12%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           P P  + SPPP  +  P PK +Y  KSPPPP  + SPPP Y+SP P      YKSPPPP 
Sbjct: 78  PKPYVYISPPPPSYYSPSPKVNY--KSPPPPNVYNSPPPPYYSPSPKVD---YKSPPPPY 132

Query: 191 KHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPPP 319
            + SPPP Y+SP P      P   YVY SPPPP       V++ SPPP  VY+SPPPP
Sbjct: 133 VYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPP 190

 Score =  102 bits (253), Expect = 2e-20
 Identities = 60/113 (53%), Positives = 62/113 (54%), Gaps = 5/113 (4%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPP---PPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSP 178
           P   HY+ P   H  P   P  K YVY SPPPP  +YSP P   Y SPPPP    VY SP
Sbjct: 57  PQTPHYNSPSHEHKSPKYAPHPKPYVYISPPPP-SYYSPSPKVNYKSPPPPN---VYNSP 112

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 113 PPPYYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVDYKSPPPP---YVY 159

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 54/118 (45%), Positives = 63/118 (53%), Gaps = 22/118 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP----------------------PKKHYVYKSPPPPVKHY 115
           KSPPPP  + SPPP Y+SP P                      P     YKSPP P  + 
Sbjct: 576 KSPPPPYVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPPLPYYSPSPKVDYKSPPLPYVYS 635

Query: 116 SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 289
           SPPP+Y+SP P K HY  KSPPPP  + SPPP Y+SP P      YKSPPPP  + +P
Sbjct: 636 SPPPLYYSPSP-KVHY--KSPPPPYVYNSPPPPYYSPSPK---VTYKSPPPPYVYKAP 687

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 43/98 (43%), Positives = 48/98 (48%), Gaps = 11/98 (11%)
 Frame = +2

Query: 77  YVYKSP--PPPVKHYSPPPVYHSPP---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 241
           Y Y SP   P   HY+ P   H  P   P  K YVY SPPPP  +YSP P  +       
Sbjct: 48  YPYSSPYSSPQTPHYNSPSHEHKSPKYAPHPKPYVYISPPPP-SYYSPSPKVN------- 99

Query: 242 HYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
              YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 100 ---YKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVY 134

[61][TOP]
>UniRef100_Q43687 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43687_VIGUN
          Length = 242

 Score =  123 bits (308), Expect = 7e-27
 Identities = 63/116 (54%), Positives = 65/116 (56%), Gaps = 12/116 (10%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKK----HYVYKSPPPPVKHYSPPPVYHSPPPPKKH----Y 163
           PPPP  + SPPP   SPPPP K    HY YKSPPPP     PP  Y SPPPP       Y
Sbjct: 44  PPPPYVYSSPPPPSLSPPPPYKYKDPHYEYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPY 103

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
            YKSPPPP     PP  Y SPPPP+      Y YKSPPPP     PP  Y SPPPP
Sbjct: 104 YYKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 159

 Score =  120 bits (302), Expect = 4e-26
 Identities = 65/126 (51%), Positives = 67/126 (53%), Gaps = 14/126 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP        Y Y
Sbjct: 114 SPPPPYYYKSPPPPRPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPSYYY 170

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP-----K 322
           KSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP      
Sbjct: 171 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPYEHKD 230

Query: 323 KHYVYK 340
            +Y YK
Sbjct: 231 PYYQYK 236

 Score =  119 bits (298), Expect = 1e-25
 Identities = 65/130 (50%), Positives = 66/130 (50%), Gaps = 17/130 (13%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP+     
Sbjct: 74  KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPRPSPPP 133

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPK-----KHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
            Y YKSPPPP     PP  Y SPPPP        Y YKSPPPP     PP  Y SPPPP 
Sbjct: 134 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPSYYYKSPPPPSPSPPPPYYYKSPPPPS 193

Query: 323 KH----YVYK 340
                 Y YK
Sbjct: 194 PSPPPPYYYK 203

 Score =  118 bits (295), Expect = 2e-25
 Identities = 65/125 (52%), Positives = 67/125 (53%), Gaps = 13/125 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       Y YK
Sbjct: 98  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPRPSPPPPYYYKSPPPPSPSPPPPYYYK 154

Query: 173 SPPPPVKHYSPPPVYH-SPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 328
           SPPPP     PP  Y+ SPPPP       Y YKSPPPP     PP  Y SPPPP      
Sbjct: 155 SPPPPSPSPPPPSYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 214

Query: 329 -YVYK 340
            Y YK
Sbjct: 215 PYYYK 219

 Score =  116 bits (291), Expect = 7e-25
 Identities = 64/120 (53%), Positives = 66/120 (55%), Gaps = 11/120 (9%)
 Frame = +2

Query: 5   SPPPPVK----HY---SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH- 160
           SPPPP K    HY   SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP    
Sbjct: 59  SPPPPYKYKDPHYEYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSP 115

Query: 161 ---YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
              Y YKSPPPP     PP  Y SPPPP       SPPPP  + SPPP   SPPPP  +Y
Sbjct: 116 PPPYYYKSPPPPRPSPPPPYYYKSPPPPS-----PSPPPPYYYKSPPPPSPSPPPPSYYY 170

 Score =  112 bits (280), Expect = 1e-23
 Identities = 59/105 (56%), Positives = 62/105 (59%), Gaps = 1/105 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       SPPP
Sbjct: 146 SPPPPYYYKSPPPPSPSPPPPS--YYYKSPPPPSPSPPPPYYYKSPPPPSP-----SPPP 198

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPP-VKHYSPPPVYHSPPP 316
           P  + SPPP   SPPPP   Y YKSPPPP  +H  P   Y SPPP
Sbjct: 199 PYYYKSPPPPSPSPPPP---YYYKSPPPPPYEHKDPYYQYKSPPP 240

 Score =  101 bits (252), Expect = 2e-20
 Identities = 56/105 (53%), Positives = 57/105 (54%), Gaps = 8/105 (7%)
 Frame = +2

Query: 50  HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 229
           HSPPPP   YVY SPPPP    SPPP Y    P   HY YKSPPPP     PP  Y SPP
Sbjct: 40  HSPPPPPP-YVYSSPPPP--SLSPPPPYKYKDP---HYEYKSPPPPSPSPPPPYYYKSPP 93

Query: 230 PPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 340
           PP       Y YKSPPPP     PP  Y SPPPP+      Y YK
Sbjct: 94  PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYK 138

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 36/69 (52%), Positives = 37/69 (53%), Gaps = 9/69 (13%)
 Frame = +2

Query: 161 YVYKSPPPPVKHY-SPPPVYHSPPPPKK----HYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           Y +  PPPP   Y SPPP   SPPPP K    HY YKSPPPP     PP  Y SPPPP  
Sbjct: 38  YTHSPPPPPPYVYSSPPPPSLSPPPPYKYKDPHYEYKSPPPPSPSPPPPYYYKSPPPPSP 97

Query: 326 H----YVYK 340
                Y YK
Sbjct: 98  SPPPPYYYK 106

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 31/61 (50%), Positives = 34/61 (55%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP     PP  Y SPPPP       SPPPP  + SPPP  +    P  +Y YKSPP
Sbjct: 187 KSPPPPSPSPPPPYYYKSPPPPS-----PSPPPPYYYKSPPPPPYEHKDP--YYQYKSPP 239

Query: 182 P 184
           P
Sbjct: 240 P 240

[62][TOP]
>UniRef100_Q7DLZ6 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q7DLZ6_VIGUN
          Length = 164

 Score =  122 bits (307), Expect = 9e-27
 Identities = 67/129 (51%), Positives = 67/129 (51%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP VY SPPPP       Y YKSPPPP     PP  Y SPPPP      
Sbjct: 10  KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 69

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            Y YKSPPPP     PP  Y SPPPP       YVYKSPPPP     PP  Y SPPPP  
Sbjct: 70  PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSP 129

Query: 326 H----YVYK 340
                Y YK
Sbjct: 130 SPPPPYYYK 138

 Score =  122 bits (306), Expect = 1e-26
 Identities = 63/115 (54%), Positives = 66/115 (57%), Gaps = 4/115 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       YVYK
Sbjct: 50  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYK 106

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           SPPPP     PP  Y SPPPP       SPPPP  + SPPP   SPPPP   Y+Y
Sbjct: 107 SPPPPSPSPPPPYYYKSPPPPSP-----SPPPPYYYKSPPPPSPSPPPPYYPYLY 156

 Score =  121 bits (303), Expect = 3e-26
 Identities = 67/125 (53%), Positives = 69/125 (55%), Gaps = 13/125 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP-----KKHYVY 169
           SPPPP  + SPPP   SPPPP   YVYKSPPPP     PP  Y SPPPP       +Y Y
Sbjct: 2   SPPPPYYYKSPPPPSPSPPPP---YVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY-Y 57

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 328
           KSPPPP     PP  Y SPPPP       Y YKSPPPP     PP VY SPPPP      
Sbjct: 58  KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPP 117

Query: 329 -YVYK 340
            Y YK
Sbjct: 118 PYYYK 122

 Score =  117 bits (294), Expect = 3e-25
 Identities = 63/110 (57%), Positives = 67/110 (60%), Gaps = 5/110 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP VY SPPPP       SPPP
Sbjct: 66  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYVYKSPPPPSP-----SPPP 117

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-----VYHSPPPP 319
           P  + SPPP   SPPPP   Y YKSPPPP    SPPP     +Y+SPPPP
Sbjct: 118 PYYYKSPPPPSPSPPPP---YYYKSPPPPSP--SPPPPYYPYLYNSPPPP 162

[63][TOP]
>UniRef100_O65760 Extensin (Fragment) n=1 Tax=Cicer arietinum RepID=O65760_CICAR
          Length = 192

 Score =  122 bits (307), Expect = 9e-27
 Identities = 67/118 (56%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  YHSPPPP       SPPP
Sbjct: 15  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYHSPPPPS-----PSPPP 66

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPP----PKKHYVYK 340
           P  + SPPP   SPPPP   Y YKSPPPP    SPPP YH  SPPP    P+  Y YK
Sbjct: 67  PYYYKSPPPPSPSPPPP---YYYKSPPPPSP--SPPPPYHYQSPPPPSPTPRTPYYYK 119

 Score =  122 bits (307), Expect = 9e-27
 Identities = 74/133 (55%), Positives = 77/133 (57%), Gaps = 28/133 (21%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPP----KKHYV 166
           SPPPP  + SPPP   SPPPP   Y YKSPPPP    SPPP YH  SPPPP    +  Y 
Sbjct: 63  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSP--SPPPPYHYQSPPPPSPTPRTPYY 117

Query: 167 YKSPPPPVK------HY--------SPPPVYH--SPPPPKKH----YVYKSPPPPVKHYS 286
           YKSPPPP        HY        SPPP YH  SPPPP       Y+YKSPPPPVK   
Sbjct: 118 YKSPPPPTSSPPPPYHYVSPPPPIKSPPPPYHYTSPPPPSPSPAPTYIYKSPPPPVKS-P 176

Query: 287 PPPVYH--SPPPP 319
           PPPVY   SPPPP
Sbjct: 177 PPPVYIYASPPPP 189

 Score =  122 bits (306), Expect = 1e-26
 Identities = 68/116 (58%), Positives = 70/116 (60%), Gaps = 8/116 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP     PP  YHSPPPP       SPPPP  + SPPP   SPPPP   Y YKSPP
Sbjct: 39  KSPPPPSPSPPPPYYYHSPPPPSP-----SPPPPYYYKSPPPPSPSPPPP---YYYKSPP 90

Query: 182 PPVKHYSPPPVYH--SPPPP----KKHYVYKSPPPPVKHYSPPPVYH--SPPPPKK 325
           PP    SPPP YH  SPPPP    +  Y YKSPPPP    SPPP YH  SPPPP K
Sbjct: 91  PPSP--SPPPPYHYQSPPPPSPTPRTPYYYKSPPPPTS--SPPPPYHYVSPPPPIK 142

 Score =  117 bits (292), Expect = 5e-25
 Identities = 58/103 (56%), Positives = 62/103 (60%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP  ++SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       SPPPP 
Sbjct: 1   PPPYYYHSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPS-----PSPPPPY 52

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            ++SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP
Sbjct: 53  YYHSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPP 92

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 36/67 (53%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVY 169
           SPPPP  + SPPP   SPPPP   Y Y SPPPP    +P  +Y SPPPP K      Y+Y
Sbjct: 127 SPPPPYHYVSPPPPIKSPPPP---YHYTSPPPPSPSPAPTYIYKSPPPPVKSPPPPVYIY 183

Query: 170 KSPPPPV 190
            SPPPP+
Sbjct: 184 ASPPPPI 190

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/73 (49%), Positives = 39/73 (53%)
 Frame = +2

Query: 119 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
           PP  YHSPPPP       SPPPP  + SPPP   SPPPP   Y YKSPPPP         
Sbjct: 2   PPYYYHSPPPPSP-----SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPP--------- 44

Query: 299 YHSPPPPKKHYVY 337
             SP PP  +Y +
Sbjct: 45  --SPSPPPPYYYH 55

[64][TOP]
>UniRef100_Q9LJ64 Extensin protein-like n=1 Tax=Arabidopsis thaliana
           RepID=Q9LJ64_ARATH
          Length = 956

 Score =  122 bits (306), Expect = 1e-26
 Identities = 67/121 (55%), Positives = 72/121 (59%), Gaps = 13/121 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  YSPPP  HSPPPP  H    SPPPPV  +SPPP  HSPPPP       SPPP
Sbjct: 669 SPPPPV--YSPPPPVHSPPPPPVH----SPPPPV--HSPPPPVHSPPPP-----VHSPPP 715

Query: 185 PVKHYSPPPVYHSPPPPKKH-------------YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           PV  +SPPP  HSPPPP +               +Y  PPPPV  +SPPP  HSPPPP  
Sbjct: 716 PV--HSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPV--HSPPPPVHSPPPPPV 771

Query: 326 H 328
           H
Sbjct: 772 H 772

 Score =  121 bits (303), Expect = 3e-26
 Identities = 64/105 (60%), Positives = 70/105 (66%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  +SPPP  HSPPPP       SPPPPV+   PPPV+ SPPPP    +Y  PPP
Sbjct: 705 SPPPPV--HSPPPPVHSPPPP-----VHSPPPPVQSPPPPPVF-SPPPPAP--IYSPPPP 754

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV  +SPPP  HSPPPP  H    SPPPPV  +SPPP  HSPPPP
Sbjct: 755 PV--HSPPPPVHSPPPPPVH----SPPPPV--HSPPPPVHSPPPP 791

 Score =  120 bits (301), Expect = 5e-26
 Identities = 64/105 (60%), Positives = 67/105 (63%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP   +SPPP   SPPPP       SPPPPV  YSPPP  HSPPPP  H    SPPP
Sbjct: 646 SPPPPPPVHSPPPPVFSPPPPMH-----SPPPPV--YSPPPPVHSPPPPPVH----SPPP 694

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV  +SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 695 PV--HSPPPPVHSPPPP-----VHSPPPPV--HSPPPPVHSPPPP 730

 Score =  116 bits (290), Expect = 9e-25
 Identities = 61/105 (58%), Positives = 67/105 (63%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV+   PPPV+ SPPPP    +Y  PPPPV  +SPPP  HSPPPP  H    SPPP
Sbjct: 726 SPPPPVQSPPPPPVF-SPPPPAP--IYSPPPPPV--HSPPPPVHSPPPPPVH----SPPP 776

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV  +SPPP  HSPPPP       SPPPPV    PP   +SPPPP
Sbjct: 777 PV--HSPPPPVHSPPPP-----VHSPPPPVHSPPPPSPIYSPPPP 814

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/112 (57%), Positives = 70/112 (62%), Gaps = 3/112 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPP---KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           SPPPPV  +SPPP  HSPPPP       V+  PPPPV  +SPPP  HSPPPP       S
Sbjct: 655 SPPPPV--FSPPPPMHSPPPPVYSPPPPVHSPPPPPV--HSPPPPVHSPPPP-----VHS 705

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           PPPPV  +SPPP  HSPPPP       SPPPPV+   PPPV+ SPPPP   Y
Sbjct: 706 PPPPV--HSPPPPVHSPPPP-----VHSPPPPVQSPPPPPVF-SPPPPAPIY 749

 Score =  110 bits (274), Expect = 6e-23
 Identities = 60/106 (56%), Positives = 63/106 (59%), Gaps = 1/106 (0%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           +SPPPP     PPP   +SPPPP  H    SPPPPV H  PPP  HSPPPP       SP
Sbjct: 732 QSPPPPPVFSPPPPAPIYSPPPPPVH----SPPPPV-HSPPPPPVHSPPPP-----VHSP 781

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           PPPV  +SPPP  HSPPPP       SPPPP   YSPPP   SPPP
Sbjct: 782 PPPV--HSPPPPVHSPPPP-----VHSPPPPSPIYSPPPPVFSPPP 820

 Score =  105 bits (261), Expect = 2e-21
 Identities = 64/116 (55%), Positives = 68/116 (58%), Gaps = 12/116 (10%)
 Frame = +2

Query: 8   PPPP----VKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           PP P     K  SP  PPV+  PPPP  H    SPPPPV  +SPPP  HSPPPP    VY
Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVH----SPPPPV--FSPPPPMHSPPPP----VY 675

Query: 170 KSPPPPVKHYSPPPVY------HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            SPPPPV    PPPV+      HSPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 676 -SPPPPVHSPPPPPVHSPPPPVHSPPPP-----VHSPPPPV--HSPPPPVHSPPPP 723

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/107 (49%), Positives = 59/107 (55%), Gaps = 3/107 (2%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYV---YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
            SPPPP  H  PPPV HSPPPP  H       SPPPPV  +SPPP  HSPPPP       S
Sbjct: 750  SPPPPPVHSPPPPV-HSPPPPPVHSPPPPVHSPPPPV--HSPPPPVHSPPPP-----VHS 801

Query: 176  PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
            PPPP   YSPPP   SPPP        +P PP    +  P+ ++P P
Sbjct: 802  PPPPSPIYSPPPPVFSPPPKP-----VTPLPP----ATSPMANAPTP 839

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 55/112 (49%), Positives = 62/112 (55%), Gaps = 6/112 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP----VKHYSP--PPVYHSPPPPKKHY 163
           K   PP++   P   Y + P  K+      PP P     K  SP  PPV+  PPPP    
Sbjct: 599 KMGSPPLESPVPNDPYDASPIKKRR---PQPPSPSTEETKTTSPQSPPVHSPPPPPP--- 652

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           V+ SPPPPV  +SPPP  HSPPPP    VY SPPPPV H  PPP  HSPPPP
Sbjct: 653 VH-SPPPPV--FSPPPPMHSPPPP----VY-SPPPPV-HSPPPPPVHSPPPP 695

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 44/116 (37%), Positives = 54/116 (46%), Gaps = 11/116 (9%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPPV  +SPPP  HSPPPP       SPPPP   YSPPP   SPPP        +P P
Sbjct: 780  SPPPPV--HSPPPPVHSPPPP-----VHSPPPPSPIYSPPPPVFSPPPKP-----VTPLP 827

Query: 185  PVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKHYSPP------PVYHSPPPP 319
            P    +  P+ ++P P            ++P P  +    P      PV+ S P P
Sbjct: 828  P----ATSPMANAPTPSSSESGEISTPVQAPTPDSEDIEAPSDSNHSPVFKSSPAP 879

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 50/116 (43%), Positives = 57/116 (49%), Gaps = 12/116 (10%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP---PVYHSP---PPPKKHYVY 169
           P PP +    P     P PPK+    K+  P  K  SPP   PV + P    P KK    
Sbjct: 568 PQPPKQETPKPEESPKPQPPKQEQPPKTEAP--KMGSPPLESPVPNDPYDASPIKKRR-- 623

Query: 170 KSPPPP----VKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             PP P     K  SP  PPV+  PPPP    V+ SPPPPV  +SPPP  HSPPPP
Sbjct: 624 PQPPSPSTEETKTTSPQSPPVHSPPPPPP---VH-SPPPPV--FSPPPPMHSPPPP 673

[65][TOP]
>UniRef100_Q39865 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39865_SOYBN
          Length = 169

 Score =  122 bits (306), Expect = 1e-26
 Identities = 62/113 (54%), Positives = 64/113 (56%), Gaps = 8/113 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y Y SPPPP     PP  YHSPPPP       Y YK
Sbjct: 15  SPPPPYYYKSPPPPSPSPPPP---YYYHSPPPPSPSPPPPYYYHSPPPPSPSPPSPYYYK 71

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP     PP  Y SPPPP       Y YKSPPPP  +  PP  Y SPPPP
Sbjct: 72  SPPPPSPSPPPPYYYKSPPPPSPTSHPPYYYKSPPPPTSYPPPPYHYVSPPPP 124

 Score =  118 bits (295), Expect = 2e-25
 Identities = 64/132 (48%), Positives = 70/132 (53%), Gaps = 21/132 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP---------VYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPP 145
           SPPPP  ++SPPP          YHSPPPP       Y YKSPPPP     PP  Y SPP
Sbjct: 31  SPPPPYYYHSPPPPSPSPPPPYYYHSPPPPSPSPPSPYYYKSPPPPSPSPPPPYYYKSPP 90

Query: 146 PPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVY 301
           PP       Y YKSPPPP  +  PP  Y SPPPP       Y Y SPPPP    +P  +Y
Sbjct: 91  PPSPTSHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPPPYHYTSPPPPSPAPAPKYIY 150

Query: 302 HSPPPPKKHYVY 337
            SPPPP   Y+Y
Sbjct: 151 KSPPPPV--YIY 160

 Score =  117 bits (293), Expect = 4e-25
 Identities = 58/103 (56%), Positives = 62/103 (60%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP  ++SPPP   SPPPP   Y YKSPPPP     PP  YHSPPPP       SPPPP 
Sbjct: 1   PPPYYYHSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYHSPPPPS-----PSPPPPY 52

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            ++SPPP   SPP P   Y YKSPPPP     PP  Y SPPPP
Sbjct: 53  YYHSPPPPSPSPPSP---YYYKSPPPPSPSPPPPYYYKSPPPP 92

 Score =  111 bits (278), Expect = 2e-23
 Identities = 61/111 (54%), Positives = 66/111 (59%), Gaps = 12/111 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPP P  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP  +    Y Y 
Sbjct: 63  SPPSPYYYKSPPPPSPSPPPP---YYYKSPPPPSPTSHPPYYYKSPPPPTSYPPPPYHYV 119

Query: 173 SPPPPVKHYSPPPVYH--SPPPPK----KHYVYKSPPPPVKHYS--PPPVY 301
           SPPPP    SPPP YH  SPPPP       Y+YKSPPPPV  Y+  PPP+Y
Sbjct: 120 SPPPPSP--SPPPPYHYTSPPPPSPAPAPKYIYKSPPPPVYIYASPPPPIY 168

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 48/91 (52%), Positives = 54/91 (59%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP     PP  Y SPPPP  +     PPPP  + SPPP   SPPPP   Y Y SPP
Sbjct: 87  KSPPPPSPTSHPPYYYKSPPPPTSY-----PPPPYHYVSPPPPSPSPPPP---YHYTSPP 138

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
           PP    +P  +Y SPPPP   Y+Y SPPPP+
Sbjct: 139 PPSPAPAPKYIYKSPPPPV--YIYASPPPPI 167

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 35/73 (47%), Positives = 38/73 (52%)
 Frame = +2

Query: 119 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
           PP  YHSPPPP       SPPPP  + SPPP   SPPPP   Y Y SPPPP         
Sbjct: 2   PPYYYHSPPPPSP-----SPPPPYYYKSPPPPSPSPPPP---YYYHSPPPP--------- 44

Query: 299 YHSPPPPKKHYVY 337
             SP PP  +Y +
Sbjct: 45  --SPSPPPPYYYH 55

[66][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score =  122 bits (305), Expect = 2e-26
 Identities = 68/120 (56%), Positives = 73/120 (60%), Gaps = 16/120 (13%)
 Frame = +2

Query: 8   PPPPVKHYS---PPPVYH-SPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPPKKHYV 166
           PPPPV HYS   PPPVY+ SPPPP  +Y    PPPPV + SPPP    YHSPPP   H  
Sbjct: 631 PPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVH-- 688

Query: 167 YKSPPPPVK---HYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPP---PVYHSPPPP 319
           Y SPPPP       SPPP   V+HSPPPP  H+   SPPPPV H SPP   P Y  P PP
Sbjct: 689 YSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHH---SPPPPVIHQSPPPPSPEYEGPLPP 745

 Score =  116 bits (290), Expect = 9e-25
 Identities = 61/108 (56%), Positives = 65/108 (60%), Gaps = 3/108 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY---VYKS 175
           SPPPP     PPPVY  PPPP        PPPPV    PPPVY SPPPP       VY +
Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPPP-----PPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCT 535

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPP   +SPPP   SPPPP+ +Y Y SPPPP  H SPPP  HSPPPP
Sbjct: 536 RPPPPPPHSPPPPQFSPPPPEPYY-YSSPPPP--HSSPPP--HSPPPP 578

 Score =  115 bits (289), Expect = 1e-24
 Identities = 66/132 (50%), Positives = 67/132 (50%), Gaps = 23/132 (17%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYS------------PPPVYH 136
           SPPPP  H SPPP  HSPPPP       Y Y SPPPP    S            PPP   
Sbjct: 562 SPPPP--HSSPPP--HSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIE 617

Query: 137 SPPPPKKHYVYKSPPPPVKHYS---PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--- 298
            PPPP        PPPPV HYS   PPPVY+S PPP   Y    PPPP  HYS PP    
Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEV 677

Query: 299 -YHSPPPPKKHY 331
            YHSPPP   HY
Sbjct: 678 HYHSPPPSPVHY 689

 Score =  115 bits (288), Expect = 2e-24
 Identities = 69/139 (49%), Positives = 75/139 (53%), Gaps = 31/139 (22%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKS 175
           PPPP  H SPPP   SPPPP+ +Y Y SPPPP  H SPPP  HSPPPP       Y Y S
Sbjct: 537 PPPPPPH-SPPPPQFSPPPPEPYY-YSSPPPP--HSSPPP--HSPPPPHSPPPPIYPYLS 590

Query: 176 P---------PPPVKHYSPPP-------------VYHSPPPPKKHYVYKSPPPPVKHYS- 286
           P         PPP   YSPPP             + +SPPPP     Y SPPPP  +YS 
Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSS 650

Query: 287 --PPPVYHS--PPPPKKHY 331
             PPPVY+S  PPPP  HY
Sbjct: 651 PPPPPVYYSSPPPPPPVHY 669

 Score =  113 bits (283), Expect = 6e-24
 Identities = 61/112 (54%), Positives = 66/112 (58%), Gaps = 8/112 (7%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           PPPPV    PPPVY SPPPP       VY + PPP   +SPPP   SPPPP+ +Y Y SP
Sbjct: 505 PPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYY-YSSP 563

Query: 179 PPPVKHYSPPPVY----HSPPPPKKHYVYKSPPP-PVKHYSPPPVYHSPPPP 319
           PPP  H SPPP      HSPPPP   Y+   PPP PV    P PVY  PPPP
Sbjct: 564 PPP--HSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPP 613

 Score =  109 bits (273), Expect = 8e-23
 Identities = 60/112 (53%), Positives = 63/112 (56%), Gaps = 4/112 (3%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP   YSPPP    PPPP   Y   SPPPP     PPPVY  PPPP        PPPP
Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVY---SPPPPSPPPPPPPVYSPPPPPPP-----PPPPP 508

Query: 188 VKHYSPPPVYHSPPPPKKHY---VYKS-PPPPVKHYSPPPVYHSPPPPKKHY 331
           V    PPPVY SPPPP       VY + PPPP  H SPPP   SPPPP+ +Y
Sbjct: 509 VYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPH-SPPPPQFSPPPPEPYY 559

 Score =  103 bits (258), Expect = 5e-21
 Identities = 59/112 (52%), Positives = 60/112 (53%), Gaps = 7/112 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY---VYKS 175
           SPPPP   +S PP   SPPPP       SPPPP     PPPVY  PPPP       VY  
Sbjct: 409 SPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP--PPPPVYSPPPPPPPPPPPPVYSP 466

Query: 176 PPPPVKHYSPPPVYHSPPPPK----KHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPPP     PPPVY SPPPP        VY SPPPP     PPPVY  PPPP
Sbjct: 467 PPPPPPPPPPPPVY-SPPPPSPPPPPPPVY-SPPPPPPPPPPPPVYSPPPPP 516

 Score =  101 bits (251), Expect = 3e-20
 Identities = 61/122 (50%), Positives = 63/122 (51%), Gaps = 17/122 (13%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP   YSPPP    PPPP    VY  PPPP     PPPVY SPPPP        PPPP
Sbjct: 442 PPPPPPVYSPPP---PPPPPPPPPVYSPPPPPPPPPPPPPVY-SPPPPSP------PPPP 491

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--------PVY---------HSPPP 316
              YSPPP    PPPP    VY  PPPPV + SPP        PVY         HSPPP
Sbjct: 492 PPVYSPPP---PPPPPPPPPVYSPPPPPV-YSSPPPPPSPAPTPVYCTRPPPPPPHSPPP 547

Query: 317 PK 322
           P+
Sbjct: 548 PQ 549

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 57/113 (50%), Positives = 58/113 (51%), Gaps = 8/113 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 172
           SP PPV    PPP   SPPPP   +       SPPPP     PPPVY  PPPP       
Sbjct: 393 SPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPP---SPPPPVYSPPPPPPPPPPVY 449

Query: 173 SPPPPVKHYSPPPVYH----SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP     PPPVY      PPPP    VY SPPPP     PPPVY  PPPP
Sbjct: 450 SPPPPPPPPPPPPVYSPPPPPPPPPPPPPVY-SPPPPSPPPPPPPVYSPPPPP 501

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 57/121 (47%), Positives = 61/121 (50%), Gaps = 32/121 (26%)
 Frame = +2

Query: 5   SPPPPVKHYS---PPPVYHSPPPPKKHYVYKSPPPPVKHY-------------------- 115
           SPPPP  +YS   PPPVY+S PPP     Y SPPPP  HY                    
Sbjct: 640 SPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAP 699

Query: 116 ---SPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPP---PVYHSPPPPKKHYVYKSPPP 268
              SPPP   V+HSPPPP  H+   SPPPPV H SPP   P Y  P PP     Y SPPP
Sbjct: 700 CEESPPPAPVVHHSPPPPMVHH---SPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPP 756

Query: 269 P 271
           P
Sbjct: 757 P 757

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 34/65 (52%), Positives = 40/65 (61%), Gaps = 3/65 (4%)
 Frame = +2

Query: 2   KSPPP-PVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 172
           +SPPP PV H+SPPP  V+HSPPPP    +++SPPP      P P Y  P PP     Y 
Sbjct: 702 ESPPPAPVVHHSPPPPMVHHSPPPP---VIHQSPPP------PSPEYEGPLPPVIGVSYA 752

Query: 173 SPPPP 187
           SPPPP
Sbjct: 753 SPPPP 757

[67][TOP]
>UniRef100_Q9FH26 Genomic DNA, chromosome 5, TAC clone: K20J1 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FH26_ARATH
          Length = 609

 Score =  122 bits (305), Expect = 2e-26
 Identities = 69/137 (50%), Positives = 77/137 (56%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 371 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 427

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY+SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 428 VYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 487

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 488 SPSPKVDYKSPPPPYVY 504

 Score =  122 bits (305), Expect = 2e-26
 Identities = 71/141 (50%), Positives = 79/141 (56%), Gaps = 28/141 (19%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 471 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 527

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY+SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 528 VYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 587

Query: 305 SP---------PPPKKHYVYK 340
           SP         PPP   YVYK
Sbjct: 588 SPSPKVTYKSLPPP---YVYK 605

 Score =  121 bits (304), Expect = 2e-26
 Identities = 65/121 (53%), Positives = 73/121 (60%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 346 KSPPPPYVYSSPPPPYYSPTPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 399

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           PP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY+SPPP
Sbjct: 400 PPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPP 459

Query: 317 P 319
           P
Sbjct: 460 P 460

 Score =  121 bits (303), Expect = 3e-26
 Identities = 69/137 (50%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 296 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 352

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 353 VYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 412

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 413 SPSPKVDYKSPPPPYVY 429

 Score =  121 bits (303), Expect = 3e-26
 Identities = 69/137 (50%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY 
Sbjct: 446 KSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYS 505

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           SPPP    P     YKSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+
Sbjct: 506 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYNSPPPPYY 562

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 563 SPSPKVDYKSPPPPYVY 579

 Score =  120 bits (302), Expect = 4e-26
 Identities = 63/118 (53%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 171 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 224

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 225 PPYVYSSPPPPYYSPTPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVY 279

 Score =  120 bits (302), Expect = 4e-26
 Identities = 69/137 (50%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY 
Sbjct: 246 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKSPPPPYVYS 305

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           SPPP    P     YKSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+
Sbjct: 306 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYY 362

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 363 SPTPKVDYKSPPPPYVY 379

 Score =  119 bits (297), Expect = 1e-25
 Identities = 68/139 (48%), Positives = 75/139 (53%), Gaps = 27/139 (19%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPP-----------V 130
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP  +YSP P           V
Sbjct: 221 KSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPP--YYSPSPKVDYKSPPLPYV 278

Query: 131 YHSPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
           Y SPPP    P     YKSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP 
Sbjct: 279 YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPP 335

Query: 299 YHSPPP------PKKHYVY 337
           Y+SP P      P   YVY
Sbjct: 336 YYSPSPKVDYKSPPPPYVY 354

 Score =  117 bits (294), Expect = 3e-25
 Identities = 67/137 (48%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y++P P      YKSPPPP ++ SPPP Y+SP P      P   Y
Sbjct: 71  KSPPPPYVYSSPPPPYYTPSPKVD---YKSPPPPYEYSSPPPPYYSPSPKIDYKSPPPPY 127

Query: 164 VYKSPP-------PPVKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPP       P V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 128 VYSSPPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYY 187

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 188 SPSPKVDYKSPPPPYVY 204

 Score =  117 bits (294), Expect = 3e-25
 Identities = 72/159 (45%), Positives = 80/159 (50%), Gaps = 47/159 (29%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVY----------------KSPPPPVKHY 115
           KSPPPP ++ SPPP Y+SP P      P   YVY                KSPPPP  + 
Sbjct: 96  KSPPPPYEYSSPPPPYYSPSPKIDYKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYVYS 155

Query: 116 SPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP----PK 238
           SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY SPPP    P 
Sbjct: 156 SPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPS 215

Query: 239 KHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
               YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 216 PKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVY 254

 Score =  109 bits (273), Expect = 8e-23
 Identities = 65/130 (50%), Positives = 70/130 (53%), Gaps = 19/130 (14%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPPVYH--SPPP--- 148
           SPPPP    SP   Y SPPPP   YVY SPPPP       V + SPPP Y   SPPP   
Sbjct: 56  SPPPPYYSPSPKVNYKSPPPP---YVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYY 112

Query: 149 -PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP--- 316
            P     YKSPPPP  + SPP  Y+SP P      YKSPPPP  + SPPP Y+SP P   
Sbjct: 113 SPSPKIDYKSPPPPYVYSSPPLPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPTPKVD 169

Query: 317 ---PKKHYVY 337
              P   YVY
Sbjct: 170 YKSPPPPYVY 179

 Score =  101 bits (252), Expect = 2e-20
 Identities = 57/115 (49%), Positives = 65/115 (56%), Gaps = 19/115 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY+
Sbjct: 496 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYN 555

Query: 137 SPPPP----KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 289
           SPPPP         YKSPPPP  + SPPP Y+SP P      YKS PPP  + +P
Sbjct: 556 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPK---VTYKSLPPPYVYKAP 607

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 61/133 (45%), Positives = 68/133 (51%), Gaps = 31/133 (23%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPP---PPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP--- 148
           P    Y+ P   H  P   P  K Y+Y SPPPP       V + SPPP  VY SPPP   
Sbjct: 28  PQTPQYNFPSHQHKSPKYTPHSKPYIYNSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYY 87

Query: 149 -PKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPP-------PPVKHYS 286
            P     YKSPPPP ++ SPPP Y+SP P      P   YVY SPP       P V + S
Sbjct: 88  TPSPKVDYKSPPPPYEYSSPPPPYYSPSPKIDYKSPPPPYVYSSPPLPYYSPSPKVDYKS 147

Query: 287 PPP--VYHSPPPP 319
           PPP  VY SPPPP
Sbjct: 148 PPPPYVYSSPPPP 160

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/110 (43%), Positives = 60/110 (54%), Gaps = 13/110 (11%)
 Frame = +2

Query: 47  YHSPPPPKKHYV-YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VY 217
           Y SP  P+ ++  ++   P    +S P +Y+SPPPP     Y SP P V + SPPP  VY
Sbjct: 25  YSSPQTPQYNFPSHQHKSPKYTPHSKPYIYNSPPPP-----YYSPSPKVNYKSPPPPYVY 79

Query: 218 HSPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
            SPPP    P     YKSPPPP ++ SPPP Y+SP P      P   YVY
Sbjct: 80  SSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSPSPKIDYKSPPPPYVY 129

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/87 (48%), Positives = 46/87 (52%), Gaps = 3/87 (3%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYHSPP---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 247
           Y Y SP  P   Y+ P   H  P   P  K Y+Y SPPPP    SP   Y SPPPP   Y
Sbjct: 23  YPYSSPQTP--QYNFPSHQHKSPKYTPHSKPYIYNSPPPPYYSPSPKVNYKSPPPP---Y 77

Query: 248 VYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           VY SPPPP    SP   Y SPPPP ++
Sbjct: 78  VYSSPPPPYYTPSPKVDYKSPPPPYEY 104

[68][TOP]
>UniRef100_Q9STM8 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STM8_ARATH
          Length = 513

 Score =  121 bits (304), Expect = 2e-26
 Identities = 65/121 (53%), Positives = 73/121 (60%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 280 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPTPKVD---YKSPP 333

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           PP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY+SPPP
Sbjct: 334 PPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPP 393

Query: 317 P 319
           P
Sbjct: 394 P 394

 Score =  120 bits (302), Expect = 4e-26
 Identities = 68/138 (49%), Positives = 75/138 (54%), Gaps = 26/138 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 181 KSPPPPYVYSSPPPPYYSPTPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 237

Query: 164 VYKSPPPPVKHYS----------PPPVYHSPPP----PKKHYVYKSPPPPVKHYSPPPVY 301
           VY SPPPP  +YS          PPP Y SPPP    P     YKSPPPP  + SPPP Y
Sbjct: 238 VYSSPPPP--YYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 295

Query: 302 HSPPP------PKKHYVY 337
           +SP P      P   YVY
Sbjct: 296 YSPSPKVDYKSPPPPYVY 313

 Score =  120 bits (302), Expect = 4e-26
 Identities = 65/121 (53%), Positives = 72/121 (59%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 355 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYNSPPPPYYSPSPKVD---YKSPP 408

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           PP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY SPPP
Sbjct: 409 PPYIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPP 468

Query: 317 P 319
           P
Sbjct: 469 P 469

 Score =  120 bits (301), Expect = 5e-26
 Identities = 65/118 (55%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 380 KSPPPPYVYNSPPPPYYSPSPKVD---YKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPPY 436

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           VY SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 437 VYSSPPPPYYSPSPKVNYKSPPPP---YVYSSPPPPYYSPSPNVDYKSPPPP---YVY 488

 Score =  117 bits (294), Expect = 3e-25
 Identities = 62/118 (52%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KS PPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 106 KSLPPPYVYSSPPPPYYSPSPKVN---YKSPPPPYVYSSPPPPYYSPSPKGD---YKSPP 159

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 160 PPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVY 214

 Score =  117 bits (294), Expect = 3e-25
 Identities = 69/137 (50%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY 
Sbjct: 156 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYS 215

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           SPPP    P     YKSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+
Sbjct: 216 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVN---YKSPPPPY-YRSPPPPYY 271

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 272 SPSPKVDYKSPPPPYVY 288

 Score =  117 bits (293), Expect = 4e-25
 Identities = 69/137 (50%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 231 KSPPPPYVYSSPPPPYYSPSPKVN---YKSPPPPY-YRSPPPPYYSPSPKVDYKSPPPPY 286

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 287 VYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYY 346

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 347 SPSPKVDYKSPPPPYVY 363

 Score =  116 bits (290), Expect = 9e-25
 Identities = 66/121 (54%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSP---------PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 154
           KSPPP   + SPPP Y+SP         PPP   YVY SPPPP    SP   Y SPPPP 
Sbjct: 81  KSPPPSYVYSSPPPPYYSPSPKVDYKSLPPP---YVYSSPPPPYYSPSPKVNYKSPPPP- 136

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
             YVY SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YV
Sbjct: 137 --YVYSSPPPPYYSPSPKGDYKSPPPP---YVYSSPPPPYYSPSPKVDYKSPPPP---YV 188

Query: 335 Y 337
           Y
Sbjct: 189 Y 189

 Score =  115 bits (288), Expect = 2e-24
 Identities = 61/118 (51%), Positives = 68/118 (57%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YK+PPPP  + SPPP Y+SP P      YKSPP
Sbjct: 405 KSPPPPYIYNSPPPPYYSPSPKVN---YKTPPPPYVYSSPPPPYYSPSPKVN---YKSPP 458

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P      P   YVY SPP P    S    Y SPPPP   YVY
Sbjct: 459 PPYVYSSPPPPYYSPSPNVDYKSPPPPYVYSSPPTPYYSPSSKVTYKSPPPP---YVY 513

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 58/131 (44%), Positives = 65/131 (49%), Gaps = 23/131 (17%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPP---PPKKHYVYKSPPPP--------VKHYSPPP--VYHSPPP-- 148
           P   HY+ P   H  P   P  K  +Y S PPP        V + SPPP  VY SPPP  
Sbjct: 37  PQTPHYNSPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYSSPPPPY 96

Query: 149 --PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP-- 316
             P     YKS PPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P  
Sbjct: 97  YSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVN---YKSPPPPYVYSSPPPPYYSPSPKG 153

Query: 317 ----PKKHYVY 337
               P   YVY
Sbjct: 154 DYKSPPPPYVY 164

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 36/86 (41%), Positives = 40/86 (46%), Gaps = 1/86 (1%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 256
           Y Y SP  P  HY+ P   H  P    H     P P +   SPPP Y+SP P      YK
Sbjct: 32  YPYTSPQTP--HYNSPSHEHKIPKYTPH-----PKPSIYSSSPPPSYYSPSPKVD---YK 81

Query: 257 SPPPPVKHYSPPP-VYHSPPPPKKHY 331
           SPPP   + SPPP  Y   P PK  Y
Sbjct: 82  SPPPSYVYSSPPPPYY--SPSPKVDY 105

[69][TOP]
>UniRef100_Q9STM7 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STM7_ARATH
          Length = 707

 Score =  121 bits (304), Expect = 2e-26
 Identities = 70/140 (50%), Positives = 78/140 (55%), Gaps = 34/140 (24%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V++ SPPP  +Y 
Sbjct: 524 KSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYS 583

Query: 137 SPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP----- 271
           SPPP    P     YKSPPPP  + SPPP Y+SP P      P   YVY SPPPP     
Sbjct: 584 SPPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPS 643

Query: 272 --VKHYSPPP--VYHSPPPP 319
             V + SPPP  VY SPPPP
Sbjct: 644 PKVNYKSPPPPYVYSSPPPP 663

 Score =  121 bits (303), Expect = 3e-26
 Identities = 69/137 (50%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 149 KSPPPPYVYSSPPPPYYSPSPKGD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 205

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 206 VYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 265

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 266 SPSPKVNYKSPPPPYVY 282

 Score =  121 bits (303), Expect = 3e-26
 Identities = 63/118 (53%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 199 KSPPPPYVYSSPPPPYYSPTPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 252

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 253 PPYVYSSPPPPYYSPSPKVN---YKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVY 307

 Score =  121 bits (303), Expect = 3e-26
 Identities = 63/118 (53%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 224 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVN---YKSPP 277

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 278 PPYVYGSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVY 332

 Score =  121 bits (303), Expect = 3e-26
 Identities = 69/137 (50%), Positives = 76/137 (55%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHY 163
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y
Sbjct: 249 KSPPPPYVYSSPPPPYYSPSPKVN---YKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPY 305

Query: 164 VYKSPPPP-------VKHYSPPP--VYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYH 304
           VY SPPPP       V + SPPP  VY SPPP    P     YKSPPPP  + SPPP Y+
Sbjct: 306 VYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 365

Query: 305 SPPP------PKKHYVY 337
           SP P      P   YVY
Sbjct: 366 SPSPKVDYKSPPPPYVY 382

 Score =  119 bits (299), Expect = 8e-26
 Identities = 64/124 (51%), Positives = 72/124 (58%), Gaps = 19/124 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   Y+Y SPPPP       V + SPPP  VY 
Sbjct: 549 KSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYVYS 608

Query: 137 SPPPP----KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           SPPPP         YKSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+
Sbjct: 609 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVN---YKSPPPPYVYSSPPPPYY 665

Query: 305 SPPP 316
           SP P
Sbjct: 666 SPSP 669

 Score =  119 bits (297), Expect = 1e-25
 Identities = 66/121 (54%), Positives = 69/121 (57%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   Y
Sbjct: 449 KSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPP---Y 505

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           VY  PPPP    SP   Y SPPPP   YVY SPPPP       V + SPPP  VY SPPP
Sbjct: 506 VYSFPPPPYYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPP 562

Query: 317 P 319
           P
Sbjct: 563 P 563

 Score =  118 bits (296), Expect = 2e-25
 Identities = 63/121 (52%), Positives = 71/121 (58%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  +  PPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 499 KSPPPPYVYSFPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVN---YKSPP 552

Query: 182 PPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYHSPPP 316
           PP  + SPPP Y+SP P      P   Y+Y SPPPP       V + SPPP  VY SPPP
Sbjct: 553 PPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPPP 612

Query: 317 P 319
           P
Sbjct: 613 P 613

 Score =  118 bits (295), Expect = 2e-25
 Identities = 62/118 (52%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 299 KSPPPPYVYSSPPPPYYSPSPKVN---YKSPPPPYVYGSPPPPYYSPSPKVD---YKSPP 352

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P      YKSPPPP  + S PP Y+SP P      P   YVY
Sbjct: 353 PPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYVY 407

 Score =  117 bits (294), Expect = 3e-25
 Identities = 62/118 (52%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KS PPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 124 KSLPPPYVYSSPPPPYYSPSPKVN---YKSPPPPYVYSSPPPPYYSPSPKGD---YKSPP 177

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   YVY
Sbjct: 178 PPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVY 232

 Score =  117 bits (294), Expect = 3e-25
 Identities = 62/118 (52%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 599 KSPPPPYVYSSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVN---YKSPP 652

Query: 182 PPVKHYSPPPVYHSPPPPKKH------YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PP  + SPPP Y+SP P   +      YVY SPP P    SP   Y SPPPP   YVY
Sbjct: 653 PPYVYSSPPPPYYSPSPKVDYKSSPPQYVYSSPPTPYYSPSPKVTYKSPPPP---YVY 707

 Score =  117 bits (293), Expect = 4e-25
 Identities = 61/118 (51%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P      YKSPP
Sbjct: 324 KSPPPPYVYGSPPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVD---YKSPP 377

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP------PKKHYVY 337
           PP  + S PP Y+SP P      YKSPPPP  + SPPP Y+SP P      P   Y+Y
Sbjct: 378 PPYVYSSTPPPYYSPSPKVD---YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYIY 432

 Score =  116 bits (290), Expect = 9e-25
 Identities = 66/121 (54%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSP---------PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 154
           KSPPP   + SPPP Y+SP         PPP   YVY SPPPP    SP   Y SPPPP 
Sbjct: 99  KSPPPSYVYSSPPPPYYSPSPKVDYKSLPPP---YVYSSPPPPYYSPSPKVNYKSPPPP- 154

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
             YVY SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YV
Sbjct: 155 --YVYSSPPPPYYSPSPKGDYKSPPPP---YVYSSPPPPYYSPSPKVDYKSPPPP---YV 206

Query: 335 Y 337
           Y
Sbjct: 207 Y 207

 Score =  114 bits (285), Expect = 3e-24
 Identities = 67/140 (47%), Positives = 71/140 (50%), Gaps = 28/140 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSP--------PPPKKHYV--------------YKSPPPPVKHY 115
           KSPPPP  + SPPP Y+SP        PPP   Y               YKSPPPP  + 
Sbjct: 399 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYS 458

Query: 116 SPPPVYHSP------PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 277
           SPPP Y+SP       PP   YVY SPPPP    SP   Y SPPPP   YVY  PPPP  
Sbjct: 459 SPPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPP---YVYSFPPPPYY 515

Query: 278 HYSPPPVYHSPPPPKKHYVY 337
             SP   Y SPPPP   YVY
Sbjct: 516 SPSPKVDYKSPPPP---YVY 532

 Score =  111 bits (278), Expect = 2e-23
 Identities = 66/137 (48%), Positives = 72/137 (52%), Gaps = 25/137 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + S PP Y+SP P      P   YVY SPPPP       V + SPPP  +Y 
Sbjct: 374 KSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYIYS 433

Query: 137 SPP----PPKKHYVYKSPPPPVKHYSPPPVYHSP------PPPKKHYVYKSPPPPVKHYS 286
           S P     P     YKSPPPP  + SPPP Y+SP       PP   YVY SPPPP    S
Sbjct: 434 STPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPS 493

Query: 287 PPPVYHSPPPPKKHYVY 337
           P   Y SPPPP   YVY
Sbjct: 494 PKVDYKSPPPP---YVY 507

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 58/131 (44%), Positives = 65/131 (49%), Gaps = 23/131 (17%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPP---PPKKHYVYKSPPPP--------VKHYSPPP--VYHSPPP-- 148
           P   HY+ P   H  P   P  K  +Y S PPP        V + SPPP  VY SPPP  
Sbjct: 55  PQTPHYNSPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYSSPPPPY 114

Query: 149 --PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP-- 316
             P     YKS PPP  + SPPP Y+SP P      YKSPPPP  + SPPP Y+SP P  
Sbjct: 115 YSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVN---YKSPPPPYVYSSPPPPYYSPSPKG 171

Query: 317 ----PKKHYVY 337
               P   YVY
Sbjct: 172 DYKSPPPPYVY 182

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 36/86 (41%), Positives = 40/86 (46%), Gaps = 1/86 (1%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 256
           Y Y SP  P  HY+ P   H  P    H     P P +   SPPP Y+SP P      YK
Sbjct: 50  YPYTSPQTP--HYNSPSHEHKIPKYTPH-----PKPSIYSSSPPPSYYSPSPKVD---YK 99

Query: 257 SPPPPVKHYSPPP-VYHSPPPPKKHY 331
           SPPP   + SPPP  Y   P PK  Y
Sbjct: 100 SPPPSYVYSSPPPPYY--SPSPKVDY 123

[70][TOP]
>UniRef100_Q39866 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39866_SOYBN
          Length = 118

 Score =  121 bits (304), Expect = 2e-26
 Identities = 64/113 (56%), Positives = 66/113 (58%), Gaps = 8/113 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SP PP   Y+YKSPPPP     PP VY SPPPP       YVYK
Sbjct: 2   SPPPPYVYKSPPPP--SPSPPPP-YIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYK 58

Query: 173 SPPPPVKHYSPPPVYHSPPPPK----KHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP     PP VY SPPPP       Y YKSPPPP     PP  Y SPPPP
Sbjct: 59  SPPPPSPSPPPPYVYKSPPPPSPSPPSPYYYKSPPPPSPSPPPPYYYKSPPPP 111

 Score =  119 bits (298), Expect = 1e-25
 Identities = 62/109 (56%), Positives = 64/109 (58%), Gaps = 4/109 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   YVYKSPPPP     PP VY SPPPP       YVYK
Sbjct: 18  SPPPPYIYKSPPPPSPSPPPP---YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYK 74

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP      P  Y SPPPP       SPPPP  + SPPP   SPPPP
Sbjct: 75  SPPPPSPSPPSPYYYKSPPPPS-----PSPPPPYYYKSPPPPSPSPPPP 118

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/111 (54%), Positives = 63/111 (56%), Gaps = 15/111 (13%)
 Frame = +2

Query: 53  SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYH 220
           SPPPP   YVYKSPPPP     PP +Y SPPPP       YVYKSPPPP     PP VY 
Sbjct: 2   SPPPP---YVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYK 58

Query: 221 SPPPPKKH----YVYKSPPP-------PVKHYSPPPVYHSPPPPKKHYVYK 340
           SPPPP       YVYKSPPP       P  + SPPP   SPPPP   Y YK
Sbjct: 59  SPPPPSPSPPPPYVYKSPPPPSPSPPSPYYYKSPPPPSPSPPPP---YYYK 106

[71][TOP]
>UniRef100_Q94ES5 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES5_PEA
          Length = 144

 Score =  120 bits (302), Expect = 4e-26
 Identities = 68/123 (55%), Positives = 70/123 (56%), Gaps = 14/123 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPP-PVYHSPPPP---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP----K 154
           SPPPPV  Y  P PVYHSPPPP   KK Y Y SPPPP  H    P PVYHSPPPP    K
Sbjct: 34  SPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHK 93

Query: 155 KHYVYKSPPPPVKHYSPP----PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           K Y Y SPPPP  H  PP    PVYHSPPPP       SPPPP         Y+  PPP 
Sbjct: 94  KPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAY-----SPPPPA-------YYYKSPPPP 141

Query: 323 KHY 331
            H+
Sbjct: 142 YHH 144

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/104 (55%), Positives = 59/104 (56%), Gaps = 13/104 (12%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP---KKHYVYKSPPPPVKHY--SPPP 211
           Y SPPPP   Y +           P PVYHSPPPP   KK Y Y SPPPP  H    P P
Sbjct: 32  YSSPPPPVHTYPH-----------PHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHP 80

Query: 212 VYHSPPPP----KKHYVYKSPPPPVKHYSPP----PVYHSPPPP 319
           VYHSPPPP    KK Y Y SPPPP  H  PP    PVYHSPPPP
Sbjct: 81  VYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP 124

[72][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score =  120 bits (302), Expect = 4e-26
 Identities = 61/114 (53%), Positives = 67/114 (58%), Gaps = 5/114 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPPPVYHSPPPPK-KHYVYKSP 178
           SPPPP   +SPPP  HSPPPP   Y+   PPP PV    PPPVY  PPPP     +   P
Sbjct: 403 SPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPP 462

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYHSPPPPKKHY 331
           PPP   YSPPP   SPPPP ++    S   PPPPV +YSPPP   SPPPP   Y
Sbjct: 463 PPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQSPPPPAPVY 516

 Score =  114 bits (284), Expect = 4e-24
 Identities = 60/125 (48%), Positives = 65/125 (52%), Gaps = 18/125 (14%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH--------- 160
           PPPP     PPP   SPPPP  +Y Y SPPPP   +SPPP  HSPPPP            
Sbjct: 361 PPPPPNSPPPPPPLFSPPPPTPYY-YSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHS 419

Query: 161 -----YVYKSPPPP---VKHYSPPPVYHSPPPPK-KHYVYKSPPPPVKHYSPPPVYHSPP 313
                Y Y SPPPP   V    PPPVY  PPPP     +   PPPP   YSPPP   SPP
Sbjct: 420 PPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPP 479

Query: 314 PPKKH 328
           PP ++
Sbjct: 480 PPTQY 484

 Score =  112 bits (280), Expect = 1e-23
 Identities = 62/119 (52%), Positives = 67/119 (56%), Gaps = 8/119 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKH-------YVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           SPPPPV  YSPPP   SPPPP           V   PPPP     PPP   SPPPP  +Y
Sbjct: 327 SPPPPV--YSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYY 384

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY-HSPPPPKKHYVY 337
            Y SPPPP   +SPPP  HSPPPP   +   SPPPP  H  PPP+Y +  PPP  H VY
Sbjct: 385 -YSSPPPPSPPHSPPPPPHSPPPPSPPH---SPPPP-PHSPPPPIYPYLSPPPPPHPVY 438

 Score =  108 bits (271), Expect = 1e-22
 Identities = 62/108 (57%), Positives = 62/108 (57%), Gaps = 3/108 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS---PPPVYHSPPPPKKHYVYKS 175
           SPPPP   YSPPP   SPPPP    VY  PPPP   YS   PPPVY  PPPP       S
Sbjct: 257 SPPPPPPVYSPPPPPPSPPPP----VYSPPPPPPPVYSPPPPPPVYSPPPPP------PS 306

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPPP     PPPVY  PPPP       SPPPPV  YSPPP   SPPPP
Sbjct: 307 PPPP-----PPPVYSPPPPPSP--PPPSPPPPV--YSPPPPPPSPPPP 345

 Score =  107 bits (266), Expect = 5e-22
 Identities = 58/114 (50%), Positives = 65/114 (57%), Gaps = 6/114 (5%)
 Frame = +2

Query: 8   PPPPVKHYSPPP--VYHSPPPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           PPPP   YSPPP  VY  PPPP     +   PPPP   YSPPP   SPPPP ++    SP
Sbjct: 431 PPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSP 490

Query: 179 ---PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
              PPPV +YSPPP   SPPPP    VY+ P PP+   S    Y SPPPP  +Y
Sbjct: 491 SPPPPPVHYYSPPPPSQSPPPPAP--VYEGPLPPITGVS----YASPPPPPYYY 538

 Score =  105 bits (261), Expect = 2e-21
 Identities = 58/119 (48%), Positives = 60/119 (50%), Gaps = 15/119 (12%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH--------YSPPPVYHSPPPPK--- 154
           PPPPV    PPP    PPPP    VY  PPPP           YSPPP   SPPPP    
Sbjct: 293 PPPPVYSPPPPPPSPPPPPPP---VYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPP 349

Query: 155 ----KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                  V   PPPP     PPP   SPPPP  +Y Y SPPPP   +SPPP  HSPPPP
Sbjct: 350 PSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYY-YSSPPPPSPPHSPPPPPHSPPPP 407

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 57/110 (51%), Positives = 57/110 (51%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           P PPV  Y PPPVY  PPPP    VY  PPPP     PPPVY  PPPP   Y   SPPPP
Sbjct: 245 PSPPV--YLPPPVYSPPPPPP---VYSPPPPPPS--PPPPVYSPPPPPPPVY---SPPPP 294

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
                 PPVY  PPPP        PPPP   YSPPP    PPP     VY
Sbjct: 295 ------PPVYSPPPPPPS-----PPPPPPPVYSPPPPPSPPPPSPPPPVY 333

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 55/108 (50%), Positives = 56/108 (51%), Gaps = 4/108 (3%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PP P      PPVY  PP      VY SPPPP      PPVY  PPPP       SPPPP
Sbjct: 237 PPSPPMPVPSPPVYLPPP------VY-SPPPP------PPVYSPPPPP------PSPPPP 277

Query: 188 VKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           V  YS    PPPVY  PPPP    VY  PPPP     PPP  +SPPPP
Sbjct: 278 V--YSPPPPPPPVYSPPPPPP---VYSPPPPPPSPPPPPPPVYSPPPP 320

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/93 (51%), Positives = 49/93 (52%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 220
           P   +PPPP       SPP     Y PPPVY  PPPP    VY  PPPP     PPPVY 
Sbjct: 230 PTLPAPPPPSPPMPVPSPPV----YLPPPVYSPPPPPP---VYSPPPPPPS--PPPPVYS 280

Query: 221 SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPPP   Y   SPPPP      PPVY SPPPP
Sbjct: 281 PPPPPPPVY---SPPPP------PPVY-SPPPP 303

[73][TOP]
>UniRef100_Q2A9D1 Extensin-like region containing protein n=1 Tax=Brassica oleracea
           RepID=Q2A9D1_BRAOL
          Length = 543

 Score =  120 bits (301), Expect = 5e-26
 Identities = 75/141 (53%), Positives = 80/141 (56%), Gaps = 29/141 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVY 169
           KSPPPP  +YSP P   Y SPPPP   YVY SPPPP  +YSP P   Y SPPPP   YVY
Sbjct: 277 KSPPPPPPYYSPSPKFEYKSPPPP---YVYSSPPPP-PYYSPSPKVEYKSPPPP---YVY 329

Query: 170 KSPPPP--------VKHYSPPP--VYHSPPPPKKH-----YVYKSPPPPVKHYSPPP--- 295
            SPPPP        V + SPPP  VY SPPPP  +       YKSPPPP  + SPPP   
Sbjct: 330 NSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPY 389

Query: 296 -------VYHSPPPPKKHYVY 337
                  VY SPPPP   YVY
Sbjct: 390 YSPSPKMVYKSPPPP---YVY 407

 Score =  120 bits (301), Expect = 5e-26
 Identities = 72/125 (57%), Positives = 76/125 (60%), Gaps = 16/125 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----------VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPP 145
           KSPPPP  + SPPP           Y SPPPP   YVY SPPPP  +YSP P  VY SPP
Sbjct: 347 KSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPP---YVYSSPPPP-PYYSPSPKMVYKSPP 402

Query: 146 PPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPP 313
           PP   YVY SPPPP  +YSP P   Y SPPPP   YVY SPPPP  +YSP P   Y SPP
Sbjct: 403 PP---YVYSSPPPP-PYYSPSPKVNYKSPPPP---YVYSSPPPP-PYYSPSPKVNYKSPP 454

Query: 314 PPKKH 328
           PP  H
Sbjct: 455 PPYVH 459

 Score =  119 bits (298), Expect = 1e-25
 Identities = 71/127 (55%), Positives = 76/127 (59%), Gaps = 14/127 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP----------VYHSPPPP 151
           KSPPPP  + SPPP  +  P PK +  YKSPPPP  H SPPP           Y SPPPP
Sbjct: 425 KSPPPPYVYSSPPPPPYYSPSPKVN--YKSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPP 482

Query: 152 KKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPP 319
              YVY SPPPP  +YSP P   Y SPPPP   YVY SPPPP  +YSP P   Y SPPPP
Sbjct: 483 ---YVYSSPPPP-PYYSPSPKVDYKSPPPP---YVYSSPPPP-PYYSPSPKVYYKSPPPP 534

Query: 320 KKHYVYK 340
              YVYK
Sbjct: 535 P--YVYK 539

 Score =  117 bits (293), Expect = 4e-25
 Identities = 75/149 (50%), Positives = 79/149 (53%), Gaps = 37/149 (24%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----------VYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPP 145
           KSPPPP  + SPPP          VY SPPPP   YVY SPPPP  +YSP P   Y SPP
Sbjct: 373 KSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPP---YVYSSPPPP-PYYSPSPKVNYKSPP 428

Query: 146 PPKKHYVYKSPPPP--------VKHYSPPPVY-HSPPPPKKHY------VYKSPPPPVKH 280
           PP   YVY SPPPP        V + SPPP Y HS PPP   Y       YKSPPPP  +
Sbjct: 429 PP---YVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPPYVY 485

Query: 281 YSPPPV----------YHSPPPPKKHYVY 337
            SPPP           Y SPPPP   YVY
Sbjct: 486 SSPPPPPYYSPSPKVDYKSPPPP---YVY 511

 Score =  115 bits (288), Expect = 2e-24
 Identities = 69/118 (58%), Positives = 73/118 (61%), Gaps = 6/118 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKS 175
           KSPPPP    SPPP  +  P PK  Y  KSPPPP  +YSP P   Y SPPPP   YVY S
Sbjct: 251 KSPPPPYVCSSPPPPPYYSPSPKVDY--KSPPPPPPYYSPSPKFEYKSPPPP---YVYSS 305

Query: 176 PPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVY 337
           PPPP  +YSP P   Y SPPPP   YVY SPPPP  +YSP P   Y SPPPP   YVY
Sbjct: 306 PPPP-PYYSPSPKVEYKSPPPP---YVYNSPPPP-PYYSPSPKVDYKSPPPP---YVY 355

 Score =  115 bits (287), Expect = 2e-24
 Identities = 69/123 (56%), Positives = 76/123 (61%), Gaps = 13/123 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV-YHSPPP------PKKHYVYKSPPPPVKHYSPPPV--YHSPPPPK 154
           KSPPPP  + SPPP  Y+SP P      P+  YVY SPPPP  +YSP P   Y SPPPP 
Sbjct: 173 KSPPPPYVYSSPPPPPYYSPSPKVEYKSPQPPYVYSSPPPP-PYYSPSPKVDYKSPPPP- 230

Query: 155 KHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPK 322
             YVY SPPPP  +YSP P   Y SPPPP   YV  SPPPP  +YSP P   Y SPPPP 
Sbjct: 231 --YVYSSPPPP-PYYSPSPKVDYKSPPPP---YVCSSPPPP-PYYSPSPKVDYKSPPPPP 283

Query: 323 KHY 331
            +Y
Sbjct: 284 PYY 286

 Score =  113 bits (282), Expect = 7e-24
 Identities = 74/150 (49%), Positives = 80/150 (53%), Gaps = 38/150 (25%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV----------YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPP 145
           KSPPPP  + SPPP           Y SPPPP   YVY SPPPP  +YSP P   Y SPP
Sbjct: 95  KSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPP---YVYSSPPPP-PYYSPSPKVEYKSPP 150

Query: 146 PPKKHYVYKSPPPP--------VKHYSPPP--VYHSPPPPKKH--------------YVY 253
           PP   YVY SPPPP         ++ SPPP  VY SPPPP  +              YVY
Sbjct: 151 PP---YVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPQPPYVY 207

Query: 254 KSPPPPVKHYSPPPV--YHSPPPPKKHYVY 337
            SPPPP  +YSP P   Y SPPPP   YVY
Sbjct: 208 SSPPPP-PYYSPSPKVDYKSPPPP---YVY 233

 Score =  112 bits (280), Expect = 1e-23
 Identities = 64/118 (54%), Positives = 71/118 (60%), Gaps = 12/118 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  + SPPP  +  P PK  Y  KSPPPP    SPPP  +  P PK    YKSPP
Sbjct: 225 KSPPPPYVYSSPPPPPYYSPSPKVDY--KSPPPPYVCSSPPPPPYYSPSPKVD--YKSPP 280

Query: 182 PPVKHYSPPP--VYHSPPPPKKHYVYKSPPPP--------VKHYSPPP--VYHSPPPP 319
           PP  +YSP P   Y SPPPP   YVY SPPPP        V++ SPPP  VY+SPPPP
Sbjct: 281 PPPPYYSPSPKFEYKSPPPP---YVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPP 335

 Score =  107 bits (266), Expect = 5e-22
 Identities = 68/137 (49%), Positives = 73/137 (53%), Gaps = 26/137 (18%)
 Frame = +2

Query: 5   SPPPPVKHYSP-------PPVYHSPPP-----PKKHYVYKSPPPPVKHYSPPPV------ 130
           SPPP  +   P       P +Y SPPP     P     YKSPPPP  + SPPP       
Sbjct: 56  SPPPQYRRQGPKYTPHPKPYIYSSPPPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPS 115

Query: 131 ----YHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPP 292
               Y SPPPP   YVY SPPPP  +YSP P   Y SPPPP   YVY SPPPP  +YSP 
Sbjct: 116 PKVDYKSPPPP---YVYSSPPPP-PYYSPSPKVEYKSPPPP---YVYNSPPPP-PYYSPS 167

Query: 293 P--VYHSPPPPKKHYVY 337
           P   Y SPPPP   YVY
Sbjct: 168 PKAEYKSPPPP---YVY 181

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 58/101 (57%), Positives = 60/101 (59%), Gaps = 14/101 (13%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----------VYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPP 145
           KSPPPP  H SPPP           Y SPPPP   YVY SPPPP  +YSP P   Y SPP
Sbjct: 451 KSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPP---YVYSSPPPP-PYYSPSPKVDYKSPP 506

Query: 146 PPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSP 262
           PP   YVY SPPPP  +YSP P   Y SPPPP   YVYK P
Sbjct: 507 PP---YVYSSPPPP-PYYSPSPKVYYKSPPPPP--YVYKMP 541

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 64/144 (44%), Positives = 71/144 (49%), Gaps = 41/144 (28%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPK---------------------------KHYVYKSPPPPVK 109
           PP  + Y P     SP PPK                           K Y+Y SPPP   
Sbjct: 26  PPTTQKYPPVHKTKSPYPPKMNSPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSSPPPS-S 84

Query: 110 HYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPP-- 271
           +YSP P   Y SPPPP   YVY SPPPP  +YSP P   Y SPPPP   YVY SPPPP  
Sbjct: 85  YYSPSPKVEYKSPPPP---YVYSSPPPP-PYYSPSPKVDYKSPPPP---YVYSSPPPPPY 137

Query: 272 ------VKHYSPPP--VYHSPPPP 319
                 V++ SPPP  VY+SPPPP
Sbjct: 138 YSPSPKVEYKSPPPPYVYNSPPPP 161

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/118 (44%), Positives = 61/118 (51%), Gaps = 21/118 (17%)
 Frame = +2

Query: 47  YHSPPPPKKH---YVYKSPPPPVKHYSPPPVYHSPPPP--------------KKHYVYKS 175
           Y SPP  +K+   +  KSP PP  +    P Y +PP P               K Y+Y S
Sbjct: 23  YESPPTTQKYPPVHKTKSPYPPKMN---SPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSS 79

Query: 176 PPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVY 337
           PPP   +YSP P   Y SPPPP   YVY SPPPP  +YSP P   Y SPPPP   YVY
Sbjct: 80  PPPS-SYYSPSPKVEYKSPPPP---YVYSSPPPP-PYYSPSPKVDYKSPPPP---YVY 129

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 40/99 (40%), Positives = 45/99 (45%), Gaps = 12/99 (12%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYH--SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 250
           Y Y+SPP   K+   PPV+   SP PPK +  Y S PP     SPPP Y    P      
Sbjct: 21  YPYESPPTTQKY---PPVHKTKSPYPPKMNSPYYSAPP-----SPPPQYRRQGPK----- 67

Query: 251 YKSPPPPVKHYSPPP----------VYHSPPPPKKHYVY 337
           Y   P P  + SPPP           Y SPPPP   YVY
Sbjct: 68  YTPHPKPYIYSSPPPSSYYSPSPKVEYKSPPPP---YVY 103

[74][TOP]
>UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis
           thaliana RepID=Q9XIL9_ARATH
          Length = 727

 Score =  120 bits (300), Expect = 6e-26
 Identities = 65/110 (59%), Positives = 69/110 (62%), Gaps = 5/110 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-----YSPPPVYHSPPPPKKHYVY 169
           SPPPPV  +SPPP  HSPPPP    VY  PPPPV       +SPPP  HSPPPP    VY
Sbjct: 565 SPPPPV--HSPPPPVHSPPPP----VYSPPPPPVHSPPPPVHSPPPPVHSPPPP----VY 614

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             PPPP  H  PPPV+ SPPPP       SPPPPV  YSPPP  +SPPPP
Sbjct: 615 SPPPPPPVHSPPPPVF-SPPPP-----VHSPPPPV--YSPPPPVYSPPPP 656

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/108 (59%), Positives = 66/108 (61%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP   +SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP       SPPP
Sbjct: 535 SPPPPPPVHSPPPPVHSPPPP-----VHSPPPPV--HSPPPPVHSPPPP-----VHSPPP 582

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PV    PPPV HSPPPP       SPPPPV H  PPPVY  PPPP  H
Sbjct: 583 PVYSPPPPPV-HSPPPP-----VHSPPPPV-HSPPPPVYSPPPPPPVH 623

 Score =  117 bits (293), Expect = 4e-25
 Identities = 65/119 (54%), Positives = 70/119 (58%), Gaps = 14/119 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP--VYHSPPPPKKHY------VYKSPPPPVKH------YSPPPVYHSP 142
           SPPPP   +SPPP  VY  PPPP  +       VY  PPPP  H      +SPPP  HSP
Sbjct: 500 SPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSP 559

Query: 143 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPP       SPPPPV  +SPPP  HSPPPP    VY  PPPPV  +SPPP  HSPPPP
Sbjct: 560 PPP-----VHSPPPPV--HSPPPPVHSPPPP----VYSPPPPPV--HSPPPPVHSPPPP 605

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/110 (58%), Positives = 68/110 (61%), Gaps = 4/110 (3%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKKHYVY 169
           +SPPPP  H  PPP   HSPPPP  +    SPPPP   YSPPP   VY  PPPP  H   
Sbjct: 491 RSPPPPPVHSPPPPSPIHSPPPPPVY----SPPPPPPVYSPPPPPPVYSPPPPPPVH--- 543

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            SPPPPV  +SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 544 -SPPPPV--HSPPPPVHSPPPP-----VHSPPPPV--HSPPPPVHSPPPP 583

 Score =  113 bits (283), Expect = 6e-24
 Identities = 65/118 (55%), Positives = 69/118 (58%), Gaps = 13/118 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  +SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP    VY  PPP
Sbjct: 544 SPPPPV--HSPPPPVHSPPPP-----VHSPPPPV--HSPPPPVHSPPPP----VYSPPPP 590

Query: 185 PVKH-----YSPPPVYHSPPPPKKHYVYKSPPPPVKH--------YSPPPVYHSPPPP 319
           PV       +SPPP  HSPPPP    VY  PPPP           +SPPP  HSPPPP
Sbjct: 591 PVHSPPPPVHSPPPPVHSPPPP----VYSPPPPPP--VHSPPPPVFSPPPPVHSPPPP 642

 Score =  103 bits (258), Expect = 5e-21
 Identities = 63/107 (58%), Positives = 65/107 (60%), Gaps = 3/107 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV H  PPPVY  PPPP  H    SPPPPV  +SPPP  HSPPPP    VY SPPP
Sbjct: 601 SPPPPV-HSPPPPVYSPPPPPPVH----SPPPPV--FSPPPPVHSPPPP----VY-SPPP 648

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP---PVYHSPPP 316
           PV    PPPV   PPPP    VY  P  P K  SPP   PV +SPPP
Sbjct: 649 PVYSPPPPPVKSPPPPP----VYSPPLLPPKMSSPPTQTPV-NSPPP 690

 Score =  101 bits (252), Expect = 2e-20
 Identities = 60/116 (51%), Positives = 63/116 (54%), Gaps = 10/116 (8%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVY--HSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHY-- 163
           K  P P   Y   PV    SPPPP  H    SPPPP   +SPPP  VY  PPPP  +   
Sbjct: 473 KESPQPNDPYDQSPVKFRRSPPPPPVH----SPPPPSPIHSPPPPPVYSPPPPPPVYSPP 528

Query: 164 ----VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               VY  PPPP  H SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 529 PPPPVYSPPPPPPVH-SPPPPVHSPPPP-----VHSPPPPV--HSPPPPVHSPPPP 576

 Score =  101 bits (251), Expect = 3e-20
 Identities = 63/123 (51%), Positives = 68/123 (55%), Gaps = 18/123 (14%)
 Frame = +2

Query: 5   SPP--PPVKHYSPPPVYHSPPPPKKH------------YVYKSPPPPVKHYSPPPV-YHS 139
           SPP  PPV H +P PV H P PPK+                +SPPPP  H  PPP   HS
Sbjct: 452 SPPTSPPV-HSTPSPV-HKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHS 509

Query: 140 PPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 310
           PPPP  +    SPPPP   YSPPP   VY  PPPP  H    SPPPPV  +SPPP  HSP
Sbjct: 510 PPPPPVY----SPPPPPPVYSPPPPPPVYSPPPPPPVH----SPPPPV--HSPPPPVHSP 559

Query: 311 PPP 319
           PPP
Sbjct: 560 PPP 562

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 54/115 (46%), Positives = 59/115 (51%), Gaps = 10/115 (8%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY--HSPPPPKKHYVYKSP 178
           SPPP     + PPV+ +P P  K    K  P P   Y   PV    SPPPP  H    SP
Sbjct: 446 SPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVH----SP 501

Query: 179 PPPVKHYSPPP--VYHSPPPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPP 319
           PPP   +SPPP  VY  PPPP  +       VY  PPPP  H SPPP  HSPPPP
Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVH-SPPPPVHSPPPP 555

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 57/111 (51%), Positives = 63/111 (56%), Gaps = 6/111 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  +SPPP  HSPPPP    VY SPPPPV    PPPV   PPPP    VY  P  
Sbjct: 624 SPPPPV--FSPPPPVHSPPPP----VY-SPPPPVYSPPPPPVKSPPPPP----VYSPPLL 672

Query: 185 PVKHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPP 319
           P K  SPP   PV +SPPP       ++PPP  +   PP +   Y SPPPP
Sbjct: 673 PPKMSSPPTQTPV-NSPPPRTPSQTVEAPPPSEEFIIPPFIGHQYASPPPP 722

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 59/136 (43%), Positives = 67/136 (49%), Gaps = 27/136 (19%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVY--HSPPPPKK--HYVYKSPPP-------PVKHYSPPPVYHSPPP 148
           K  P P   Y+  PV    SPPPP++  H+V  SPPP       P  H +P PV H P P
Sbjct: 413 KESPQPNDPYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPV-HKPQP 471

Query: 149 PKKH------------YVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSP 289
           PK+                +SPPPP  H  PPP   HSPPPP  +    SPPPP   YSP
Sbjct: 472 PKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVY----SPPPPPPVYSP 527

Query: 290 PP---VYHSPPPPKKH 328
           PP   VY  PPPP  H
Sbjct: 528 PPPPPVYSPPPPPPVH 543

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 52/131 (39%), Positives = 60/131 (45%), Gaps = 26/131 (19%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPVY--HSPPPPKK--HYV 166
           S   P K  SP P    H P PPK+       P P   Y+  PV    SPPPP++  H+V
Sbjct: 390 SQATPSKSPSPVPTRPVHKPQPPKES------PQPNDPYNQSPVKFRRSPPPPQQPHHHV 443

Query: 167 YKSPPP-------PVKHYSPPPVYHSPPPPKKH------------YVYKSPPPPVKHYSP 289
             SPPP       P  H +P PV H P PPK+                +SPPPP  H  P
Sbjct: 444 VHSPPPASSPPTSPPVHSTPSPV-HKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPP 502

Query: 290 PP-VYHSPPPP 319
           PP   HSPPPP
Sbjct: 503 PPSPIHSPPPP 513

[75][TOP]
>UniRef100_Q6GUG3 Serine/proline-rich repeat protein n=2 Tax=Lupinus angustifolius
           RepID=Q6GUG3_LUPAN
          Length = 198

 Score =  120 bits (300), Expect = 6e-26
 Identities = 63/111 (56%), Positives = 66/111 (59%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   YV KSPPPP     PP +Y SPPPP       SP P
Sbjct: 88  SPPPPYLYKSPPPPSPSPPPP---YVNKSPPPPSSSPPPPYIYKSPPPPSPSPPPPSPSP 144

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           P    SPPP   SPPPP   YVYKSPPPP    SPPP   SPPPP   Y+Y
Sbjct: 145 PPPSPSPPPPSPSPPPP---YVYKSPPPPSP--SPPPPSPSPPPPYHPYLY 190

 Score =  118 bits (296), Expect = 2e-25
 Identities = 65/123 (52%), Positives = 68/123 (55%), Gaps = 10/123 (8%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP--VYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH- 160
           +SPPPP    SPPP  VY SPPPP       Y YKSPPPP     PP +Y SPPPP    
Sbjct: 46  QSPPPPSPSPSPPPPYVYKSPPPPSPSPPPPYAYKSPPPPSPSPPPPYLYKSPPPPSPSP 105

Query: 161 ---YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
              YV KSPPPP     PP +Y SPPPP       SP PP    SPPP   SPPPP   Y
Sbjct: 106 PPPYVNKSPPPPSSSPPPPYIYKSPPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPP---Y 162

Query: 332 VYK 340
           VYK
Sbjct: 163 VYK 165

 Score =  112 bits (280), Expect = 1e-23
 Identities = 60/111 (54%), Positives = 63/111 (56%), Gaps = 8/111 (7%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSP 178
           PP   + SPPP   SP PP   YVYKSPPPP     PP  Y SPPPP       Y+YKSP
Sbjct: 40  PPSYYYQSPPPPSPSPSPPPP-YVYKSPPPPSPSPPPPYAYKSPPPPSPSPPPPYLYKSP 98

Query: 179 PPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPP     PP V  SPPPP       Y+YKSPPPP    SPPP   SPPPP
Sbjct: 99  PPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPPPPSP--SPPPPSPSPPPP 147

 Score =  107 bits (268), Expect = 3e-22
 Identities = 60/110 (54%), Positives = 62/110 (56%), Gaps = 5/110 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   Y+YKSPPPP    SPPP   SPPPP       SPPP
Sbjct: 104 SPPPPYVNKSPPPPSSSPPPP---YIYKSPPPPSP--SPPPPSPSPPPPS-----PSPPP 153

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-----SPPPP 319
           P     PP VY SPPPP       SP PP    SPPP YH     SPPPP
Sbjct: 154 PSPSPPPPYVYKSPPPP-------SPSPPPPSPSPPPPYHPYLYSSPPPP 196

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/103 (52%), Positives = 58/103 (56%), Gaps = 10/103 (9%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKH----YVYKSPPPPVKHYS 202
           P Y+  PP    Y Y+SPPPP    SPPP  VY SPPPP       Y YKSPPPP     
Sbjct: 34  PYYYYQPPS---YYYQSPPPPSPSPSPPPPYVYKSPPPPSPSPPPPYAYKSPPPPSPSPP 90

Query: 203 PPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP +Y SPPPP       YV KSPPPP     PP +Y SPPPP
Sbjct: 91  PPYLYKSPPPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPPPP 133

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 46/95 (48%), Positives = 50/95 (52%), Gaps = 15/95 (15%)
 Frame = +2

Query: 101 PVKHYSPPPVYH-SPPPPKKH------YVYKSPPPPVKHYSPPPVYHSPPPPKKH----Y 247
           P  +Y PP  Y+ SPPPP         YVYKSPPPP     PP  Y SPPPP       Y
Sbjct: 34  PYYYYQPPSYYYQSPPPPSPSPSPPPPYVYKSPPPPSPSPPPPYAYKSPPPPSPSPPPPY 93

Query: 248 VYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 340
           +YKSPPPP     PP V  SPPPP       Y+YK
Sbjct: 94  LYKSPPPPSPSPPPPYVNKSPPPPSSSPPPPYIYK 128

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 37/64 (57%), Positives = 39/64 (60%), Gaps = 2/64 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH--YVYKSP 178
           SP PP    SPPP   SPPPP   YVYKSPPPP    SP P   SP PP  +  Y+Y SP
Sbjct: 141 SPSPPPPSPSPPPPSPSPPPP---YVYKSPPPP----SPSPPPPSPSPPPPYHPYLYSSP 193

Query: 179 PPPV 190
           PPPV
Sbjct: 194 PPPV 197

[76][TOP]
>UniRef100_Q2A9D2 Extensin-like region containing protein n=1 Tax=Brassica oleracea
           RepID=Q2A9D2_BRAOL
          Length = 347

 Score =  120 bits (300), Expect = 6e-26
 Identities = 74/129 (57%), Positives = 78/129 (60%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV----------YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPP 145
           KSPPPP  + SPPP           Y SPPPP   YVY SPPPP  +YSP P   Y SPP
Sbjct: 229 KSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPP---YVYSSPPPP-PYYSPSPKVDYKSPP 284

Query: 146 PPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPP 313
           PP   YVY SPPPP  +YSP P   Y SPPPP   YVY SPPPP  +YSP P   Y SPP
Sbjct: 285 PP---YVYSSPPPP-PYYSPSPKVDYKSPPPP---YVYSSPPPP-PYYSPSPKVYYKSPP 336

Query: 314 PPKKHYVYK 340
           PP   YVYK
Sbjct: 337 PPP--YVYK 343

 Score =  112 bits (280), Expect = 1e-23
 Identities = 68/130 (52%), Positives = 73/130 (56%), Gaps = 24/130 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----------VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPP 145
           KSPPPP  + SPPP           Y SPPPP   Y+Y SPPPP  +YSP P   Y SPP
Sbjct: 99  KSPPPPYVYSSPPPPPYYSPSLKVEYKSPPPP---YLYNSPPPP-PYYSPSPKAEYKSPP 154

Query: 146 PPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPP----------VKHYSP 289
           PP   YVY  PPPP  +YSP P   Y SPPPP   YVY SPPPP           K   P
Sbjct: 155 PP---YVYSYPPPP-PYYSPSPKVEYKSPPPP---YVYSSPPPPPYYSPSPKVEYKSQPP 207

Query: 290 PPVYHSPPPP 319
           P VY+SPPPP
Sbjct: 208 PYVYNSPPPP 217

 Score =  111 bits (277), Expect = 3e-23
 Identities = 69/145 (47%), Positives = 76/145 (52%), Gaps = 33/145 (22%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-VKHYSPPPVYHSPPP------PKKH 160
           KSPPPP  + SPPP  +  P PK  Y  KSPPPP V  Y PPP Y+SP P      P   
Sbjct: 125 KSPPPPYLYNSPPPPPYYSPSPKAEY--KSPPPPYVYSYPPPPPYYSPSPKVEYKSPPPP 182

Query: 161 YVYKSPPPPVKHYSPPP-----------VYHSPPPPKKH-----YVYKSPPPPVKHYSPP 292
           YVY SPPPP  +YSP P           VY+SPPPP  +       YKSPPPP  + SPP
Sbjct: 183 YVYSSPPPP-PYYSPSPKVEYKSQPPPYVYNSPPPPPYYSPLPKVEYKSPPPPYVYSSPP 241

Query: 293 PV----------YHSPPPPKKHYVY 337
           P           Y SPPPP   YVY
Sbjct: 242 PPPYYSPSPKVDYKSPPPP---YVY 263

 Score =  110 bits (276), Expect = 4e-23
 Identities = 72/146 (49%), Positives = 80/146 (54%), Gaps = 34/146 (23%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV-YHSPPPPKKH------YVYKSPPPPVKHYSPPPV--YHSPPPPK 154
           KSPPPP  + SPPP  Y+SP P  ++      YVY SPPPP  +YSP P   Y SPPPP 
Sbjct: 177 KSPPPPYVYSSPPPPPYYSPSPKVEYKSQPPPYVYNSPPPP-PYYSPLPKVEYKSPPPP- 234

Query: 155 KHYVYKSPPPP--------VKHYSPPP--VYHSPPPPKKH-----YVYKSPPPPVKHYSP 289
             YVY SPPPP        V + SPPP  VY SPPPP  +       YKSPPPP  + SP
Sbjct: 235 --YVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSP 292

Query: 290 PPV----------YHSPPPPKKHYVY 337
           PP           Y SPPPP   YVY
Sbjct: 293 PPPPYYSPSPKVDYKSPPPP---YVY 315

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 57/101 (56%), Positives = 60/101 (59%), Gaps = 14/101 (13%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV----------YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPP 145
           KSPPPP  + SPPP           Y SPPPP   YVY SPPPP  +YSP P   Y SPP
Sbjct: 255 KSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPP---YVYSSPPPP-PYYSPSPKVDYKSPP 310

Query: 146 PPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSP 262
           PP   YVY SPPPP  +YSP P   Y SPPPP   YVYK P
Sbjct: 311 PP---YVYSSPPPP-PYYSPSPKVYYKSPPPPP--YVYKKP 345

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 56/112 (50%), Positives = 61/112 (54%), Gaps = 14/112 (12%)
 Frame = +2

Query: 44  VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKH-----YVYKSPPPPVKHYS 202
           VY SPP P     Y SP P V + SPPP  VY SPPPP  +       YKSPPPP  + S
Sbjct: 80  VYSSPPLPP----YYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSLKVEYKSPPPPYLYNS 135

Query: 203 PPPVYHSPPPPKKHYVYKSPPPP-VKHYSPPPVYHSPPP------PKKHYVY 337
           PPP  +  P PK    YKSPPPP V  Y PPP Y+SP P      P   YVY
Sbjct: 136 PPPPPYYSPSPKAE--YKSPPPPYVYSYPPPPPYYSPSPKVEYKSPPPPYVY 185

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 12/65 (18%)
 Frame = +2

Query: 161 YVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPP--------VKHYSPPP--VYH 304
           YVY SPP P  +YSP P   Y SPPPP   YVY SPPPP        V++ SPPP  +Y+
Sbjct: 79  YVYSSPPLP-PYYSPSPKVDYKSPPPP---YVYSSPPPPPYYSPSLKVEYKSPPPPYLYN 134

Query: 305 SPPPP 319
           SPPPP
Sbjct: 135 SPPPP 139

[77][TOP]
>UniRef100_Q76KW4 Hydroxyproline-rich glycoprotein-1 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW4_PEA
          Length = 152

 Score =  119 bits (298), Expect = 1e-25
 Identities = 68/114 (59%), Positives = 68/114 (59%), Gaps = 17/114 (14%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV----YHSPPPPKKHY------VYKSPPPPVKHY-SPPPVYHSPPPP 151
           SPPPPV H  PPP     Y SPPPP  H       VY SPPPPV  Y  P PVYHSPPPP
Sbjct: 37  SPPPPV-HSPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPP 95

Query: 152 ---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP-KKHYVYKSPPPPVKHYSPPP 295
              KK Y Y SPPPP  H    P PVYHSPPPP KK Y Y SPPPP  H  P P
Sbjct: 96  TPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHP 149

 Score =  107 bits (266), Expect = 5e-22
 Identities = 62/104 (59%), Positives = 62/104 (59%), Gaps = 17/104 (16%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPV----YHSPPPPKKHY------VYKSPPPPVKHY-SPPPVYHS 223
           Y Y SPPPPV H  PPP     Y SPPPP  H       VY SPPPPV  Y  P PVYHS
Sbjct: 33  YSYSSPPPPV-HSPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPVHTYPHPHPVYHS 91

Query: 224 PPPP---KKHYVYKSPPPPVKHY--SPPPVYHSPPPP-KKHYVY 337
           PPPP   KK Y Y SPPPP  H    P PVYHSPPPP KK Y Y
Sbjct: 92  PPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKY 135

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/78 (51%), Positives = 41/78 (52%), Gaps = 18/78 (23%)
 Frame = +2

Query: 5   SPPPPVKHYSPP-PVYHSPPPP---KKHYVYKSPPPPVKHY--SPPPVYHSP-------- 142
           SPPPPV  Y  P PVYHSPPPP   KK Y Y SPPPP  H    P PVYHSP        
Sbjct: 74  SPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPY 133

Query: 143 ----PPPKKHYVYKSPPP 184
               PPP   + Y  P P
Sbjct: 134 KYSSPPPPPVHTYPHPSP 151

[78][TOP]
>UniRef100_O65375 F12F1.9 protein n=1 Tax=Arabidopsis thaliana RepID=O65375_ARATH
          Length = 744

 Score =  119 bits (298), Expect = 1e-25
 Identities = 68/127 (53%), Positives = 71/127 (55%), Gaps = 19/127 (14%)
 Frame = +2

Query: 8   PPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVY 169
           PPPP    SPPP  VY SPPPP   YVY SPPPP   YS PP    VY SPPPP   YVY
Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPP---YVYSSPPPPPYVYSSPPPPPYVYSSPPPP---YVY 510

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP-------------PPVYHSP 310
            SPPPP  + SPPP   SPPPP       SPPPPV +Y+P             PPV  SP
Sbjct: 511 SSPPPPYVYSSPPPPPPSPPPPCPE---SSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSP 567

Query: 311 PPPKKHY 331
           PPP   Y
Sbjct: 568 PPPSPVY 574

 Score =  114 bits (285), Expect = 3e-24
 Identities = 69/130 (53%), Positives = 72/130 (55%), Gaps = 21/130 (16%)
 Frame = +2

Query: 5   SPPPP--------VKHYSPPPVYH-SPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPP 148
           SPPPP        V+ Y PPP    SPPPP   YVY SPPPP  + SPPP   VY SPPP
Sbjct: 440 SPPPPPYSKMSPSVRAYPPPPPPSPSPPPP---YVYSSPPPPYVYSSPPPPPYVYSSPPP 496

Query: 149 PKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPP-------PVY 301
           P   YVY SPPPP  + SPPP  VY SPPPP       SPPPP    SPP       PV 
Sbjct: 497 PP--YVYSSPPPPYVYSSPPPPYVYSSPPPPP-----PSPPPPCPESSPPPPVVYYAPVT 549

Query: 302 HSPPPPKKHY 331
            SPPPP   Y
Sbjct: 550 QSPPPPSPVY 559

 Score =  111 bits (277), Expect = 3e-23
 Identities = 67/133 (50%), Positives = 70/133 (52%), Gaps = 24/133 (18%)
 Frame = +2

Query: 5   SPPPP--------VKHYSPPP-----------VYHSPPPPKKHYVYKSPPPPVKHYSPPP 127
           SPPPP        V+ YSPPP            Y  PPPP       SPPPP  + SPPP
Sbjct: 423 SPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSP-----SPPPPYVYSSPPP 477

Query: 128 --VYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPP 292
             VY SPPPP   YVY SPPPP   YS PP   VY SPPPP   YVY SPPPP     PP
Sbjct: 478 PYVYSSPPPPP--YVYSSPPPPPYVYSSPPPPYVYSSPPPP---YVYSSPPPPPPSPPPP 532

Query: 293 PVYHSPPPPKKHY 331
               SPPPP  +Y
Sbjct: 533 CPESSPPPPVVYY 545

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/115 (53%), Positives = 65/115 (56%), Gaps = 7/115 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKS 175
           PPPP  + SPPP  VY SPPPP   YVY SPPPP     PP    SPPPP  +Y  V +S
Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPP---YVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQS 551

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           PPPP   Y  PPV  SPPPP   Y   V  SPPPP   Y PP  Y  PPP   +Y
Sbjct: 552 PPPPSPVYY-PPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYY 605

 Score =  103 bits (257), Expect = 6e-21
 Identities = 70/148 (47%), Positives = 73/148 (49%), Gaps = 37/148 (25%)
 Frame = +2

Query: 5   SPPPPVKHYSP------PP--VYHSPPPPKKHYV------YKSPPPP-------VKHYSP 121
           SPPPP    SP      PP  VY SPPPP    +      Y  PPPP       V+ YSP
Sbjct: 382 SPPPPTFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSP 441

Query: 122 PP-----------VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSP 262
           PP            Y  PPPP       SPPPP  + SPPP  VY SPPPP   YVY SP
Sbjct: 442 PPPPYSKMSPSVRAYPPPPPPSP-----SPPPPYVYSSPPPPYVYSSPPPPP--YVYSSP 494

Query: 263 PPPVKHYSPPP---VYHSPPPPKKHYVY 337
           PPP   YS PP   VY SPPPP   YVY
Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPP---YVY 519

 Score =  103 bits (257), Expect = 6e-21
 Identities = 61/127 (48%), Positives = 65/127 (51%), Gaps = 18/127 (14%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP-------------PPVYHSPP 145
           SPPPP  + SPPP   SPPPP       SPPPPV +Y+P             PPV  SPP
Sbjct: 512 SPPPPYVYSSPPPPPPSPPPPCPE---SSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPP 568

Query: 146 PPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVYHSP 310
           PP   Y   V  SPPPP   Y PP  Y  PPP   +Y  V  SPPPP   Y  PPV  SP
Sbjct: 569 PPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYY-PPVTPSP 627

Query: 311 PPPKKHY 331
           PPP   Y
Sbjct: 628 PPPSPVY 634

 Score =  102 bits (253), Expect = 2e-20
 Identities = 65/144 (45%), Positives = 71/144 (49%), Gaps = 35/144 (24%)
 Frame = +2

Query: 5   SPPPPVKHYSP-------------PPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYH 136
           SPPPPV +Y+P             PPV  SPPPP   Y   V  SPPPP   Y PP  Y 
Sbjct: 537 SPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYS 596

Query: 137 SPPPPKKHY--VYKSPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPP--- 292
            PPP   +Y  V  SPPPP   Y  PPV  SPPPP   Y   V  SPPPP   Y PP   
Sbjct: 597 PPPPSPVYYPQVTPSPPPPSPLYY-PPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTP 655

Query: 293 ------PVYH-----SPPPPKKHY 331
                 PVY+     SPPPP ++Y
Sbjct: 656 SPPPPSPVYYPSETQSPPPPTEYY 679

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 59/140 (42%), Positives = 62/140 (44%), Gaps = 35/140 (25%)
 Frame = +2

Query: 5   SPPPPVKHYSPP---------PVYH-----SPPPPKKHY---VYKSPPPPVKHYSPPPVY 133
           SPPPP   Y PP         PVY+     SPPPP   Y   V  SPPPP   Y  PPV 
Sbjct: 581 SPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYY-PPVT 639

Query: 134 HSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK--------- 277
            SPPPP   Y   V  SPPPP   Y P      PPP + +Y     PPP K         
Sbjct: 640 PSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQ 699

Query: 278 ---HYSPPPVY---HSPPPP 319
               Y PPP Y    SPPPP
Sbjct: 700 ATPSYEPPPEYSYSSSPPPP 719

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 57/143 (39%), Positives = 64/143 (44%), Gaps = 34/143 (23%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPP---------PVYH---- 136
            SPPPP   Y PP V  SPPPP   Y   V  SPPPP   Y PP         PVY+    
Sbjct: 611  SPPPPSPLYYPP-VTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSET 669

Query: 137  -SPPPPKKHYVYKSP-PPPVK------------HYSPPPVY-HSPPPPKKHYVYKSPPPP 271
             SPPPP ++Y   S  PPP K             Y PPP Y +S  PP        PP P
Sbjct: 670  QSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPP--------PPSP 721

Query: 272  VKHYSPPPVYH---SPPPPKKHY 331
              ++ P P      SPPPP  +Y
Sbjct: 722  TSYFPPMPSVSYDASPPPPPSYY 744

[79][TOP]
>UniRef100_Q09085 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q09085_PHAVU
          Length = 368

 Score =  118 bits (296), Expect = 2e-25
 Identities = 65/130 (50%), Positives = 66/130 (50%), Gaps = 18/130 (13%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-------- 160
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP           
Sbjct: 201 SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPP 257

Query: 161 --YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPK 322
             Y YKSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP 
Sbjct: 258 PPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 317

Query: 323 KH----YVYK 340
                 Y YK
Sbjct: 318 PDPPTPYYYK 327

 Score =  117 bits (294), Expect = 3e-25
 Identities = 69/131 (52%), Positives = 71/131 (54%), Gaps = 19/131 (14%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKH---YVYKSPPPPVKH-YSPPPVYHSPPPPKKH---- 160
           SPPPP  + SPP  Y SPPPP      Y YKSPPPP K  Y PP  Y SPPPP       
Sbjct: 114 SPPPPYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPP 173

Query: 161 YVYKSPPPP-----VKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           Y YKSPPPP       +Y  SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP
Sbjct: 174 YYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPP 230

Query: 320 KKH----YVYK 340
                  Y YK
Sbjct: 231 SPSPPPPYYYK 241

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/127 (50%), Positives = 66/127 (51%), Gaps = 18/127 (14%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP---PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----Y 163
           SPPPP  + SPPP   SPPP   P   Y YKSPPPP     PP  Y SPPPP       Y
Sbjct: 233 SPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPY 292

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVK-------HYSPPPVYHSP 310
            YKSPPPP     PP  Y SPPPP       Y YKSPPPP         + SPPP   SP
Sbjct: 293 YYKSPPPPSPSPPPPYYYKSPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVSPPPPTKSP 352

Query: 311 PPPKKHY 331
           PPP   Y
Sbjct: 353 PPPAYSY 359

 Score =  116 bits (291), Expect = 7e-25
 Identities = 63/126 (50%), Positives = 63/126 (50%), Gaps = 18/126 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----------YVYKSPPPPVKHYSPPPVYHSPPPP 151
           KSPPPP     PP  Y SPPPP             Y YKSPPPP     PP  Y SPPPP
Sbjct: 225 KSPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPP 284

Query: 152 KKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHS 307
                  Y YKSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y S
Sbjct: 285 SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVS 344

Query: 308 PPPPKK 325
           PPPP K
Sbjct: 345 PPPPTK 350

 Score =  115 bits (289), Expect = 1e-24
 Identities = 65/135 (48%), Positives = 65/135 (48%), Gaps = 22/135 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH--- 160
           KSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP      
Sbjct: 161 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPP 220

Query: 161 -YVYKSPPPPVKHYSPPPVYHSPPPPKKH----------YVYKSPPPPVKHYSPPPVYHS 307
            Y YKSPPPP     PP  Y SPPPP             Y YKSPPPP     PP  Y S
Sbjct: 221 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKS 280

Query: 308 PPPPKKH----YVYK 340
           PPPP       Y YK
Sbjct: 281 PPPPSPSPPPPYYYK 295

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/120 (53%), Positives = 65/120 (54%), Gaps = 14/120 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYH-SPPPPKKH-----YVYKSPPPPVKHYSPPPVYHSPPPPKKH- 160
           KSPPPP    SP P Y+ SPPPP K      Y YKSPPPP     PP  Y SPPPP    
Sbjct: 129 KSPPPPSP--SPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSP 186

Query: 161 ---YVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
              Y YKSPPPP     PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP
Sbjct: 187 PPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 246

 Score =  114 bits (285), Expect = 3e-24
 Identities = 65/119 (54%), Positives = 67/119 (56%), Gaps = 14/119 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH----YVYK 172
           SPPPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       Y YK
Sbjct: 255 SPPPPYYYKSPPPPDPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 311

Query: 173 SPPPPVK-------HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPP 319
           SPPPP         + SPPP   SPPPP   Y Y SPPPP K  SPPP    Y SPPPP
Sbjct: 312 SPPPPSPDPPTPYYYKSPPPPSPSPPPP---YYYVSPPPPTK--SPPPPAYSYASPPPP 365

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/109 (53%), Positives = 59/109 (54%), Gaps = 8/109 (7%)
 Frame = +2

Query: 17  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK---KHYVYKSPPPP 187
           P K Y      HSP P  K Y Y SPPPP  + SPP  Y SPPPP      Y YKSPPPP
Sbjct: 90  PKKPYDCEKHKHSPTPYHKPYYYNSPPPPYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPP 149

Query: 188 VKH-YSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPP 319
            K  Y PP  Y SPPPP       Y YKSPPPP     PP  Y SPPPP
Sbjct: 150 HKDPYYPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 198

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/96 (47%), Positives = 47/96 (48%), Gaps = 8/96 (8%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK---KHY 247
           Y  K P    KH   P  YH P      Y Y SPPPP  + SPP  Y SPPPP      Y
Sbjct: 88  YAPKKPYDCEKHKHSPTPYHKP------YYYNSPPPPYYYKSPPYYYKSPPPPSPSPSPY 141

Query: 248 VYKSPPPPVKH-YSPPPVYHSPPPPKKH----YVYK 340
            YKSPPPP K  Y PP  Y SPPPP       Y YK
Sbjct: 142 YYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYYYK 177

[80][TOP]
>UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RZI2_RICCO
          Length = 829

 Score =  118 bits (296), Expect = 2e-25
 Identities = 63/111 (56%), Positives = 68/111 (61%), Gaps = 6/111 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  +SPPP  +SPPPP       SPPPPV  +SPPP  HSPPPP    VY  PPP
Sbjct: 674 SPPPPV--HSPPPPVYSPPPPSPPPPVHSPPPPV--HSPPPPVHSPPPP----VYSPPPP 725

Query: 185 ------PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                 P  H  PPPVY  PPPP      +SPPPPV  +SPPP  HSPPPP
Sbjct: 726 SPPSPPPPMHSPPPPVYSPPPPP-----VRSPPPPV--HSPPPPVHSPPPP 769

 Score =  116 bits (291), Expect = 7e-25
 Identities = 63/106 (59%), Positives = 67/106 (63%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  +SPPP  HSPPPP    VY  PPP     SPPP  HSPPPP    VY  PPP
Sbjct: 700 SPPPPV--HSPPPPVHSPPPP----VYSPPPPSPP--SPPPPMHSPPPP----VYSPPPP 747

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           PV+  SPPP  HSPPPP       SPPPP+  YSPPP   SPPPP+
Sbjct: 748 PVR--SPPPPVHSPPPP-----VHSPPPPI--YSPPPPRFSPPPPR 784

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/111 (57%), Positives = 66/111 (59%), Gaps = 6/111 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP       SPPP
Sbjct: 669 SPPPP----SPPPPVHSPPPPVYSPPPPSPPPPV--HSPPPPVHSPPPP-----VHSPPP 717

Query: 185 PV------KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV         SPPP  HSPPPP    VY  PPPPV+  SPPP  HSPPPP
Sbjct: 718 PVYSPPPPSPPSPPPPMHSPPPP----VYSPPPPPVR--SPPPPVHSPPPP 762

 Score =  108 bits (270), Expect = 2e-22
 Identities = 58/106 (54%), Positives = 64/106 (60%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPP     SP P   SPPPP +     SPPPPV   SPPP  +SPPPP       SPP
Sbjct: 631 QSPPPTTPEQSPSPPGQSPPPPTQ-----SPPPPVN--SPPPPVYSPPPP-------SPP 676

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV  +SPPP  +SPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 677 PPV--HSPPPPVYSPPPPSPPPPVHSPPPPV--HSPPPPVHSPPPP 718

 Score =  107 bits (268), Expect = 3e-22
 Identities = 61/109 (55%), Positives = 66/109 (60%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPPV   SPPP  +SPPPP       SPPPPV  +SPPP  +SPPPP       SPP
Sbjct: 654 QSPPPPVN--SPPPPVYSPPPP-------SPPPPV--HSPPPPVYSPPPP-------SPP 695

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PPV  +SPPP  HSPPPP       SPPPPV  YSPPP     PPP  H
Sbjct: 696 PPV--HSPPPPVHSPPPP-----VHSPPPPV--YSPPPPSPPSPPPPMH 735

 Score =  104 bits (260), Expect = 3e-21
 Identities = 57/104 (54%), Positives = 61/104 (58%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP  HSPPPP    VY  PPPPV+  SPPP  HSPPPP       SPPP
Sbjct: 721 SPPPPSPP-SPPPPMHSPPPP----VYSPPPPPVR--SPPPPVHSPPPP-----VHSPPP 768

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           P+  YSPPP   SPPPP+      SPPPP     P P   +PPP
Sbjct: 769 PI--YSPPPPRFSPPPPR-----FSPPPPTSSPPPTPTVAAPPP 805

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/116 (50%), Positives = 65/116 (56%), Gaps = 11/116 (9%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP+ H  PPPVY  PPPP      +SPPPPV  +SPPP  HSPPPP    +Y SPPP
Sbjct: 729  SPPPPM-HSPPPPVYSPPPPP-----VRSPPPPV--HSPPPPVHSPPPP----IY-SPPP 775

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-----------VYHSPPPP 319
            P   +SPPP   SPPPP       SPPP     +PPP            Y SPPPP
Sbjct: 776  P--RFSPPPPRFSPPPPT-----SSPPPTPTVAAPPPEDFILPPNIGFQYSSPPPP 824

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 51/108 (47%), Positives = 57/108 (52%), Gaps = 3/108 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SP  P+   + P +  SP PP +     SPPP     SP P   SPPPP +     SPPP
Sbjct: 609 SPESPLSSPTSPTLEQSPSPPGQ-----SPPPTTPEQSPSPPGQSPPPPTQ-----SPPP 658

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPV---KHYSPPPVYHSPPPP 319
           PV   SPPP  +SPPPP       SPPPPV      SPPP  HSPPPP
Sbjct: 659 PVN--SPPPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPP 704

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/91 (50%), Positives = 53/91 (58%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPPV  +SPPP  HSPPPP    +Y SPPPP   +SPPP   SPPPP       SPP
Sbjct: 750 RSPPPPV--HSPPPPVHSPPPP----IY-SPPPP--RFSPPPPRFSPPPPTS-----SPP 795

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
           P     +PPP      PP   + Y SPPPP+
Sbjct: 796 PTPTVAAPPP-EDFILPPNIGFQYSSPPPPM 825

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 42/105 (40%), Positives = 48/105 (45%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SP P      P P       P+      SP  P+   + P +  SP PP +     SPPP
Sbjct: 581 SPSPEYNSSEPSPTPSPESEPQSPTSTPSPESPLSSPTSPTLEQSPSPPGQ-----SPPP 635

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                SP P   SPPPP +     SPPPPV    PPPVY SPPPP
Sbjct: 636 TTPEQSPSPPGQSPPPPTQ-----SPPPPVNS-PPPPVY-SPPPP 673

[81][TOP]
>UniRef100_Q9S9A4 Extensin (Fragment) n=1 Tax=Vicia faba RepID=Q9S9A4_VICFA
          Length = 116

 Score =  118 bits (295), Expect = 2e-25
 Identities = 70/122 (57%), Positives = 70/122 (57%), Gaps = 14/122 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPP-PVYHSPPPP----KKHYVYKSPPPPVKHY--SPPPVYHSPPPP---- 151
           S PPPV  Y  P P YHSPPPP    KK Y Y SPPPP  H    P PVYHSPPPP    
Sbjct: 5   SSPPPVHTYPHPHPFYHSPPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPH 64

Query: 152 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPK 322
           KK Y Y SPPPP  H  PP   H P P     VY SPPPPV  YSPPP    Y SPPPP 
Sbjct: 65  KKPYKYPSPPPPPVHTYPP---HVPHP-----VYHSPPPPV--YSPPPPHYYYKSPPPPY 114

Query: 323 KH 328
            H
Sbjct: 115 HH 116

 Score =  111 bits (277), Expect = 3e-23
 Identities = 63/116 (54%), Positives = 64/116 (55%), Gaps = 24/116 (20%)
 Frame = +2

Query: 29  YSPPPV----------YHSPPPP----KKHYVYKSPPPPVKHY--SPPPVYHSPPPP--- 151
           YS PP           YHSPPPP    KK Y Y SPPPP  H    P PVYHSPPPP   
Sbjct: 4   YSSPPPVHTYPHPHPFYHSPPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTP 63

Query: 152 -KKHYVYKSPPPPVKHYSPP----PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
            KK Y Y SPPPP  H  PP    PVYHSPPPP    VY  PPP   + SPPP YH
Sbjct: 64  HKKPYKYPSPPPPPVHTYPPHVPHPVYHSPPPP----VYSPPPPHYYYKSPPPPYH 115

 Score =  107 bits (267), Expect = 4e-22
 Identities = 61/111 (54%), Positives = 62/111 (55%), Gaps = 22/111 (19%)
 Frame = +2

Query: 74  HYVYKSPPPPVKHYSPPPVYHSPPPP----KKHYVYKSPPPPVKHY--SPPPVYHSPPPP 235
           HY Y SPPP   +  P P YHSPPPP    KK Y Y SPPPP  H    P PVYHSPPPP
Sbjct: 1   HYSYSSPPPVHTYPHPHPFYHSPPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPP 60

Query: 236 ----KKHYVYKSPPPP------------VKHYSPPPVYHSPPPPKKHYVYK 340
               KK Y Y SPPPP            V H  PPPVY SPPPP  HY YK
Sbjct: 61  PTPHKKPYKYPSPPPPPVHTYPPHVPHPVYHSPPPPVY-SPPPP--HYYYK 108

[82][TOP]
>UniRef100_Q9LHS1 Genomic DNA, chromosome 5, TAC clone:K3D20 n=2 Tax=Arabidopsis
           thaliana RepID=Q9LHS1_ARATH
          Length = 334

 Score =  118 bits (295), Expect = 2e-25
 Identities = 65/121 (53%), Positives = 69/121 (57%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP    SP   Y SPPPP   Y
Sbjct: 102 KSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP---Y 158

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV--------KHYSPPP-VYHSPPP 316
           VY SPPPP    SP   Y SPPPP   YVY SPPPP           +SPPP VY+SP P
Sbjct: 159 VYNSPPPPYYSLSPKVDYKSPPPP---YVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSP 215

Query: 317 P 319
           P
Sbjct: 216 P 216

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/111 (57%), Positives = 64/111 (57%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY SPPP
Sbjct: 87  SPPPPYYSPSPKEDYKSPPPP---YVYNSPPPPYYSPSPKVDYKSPPPP---YVYNSPPP 140

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           P    SP   Y SPPPP   YVY SPPPP    SP   Y SPPPP   YVY
Sbjct: 141 PYYSPSPKVEYKSPPPP---YVYNSPPPPYYSLSPKVDYKSPPPP---YVY 185

 Score =  114 bits (285), Expect = 3e-24
 Identities = 70/143 (48%), Positives = 75/143 (52%), Gaps = 37/143 (25%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP------PKKHYVYKSPPPP-------VKHYSPPP--VYH 136
           KSPPPP  + SPPP Y+SP P      P   YVY SPPPP       V + SPPP  VY+
Sbjct: 127 KSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPPPYVYN 186

Query: 137 SPPPP-------------KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-- 271
           SPPPP                YVY SP PP    SP   Y SPPPP   YVY SPPPP  
Sbjct: 187 SPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPP---YVYNSPPPPYF 243

Query: 272 -----VKHYSPPP--VYHSPPPP 319
                V + SPPP  VY SPPPP
Sbjct: 244 SPSPKVDYKSPPPPYVYSSPPPP 266

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/114 (55%), Positives = 67/114 (58%), Gaps = 8/114 (7%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH------YVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSPPPP  + SPPP Y+SP P   +      YVY SP PP    SP   Y SPPPP   Y
Sbjct: 177 KSPPPPYVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPP---Y 233

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPP 319
           VY SPPPP    SP   Y SPPPP   YVY SPPPP  +YSP P   Y SPPPP
Sbjct: 234 VYNSPPPPYFSPSPKVDYKSPPPP---YVYSSPPPP-PYYSPSPEVSYKSPPPP 283

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/114 (50%), Positives = 66/114 (57%), Gaps = 9/114 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SP PP+++    P Y   P P   Y++ SPPPP    SP   Y SPPPP   YVY SPPP
Sbjct: 62  SPLPPLQYRRQGPKYTPHPKP---YLFNSPPPPYYSPSPKEDYKSPPPP---YVYNSPPP 115

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPP--VYHSPPPP 319
           P    SP   Y SPPPP   YVY SPPPP       V++ SPPP  VY+SPPPP
Sbjct: 116 PYYSPSPKVDYKSPPPP---YVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPP 166

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 57/116 (49%), Positives = 64/116 (55%), Gaps = 11/116 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSP 178
           KSPPPP  + SPPP Y SP P      YKSPPPP  + SPPP  Y+SP P      YKSP
Sbjct: 227 KSPPPPYVYNSPPPPYFSPSPKVD---YKSPPPPYVYSSPPPPPYYSPSPEVS---YKSP 280

Query: 179 PPP--------VKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           PPP        V + SPPP  VY+ PPPP     + SP P V + SPP  Y S  P
Sbjct: 281 PPPPYYSPSLEVSYKSPPPLFVYNFPPPPP----FYSPSPKVSYKSPPAPYVSKTP 332

[83][TOP]
>UniRef100_Q2A9D3 Extensin, putative n=1 Tax=Brassica oleracea RepID=Q2A9D3_BRAOL
          Length = 509

 Score =  118 bits (295), Expect = 2e-25
 Identities = 72/131 (54%), Positives = 77/131 (58%), Gaps = 24/131 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----------VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPP 145
           KSPPPP  + SPPP           Y SPPPP   YVY SPPPP  +YSP P  VY SPP
Sbjct: 313 KSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPP---YVYSSPPPP-PYYSPSPKMVYKSPP 368

Query: 146 PPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPP--------VKHYSPPP 295
           PP   YVY SPPPP  +YSP P   Y  PPPP   YVY SPPPP        V + SPPP
Sbjct: 369 PP---YVYSSPPPP-PYYSPSPKVNYKYPPPP---YVYSSPPPPPYYSPSPKVNYKSPPP 421

Query: 296 --VYHSPPPPK 322
             VY SPPPP+
Sbjct: 422 PYVYSSPPPPQ 432

 Score =  117 bits (293), Expect = 4e-25
 Identities = 71/140 (50%), Positives = 81/140 (57%), Gaps = 28/140 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYS-PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYK 172
           KSPPPP  + S PPP Y+SP P      YKSPPPP  +YSP P   Y+SPPPP   YVY 
Sbjct: 217 KSPPPPYVYSSLPPPPYYSPSPEVD---YKSPPPPPPYYSPSPKVEYNSPPPP---YVYS 270

Query: 173 SPPPP--------VKHYSPPP--VYHSPPPPKKHYV-----YKSPPPPVKHYSPPP---- 295
           SPPPP        V++ SPPP  VY+SPPPP  ++      YKSPPPP  + SPPP    
Sbjct: 271 SPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYFPSPKVDYKSPPPPYVYSSPPPPPYY 330

Query: 296 ------VYHSPPPPKKHYVY 337
                  Y SPPPP   YVY
Sbjct: 331 SPSPKVYYKSPPPP---YVY 347

 Score =  117 bits (293), Expect = 4e-25
 Identities = 68/137 (49%), Positives = 78/137 (56%), Gaps = 28/137 (20%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP--VYHSPPPPKKHYV-----YKSPPPPVKHYSPPP----------VY 133
           SP P V++ SPPP  VY+SPPPP  ++      YKSPPPP  + SPPP           Y
Sbjct: 279 SPSPKVEYKSPPPPYVYNSPPPPPYYFPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYY 338

Query: 134 HSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKH--------- 280
            SPPPP   YVY SPPPP  +YSP P  VY SPPPP   YVY SPPPP  +         
Sbjct: 339 KSPPPP---YVYSSPPPP-PYYSPSPKMVYKSPPPP---YVYSSPPPPPYYSPSPKVNYK 391

Query: 281 YSPPPVYHSPPPPKKHY 331
           Y PPP  +S PPP  +Y
Sbjct: 392 YPPPPYVYSSPPPPPYY 408

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/123 (52%), Positives = 76/123 (61%), Gaps = 13/123 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-PPPVYHSPPPPKKHYVYKSP 178
           KSPPPP  + SPPP  +  P PK  Y  KSPPPP  + S PPP Y+SP P      YKSP
Sbjct: 191 KSPPPPYVYSSPPPPPYYSPSPKVDY--KSPPPPYVYSSLPPPPYYSPSPEVD---YKSP 245

Query: 179 PPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPP--------VKHYSPPP--VYHSPPPPK 322
           PPP  +YSP P   Y+SPPPP   YVY SPPPP        V++ SPPP  VY+SPPPP 
Sbjct: 246 PPPPPYYSPSPKVEYNSPPPP---YVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPP 302

Query: 323 KHY 331
            ++
Sbjct: 303 YYF 305

 Score =  114 bits (286), Expect = 3e-24
 Identities = 69/123 (56%), Positives = 75/123 (60%), Gaps = 11/123 (8%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-PPPVYHSPPP------PKKH 160
           KSPPPP  + SPPP  +  P PK   VYKSPPPP  + S PPP Y+SP P      P   
Sbjct: 339 KSPPPPYVYSSPPPPPYYSPSPKM--VYKSPPPPYVYSSPPPPPYYSPSPKVNYKYPPPP 396

Query: 161 YVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKH 328
           YVY SPPPP  +YSP P   Y SPPPP   YVY SPPPP + YSP P   Y SPPPP   
Sbjct: 397 YVYSSPPPP-PYYSPSPKVNYKSPPPP---YVYSSPPPP-QFYSPSPKAEYKSPPPP--- 448

Query: 329 YVY 337
           YVY
Sbjct: 449 YVY 451

 Score =  114 bits (285), Expect = 3e-24
 Identities = 73/147 (49%), Positives = 80/147 (54%), Gaps = 34/147 (23%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV-YHSPPP------PKKHYVYKSPPPPVKHYSPPPV--YHSPPPPK 154
           KSPPPP  + SPPP  Y+SP P      P   YVY SPPPP  +YSP P   Y SPPPP 
Sbjct: 365 KSPPPPYVYSSPPPPPYYSPSPKVNYKYPPPPYVYSSPPPP-PYYSPSPKVNYKSPPPP- 422

Query: 155 KHYVYKSPPPP--------VKHYSPPP--VYHSPPPPKKH-----YVYKSPPPPVKHYSP 289
             YVY SPPPP         ++ SPPP  VY SPPPP  +       YKSPPPP  + SP
Sbjct: 423 --YVYSSPPPPQFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSP 480

Query: 290 PP----------VYHSPPPPKKHYVYK 340
           PP           Y SPPPP   YVYK
Sbjct: 481 PPPPYYSPSPKVYYKSPPPPP--YVYK 505

 Score =  112 bits (280), Expect = 1e-23
 Identities = 68/121 (56%), Positives = 73/121 (60%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYS-PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYK 172
           KSPPPP  + S PPP Y+SP P      YKSPPPP  +YSP P   Y SPPPP   YVY 
Sbjct: 95  KSPPPPYIYSSLPPPPYYSPSPEVD---YKSPPPPPPYYSPSPKVEYKSPPPP---YVYN 148

Query: 173 SPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPP--------PPVKHYSPPP--VYHSPPP 316
           SPPPP  +YSP P   Y SPPPP   YVY SPP        P V + SPPP  VY SPPP
Sbjct: 149 SPPPP-PYYSPSPKVEYKSPPPP---YVYSSPPLPPYYSPSPKVDYKSPPPPYVYSSPPP 204

Query: 317 P 319
           P
Sbjct: 205 P 205

 Score =  112 bits (279), Expect = 2e-23
 Identities = 70/139 (50%), Positives = 76/139 (54%), Gaps = 29/139 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPP--------VKHYSPPP--VYHSPP 145
           KSPPPP  +YSP P   Y SPPPP   YVY SPPPP        V++ SPPP  VY SPP
Sbjct: 121 KSPPPPPPYYSPSPKVEYKSPPPP---YVYNSPPPPPYYSPSPKVEYKSPPPPYVYSSPP 177

Query: 146 -----PPKKHYVYKSPPPPVKHYSPPPV----------YHSPPPPKKHYVYKSPPPPVKH 280
                 P     YKSPPPP  + SPPP           Y SPPPP   YVY S PPP  +
Sbjct: 178 LPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPP---YVYSSLPPP-PY 233

Query: 281 YSPPPV--YHSPPPPKKHY 331
           YSP P   Y SPPPP  +Y
Sbjct: 234 YSPSPEVDYKSPPPPPPYY 252

 Score =  106 bits (264), Expect = 9e-22
 Identities = 65/128 (50%), Positives = 72/128 (56%), Gaps = 17/128 (13%)
 Frame = +2

Query: 5   SPPPPVKHYSP-------PPVYHSPPPPKKH-----YVYKSPPPPVKHYS-PPPVYHSPP 145
           SPPP  +   P       P +Y SPPPP  +       YKSPPPP  + S PPP Y+SP 
Sbjct: 56  SPPPQYRRQGPKYTPHPKPYIYSSPPPPSYYSPSPKVEYKSPPPPYIYSSLPPPPYYSPS 115

Query: 146 PPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPP 313
           P      YKSPPPP  +YSP P   Y SPPPP   YVY SPPPP  +YSP P   Y SPP
Sbjct: 116 P---EVDYKSPPPPPPYYSPSPKVEYKSPPPP---YVYNSPPPP-PYYSPSPKVEYKSPP 168

Query: 314 PPKKHYVY 337
           PP   YVY
Sbjct: 169 PP---YVY 173

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 57/128 (44%), Positives = 65/128 (50%), Gaps = 19/128 (14%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVY----KSPPPPVKHYSP-------PPVYHSPPPPKK 157
           PP  + Y P     SP  PKK+  Y     SPPP  +   P       P +Y SPPPP  
Sbjct: 26  PPTTQKYPPVHKTKSPYQPKKNSPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSSPPPPSY 85

Query: 158 H-----YVYKSPPPPVKHYS-PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPP 313
           +       YKSPPPP  + S PPP Y+SP P      YKSPPPP  +YSP P   Y SPP
Sbjct: 86  YSPSPKVEYKSPPPPYIYSSLPPPPYYSPSP---EVDYKSPPPPPPYYSPSPKVEYKSPP 142

Query: 314 PPKKHYVY 337
           PP   YVY
Sbjct: 143 PP---YVY 147

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 54/107 (50%), Positives = 56/107 (52%), Gaps = 20/107 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV----------YHSPPPPKKHYVYKSPPPP--------VKHYSPPP 127
           KSPPPP  + SPPP           Y SPPPP   YVY SPPPP        V       
Sbjct: 417 KSPPPPYVYSSPPPPQFYSPSPKAEYKSPPPP---YVYSSPPPPPYYSPSPKVD------ 467

Query: 128 VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSP 262
            Y SPPPP   YVY SPPPP  +YSP P   Y SPPPP   YVYK P
Sbjct: 468 -YKSPPPP---YVYSSPPPP-PYYSPSPKVYYKSPPPPP--YVYKMP 507

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 50/116 (43%), Positives = 60/116 (51%), Gaps = 21/116 (18%)
 Frame = +2

Query: 47  YHSPPPPKKH---YVYKSPPPPVKHYSPPPVYHSPPPP--------------KKHYVYKS 175
           Y SPP  +K+   +  KSP  P K+    P Y +PP P               K Y+Y S
Sbjct: 23  YESPPTTQKYPPVHKTKSPYQPKKN---SPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSS 79

Query: 176 PPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHY 331
           PPPP  +YSP P   Y SPPPP   Y+Y S PPP  +YSP P   Y SPPPP  +Y
Sbjct: 80  PPPP-SYYSPSPKVEYKSPPPP---YIYSSLPPP-PYYSPSPEVDYKSPPPPPPYY 130

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 44/103 (42%), Positives = 52/103 (50%), Gaps = 16/103 (15%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK---HYSPPPVYHSPPP----- 232
           Y Y+SPP   K+   PPV+ +          KSP  P K   +YS PP   SPPP     
Sbjct: 21  YPYESPPTTQKY---PPVHKT----------KSPYQPKKNSPYYSAPP---SPPPQYRRQ 64

Query: 233 -PK-----KHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVY 337
            PK     K Y+Y SPPPP  +YSP P   Y SPPPP   Y+Y
Sbjct: 65  GPKYTPHPKPYIYSSPPPP-SYYSPSPKVEYKSPPPP---YIY 103

[84][TOP]
>UniRef100_B9SSV0 Cleavage and polyadenylation specificity factor, putative n=1
           Tax=Ricinus communis RepID=B9SSV0_RICCO
          Length = 210

 Score =  117 bits (294), Expect = 3e-25
 Identities = 66/128 (51%), Positives = 70/128 (54%), Gaps = 18/128 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPV----YHSPPPPKK 157
           K PPP  K Y PP  Y SPPPP       Y Y SPPP  K+ SP P+    YHSPPPPKK
Sbjct: 38  KLPPPHKKVYYPPYYYKSPPPPSPSPPPPYYYTSPPPRKKYPSPSPLLPYHYHSPPPPKK 97

Query: 158 H----YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP----- 310
                Y Y SPPPP  + SPPP   SPPP    Y Y SPPPP K  SPP  Y SP     
Sbjct: 98  STHPTYYYNSPPPPYYYNSPPPPSSSPPPL---YYYDSPPPPKKSLSPPYHYQSPSPLSP 154

Query: 311 -PPPKKHY 331
            PPP  +Y
Sbjct: 155 SPPPPYYY 162

 Score =  108 bits (269), Expect = 2e-22
 Identities = 66/141 (46%), Positives = 72/141 (51%), Gaps = 37/141 (26%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV----YHSPPPPKKH----YVYKSPPPPVKHYSPPPVYHSPPPPKKH 160
           SPPP  K+ SP P+    YHSPPPPKK     Y Y SPPPP  + SPPP   SPPP    
Sbjct: 71  SPPPRKKYPSPSPLLPYHYHSPPPPKKSTHPTYYYNSPPPPYYYNSPPPPSSSPPPL--- 127

Query: 161 YVYKSPPPPVKHYSPPPVYHSP------PPPKKHYV---------------YKSPPPP-- 271
           Y Y SPPPP K  SPP  Y SP      PPP  +Y                YKSPPPP  
Sbjct: 128 YYYDSPPPPKKSLSPPYHYQSPSPLSPSPPPPYYYASPSPTPKKSPSPLSYYKSPPPPSL 187

Query: 272 ---VKHYS---PPPVYHSPPP 316
              + +Y    PPP Y SPPP
Sbjct: 188 SPPLSYYYQSLPPPNYFSPPP 208

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 40/80 (50%), Positives = 43/80 (53%), Gaps = 9/80 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP----PKKHYVYKSPPP-PVKHYSPPPVYHSPPPPK----K 157
           SPPPP K  SPP  Y SP P    P   Y Y SP P P K  SP   Y SPPPP      
Sbjct: 132 SPPPPKKSLSPPYHYQSPSPLSPSPPPPYYYASPSPTPKKSPSPLSYYKSPPPPSLSPPL 191

Query: 158 HYVYKSPPPPVKHYSPPPVY 217
            Y Y+S PPP  ++SPPP Y
Sbjct: 192 SYYYQSLPPP-NYFSPPPYY 210

[85][TOP]
>UniRef100_B9HRV2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HRV2_POPTR
          Length = 711

 Score =  117 bits (294), Expect = 3e-25
 Identities = 65/112 (58%), Positives = 72/112 (64%), Gaps = 7/112 (6%)
 Frame = +2

Query: 5   SPPPPVKH-----YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           SPPPP+       YSPPP  HSPPPP       SPPPPV+ + PPPV HSPPPP    V+
Sbjct: 444 SPPPPIYSPPPLVYSPPPPVHSPPPP-----VHSPPPPVQSF-PPPV-HSPPPP----VH 492

Query: 170 KSPPPPVKHYSPPPVYHSPPPP--KKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             PPPPV  YSPPP  HSPPPP      + +SPPPPV  +SPPP  HSPPPP
Sbjct: 493 SPPPPPV--YSPPPPVHSPPPPVYSPPPLVQSPPPPV--HSPPPPLHSPPPP 540

 Score =  117 bits (294), Expect = 3e-25
 Identities = 65/107 (60%), Positives = 70/107 (65%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPPV  YSPPP  HSPPPP    VY SPPP V+  SPPP  HSPPPP    ++  PPPP
Sbjct: 495 PPPPV--YSPPPPVHSPPPP----VY-SPPPLVQ--SPPPPVHSPPPP----LHSPPPPP 541

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           V  YSPPP  HSPPPP       SPPPP++  SPPP  HSPPPP  H
Sbjct: 542 V--YSPPPPVHSPPPP-----VHSPPPPIQ--SPPPPVHSPPPPPIH 579

 Score =  117 bits (292), Expect = 5e-25
 Identities = 65/117 (55%), Positives = 74/117 (63%), Gaps = 12/117 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY----------VYKSPPPPVKHYSPPPVYHSPPPP- 151
           SPPPPV  +SPPP  HSPPPP + +          V+  PPPPV  YSPPP  HSPPPP 
Sbjct: 458 SPPPPV--HSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPV--YSPPPPVHSPPPPV 513

Query: 152 -KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                + +SPPPPV H  PPP++  PPPP    VY SPPPPV  +SPPP  HSPPPP
Sbjct: 514 YSPPPLVQSPPPPV-HSPPPPLHSPPPPP----VY-SPPPPV--HSPPPPVHSPPPP 562

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/110 (57%), Positives = 68/110 (61%), Gaps = 5/110 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-----YSPPPVYHSPPPPKKHYVY 169
           SPPP +    PPP  HSPPPP  H    SPPPP+       YSPPP  HSPPPP      
Sbjct: 422 SPPPSIHF--PPPPVHSPPPPPVH----SPPPPIYSPPPLVYSPPPPVHSPPPP-----V 470

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            SPPPPV+ + PPPV HSPPPP    V+  PPPPV  YSPPP  HSPPPP
Sbjct: 471 HSPPPPVQSF-PPPV-HSPPPP----VHSPPPPPV--YSPPPPVHSPPPP 512

 Score =  112 bits (280), Expect = 1e-23
 Identities = 64/121 (52%), Positives = 71/121 (58%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKH-------------YSPPPVYHSPPPP--KKHYVYKSPPPPVKHYSPPPVYH 136
           +S PPPV               YSPPP  HSPPPP      + +SPPPPV  +SPPP  H
Sbjct: 478 QSFPPPVHSPPPPVHSPPPPPVYSPPPPVHSPPPPVYSPPPLVQSPPPPV--HSPPPPLH 535

Query: 137 SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           SPPPP  +    SPPPPV  +SPPP  HSPPPP      +SPPPPV H  PPP  HSPPP
Sbjct: 536 SPPPPPVY----SPPPPV--HSPPPPVHSPPPP-----IQSPPPPV-HSPPPPPIHSPPP 583

Query: 317 P 319
           P
Sbjct: 584 P 584

 Score =  111 bits (277), Expect = 3e-23
 Identities = 64/118 (54%), Positives = 70/118 (59%), Gaps = 12/118 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPPV  +SPPP  HSPPPP  +    SPPPPV  +SPPP  HSPPPP      +SPP
Sbjct: 521 QSPPPPV--HSPPPPLHSPPPPPVY----SPPPPV--HSPPPPVHSPPPP-----IQSPP 567

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK------HYSPPPVY------HSPPPP 319
           PPV H  PPP  HSPPPP    V   PPPPV       H  PPPV+      HS PPP
Sbjct: 568 PPV-HSPPPPPIHSPPPP----VQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHSHPPP 620

 Score =  107 bits (268), Expect = 3e-22
 Identities = 61/112 (54%), Positives = 67/112 (59%), Gaps = 7/112 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  +SPPP  HSPPPP      +SPPPPV H  PPP  HSPPPP    V   PPP
Sbjct: 544 SPPPPV--HSPPPPVHSPPPP-----IQSPPPPV-HSPPPPPIHSPPPP----VQSLPPP 591

Query: 185 PVKH-----YSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVYHSPPPP 319
           PV       +SPPP  HSP  P   +     SPPPPV+   PPPV +SPPPP
Sbjct: 592 PVNSPLPPVHSPPPPVHSPTSPIHSHPPPVNSPPPPVQSLPPPPV-NSPPPP 642

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/112 (51%), Positives = 64/112 (57%), Gaps = 10/112 (8%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 193
           PP    S PP+ HS PPP       SPPP + H+ PPPV HSPPPP  H    SPPPP+ 
Sbjct: 402 PPPSSQSLPPLVHSLPPPA-----HSPPPSI-HFPPPPV-HSPPPPPVH----SPPPPIY 450

Query: 194 H-----YSPPPVYHSPPPPKKHYVYKSPPPPVKHY-----SPPPVYHSPPPP 319
                 YSPPP  HSPPPP       SPPPPV+ +     SPPP  HSPPPP
Sbjct: 451 SPPPLVYSPPPPVHSPPPP-----VHSPPPPVQSFPPPVHSPPPPVHSPPPP 497

 Score =  102 bits (254), Expect = 1e-20
 Identities = 63/140 (45%), Positives = 69/140 (49%), Gaps = 35/140 (25%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV------YHSPPPPKKHYV 166
           SPPPP++  SPPP  HSPPPP  H    SPPPPV+   PPPV       HSPPPP     
Sbjct: 558 SPPPPIQ--SPPPPVHSPPPPPIH----SPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPT 611

Query: 167 ------------------------YKSPPPPVKH-----YSPPPVYHSPPPPKKHYVYKS 259
                                     SPPPPV       +SP P  HSPPPP      +S
Sbjct: 612 SPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPSPPLHSPPPP-----IRS 666

Query: 260 PPPPVKHYSPPPVYHSPPPP 319
           PPPPV  +SPPPV  SPPPP
Sbjct: 667 PPPPV--FSPPPVIVSPPPP 684

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/109 (49%), Positives = 62/109 (56%), Gaps = 4/109 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV+   PPPV +SPPPP       SP PP+  +SP P  HSPPPP      +SPPP
Sbjct: 623 SPPPPVQSLPPPPV-NSPPPP-----VHSPTPPI--HSPSPPLHSPPPP-----IRSPPP 669

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPP 319
           PV  +SPPPV  SPP          PPPP + +  PP     Y SPPPP
Sbjct: 670 PV--FSPPPVIVSPP----------PPPPEEDFILPPNLGFQYASPPPP 706

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 47/97 (48%), Positives = 55/97 (56%), Gaps = 3/97 (3%)
 Frame = +2

Query: 50  HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 229
           HSPPP  +        PP+ H  PPP +   PPP  H+    PPPPV    PPPV+ SPP
Sbjct: 400 HSPPPSSQSL------PPLVHSLPPPAHS--PPPSIHF----PPPPVHSPPPPPVH-SPP 446

Query: 230 PP---KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           PP       VY SPPPPV  +SPPP  HSPPPP + +
Sbjct: 447 PPIYSPPPLVY-SPPPPV--HSPPPPVHSPPPPVQSF 480

[86][TOP]
>UniRef100_Q40768 Extensin n=1 Tax=Prunus dulcis RepID=Q40768_PRUDU
          Length = 278

 Score =  117 bits (293), Expect = 4e-25
 Identities = 78/149 (52%), Positives = 78/149 (52%), Gaps = 39/149 (26%)
 Frame = +2

Query: 2   KSPPPPVK-------HY-SPPPVYHSPPPPKKHYVYKSPPPPVK-------HY-SPPPVY 133
           KSPPPP         HY SPPP   SP PPK  Y YKSPPPP         HY SPPP  
Sbjct: 107 KSPPPPSPSPPKHPYHYKSPPPP--SPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPS 164

Query: 134 HSPP-------------PPKKHYVYKSPPPPVKH----YSPPP---VYHSPP---PPKKH 244
            SPP             PPKK Y YKSPPPP       YSPP     Y SPP   PPKK 
Sbjct: 165 PSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPPSPTPPVYSPPKHPYHYKSPPPPSPPKKP 224

Query: 245 YVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           Y YKSPPPP   Y  PPVY  PPPPKK Y
Sbjct: 225 YHYKSPPPPTPVYK-PPVYSPPPPPKKPY 252

 Score =  113 bits (283), Expect = 6e-24
 Identities = 82/160 (51%), Positives = 82/160 (51%), Gaps = 47/160 (29%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP---VYHSPP-----PPKKHYVYKSPPPPVK-------HY-SPPPVY 133
           KSPPPPV HYSPP     Y SPP     PPK  Y YKSPPPP         HY SPPP  
Sbjct: 72  KSPPPPV-HYSPPKHPYHYKSPPPPVYSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPP-- 128

Query: 134 HSPPPPKKHYVYKSPPPPVK-------HY-SPPPVYHSPP-------------PPKKHYV 250
            SP PPK  Y YKSPPPP         HY SPPP   SPP             PPKK Y 
Sbjct: 129 PSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPPKKPYH 188

Query: 251 YKSPPPPVKH----YSPPP---VYHSPP---PPKKHYVYK 340
           YKSPPPP       YSPP     Y SPP   PPKK Y YK
Sbjct: 189 YKSPPPPPSPTPPVYSPPKHPYHYKSPPPPSPPKKPYHYK 228

 Score =  111 bits (278), Expect = 2e-23
 Identities = 72/143 (50%), Positives = 73/143 (51%), Gaps = 33/143 (23%)
 Frame = +2

Query: 2   KSPPPPVK-------HY-SPPPVYHSPPPPKKHYVYKSPPPPVK-----HY-SPPPV--- 130
           KSPPPP         HY SPPP   SP PPK  Y YKSPPPP       HY SPPP    
Sbjct: 141 KSPPPPSPSPPKHPYHYKSPPPP--SPSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPPSP 198

Query: 131 -------------YHSPP---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 262
                        Y SPP   PPKK Y YKSPPPP   Y  PPVY  PPPPKK   YK P
Sbjct: 199 TPPVYSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPTPVYK-PPVYSPPPPPKK--PYKPP 255

Query: 263 PPPVKHYSPPPVYHSPPPPKKHY 331
            PPV    P P  +S PPP  HY
Sbjct: 256 TPPVHTAPPHPYIYSSPPPPHHY 278

 Score =  108 bits (269), Expect = 2e-22
 Identities = 74/136 (54%), Positives = 75/136 (55%), Gaps = 24/136 (17%)
 Frame = +2

Query: 5   SPPPPVK---HY-SPPPVYHSPP----PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 160
           SPPPPV    HY SPPP   +PP    PPK  Y YKSPPPPV HYSPP         K  
Sbjct: 37  SPPPPVSPPYHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPV-HYSPP---------KHP 86

Query: 161 YVYKSPPPPVKHYSPPP-VYH-------SPPPPKKHYVYKSPPPPVK-------HY-SPP 292
           Y YKSPPPPV  YSPP   YH       SP PPK  Y YKSPPPP         HY SPP
Sbjct: 87  YHYKSPPPPV--YSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPP 144

Query: 293 PVYHSPPPPKKHYVYK 340
           P   SP PPK  Y YK
Sbjct: 145 P--PSPSPPKHPYHYK 158

 Score =  100 bits (249), Expect = 5e-20
 Identities = 73/146 (50%), Positives = 73/146 (50%), Gaps = 42/146 (28%)
 Frame = +2

Query: 29  YSPPPV-------YHSPP-----------PPKKHYVYKSPPPPVKHYSPPP---VYHSPP 145
           YS PP        Y SPP           PPK  Y YKSPPPPV HYSPP     Y SPP
Sbjct: 35  YSSPPPPVSPPYHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPV-HYSPPKHPYHYKSPP 93

Query: 146 -----PPKKHYVYKSPPPPVK-------HY-SPPPVYHSPPPPKKHYVYKSPPPPVK--- 277
                PPK  Y YKSPPPP         HY SPPP   SP PPK  Y YKSPPPP     
Sbjct: 94  PPVYSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPP--PSPSPPKHPYHYKSPPPPSPSPP 151

Query: 278 ----HY-SPPPVYHSPPPPKKHYVYK 340
               HY SPPP   SP PPK  Y YK
Sbjct: 152 KHPYHYKSPPP--PSPSPPKHPYHYK 175

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 33/67 (49%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
 Frame = +2

Query: 140 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY-VYKSPPPPVKHYS--PPPVYHSP 310
           P     +Y Y SPPPPV   SPP  Y SPPPP     V+ SPP    HY   PPPV++SP
Sbjct: 26  PSETSANYPYSSPPPPV---SPPYHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPVHYSP 82

Query: 311 PPPKKHY 331
           P    HY
Sbjct: 83  PKHPYHY 89

[87][TOP]
>UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=O81765_ARATH
          Length = 699

 Score =  117 bits (293), Expect = 4e-25
 Identities = 61/114 (53%), Positives = 66/114 (57%), Gaps = 4/114 (3%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--- 172
           +SPPP   +  PPPVY  PPPP   +   SPPPPV    PPPVY  PPPP   +      
Sbjct: 516 RSPPPAPVNSPPPPVYSPPPPPPPVH---SPPPPVHSPPPPPVYSPPPPPPPVHSPPPPV 572

Query: 173 -SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
            SPPPPV  YSPPP  HSPPPP       SPPPP   +SPPP  HSPPPP   Y
Sbjct: 573 FSPPPPV--YSPPPPVHSPPPP-----VHSPPPPAPVHSPPPPVHSPPPPPPVY 619

 Score =  114 bits (284), Expect = 4e-24
 Identities = 63/115 (54%), Positives = 65/115 (56%), Gaps = 8/115 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYK----SPPPPVKHYSPPPVYHSPPPPKKHYVYK 172
           SPPPPV    PPPVY  PPPP   +       SPPPPV  YSPPP  HSPPPP       
Sbjct: 542 SPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPV--YSPPPPVHSPPPP-----VH 594

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV----KHYSPPPVYHSPPPPKK 325
           SPPPP   +SPPP  HSPPPP   Y   SPPPPV       SPP VY  PP P K
Sbjct: 595 SPPPPAPVHSPPPPVHSPPPPPPVY---SPPPPVFSPPPSQSPPVVYSPPPRPPK 646

 Score =  113 bits (283), Expect = 6e-24
 Identities = 60/115 (52%), Positives = 67/115 (58%), Gaps = 5/115 (4%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP   +SPPP  HSPPPP    VY  PPPP   +SPPP   SPPPP    VY SPPPP
Sbjct: 534 PPPPPPVHSPPPPVHSPPPPP---VYSPPPPPPPVHSPPPPVFSPPPP----VY-SPPPP 585

Query: 188 VKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           V  +SPPP  HSPPPP   +     V+  PPPP  +  PPPV+  PP      VY
Sbjct: 586 V--HSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVY 638

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 56/108 (51%), Positives = 62/108 (57%), Gaps = 5/108 (4%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY-----VYK 172
           PPPP  H  PPPV+ SPPPP    VY SPPPPV  +SPPP  HSPPPP   +     V+ 
Sbjct: 560 PPPPPVHSPPPPVF-SPPPP----VY-SPPPPV--HSPPPPVHSPPPPAPVHSPPPPVHS 611

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
            PPPP  +  PPPV+  PP      VY  PP P K  SPP    SPPP
Sbjct: 612 PPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPP--VQSPPP 657

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 54/105 (51%), Positives = 57/105 (54%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  YSPPP  HSPPPP       SPPPP   +SPPP  HSPPPP          P
Sbjct: 574 SPPPPV--YSPPPPVHSPPPP-----VHSPPPPAPVHSPPPPVHSPPPP----------P 616

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV   SPPP   SPPP +   V  SPPP     + PPV   PP P
Sbjct: 617 PVY--SPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAP 659

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/112 (47%), Positives = 59/112 (52%), Gaps = 6/112 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           + P PP +   P   Y   P  K+    +SPPP   +  PPPVY  PPPP   +   SPP
Sbjct: 492 QKPQPPKESPQPDDPYDQSPVTKR----RSPPPAPVNSPPPPVYSPPPPPPPVH---SPP 544

Query: 182 PPVKHYSPPPVYH-SPPPPKKHYVYKSPPPPV-----KHYSPPPVYHSPPPP 319
           PPV    PPPVY   PPPP  H    SPPPPV       YSPPP  HSPPPP
Sbjct: 545 PPVHSPPPPPVYSPPPPPPPVH----SPPPPVFSPPPPVYSPPPPVHSPPPP 592

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 51/117 (43%), Positives = 61/117 (52%), Gaps = 12/117 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           SPPPPV  +SPPP  HSPPPP   +     V+  PPPP  +  PPPV+ SPPP +   V 
Sbjct: 581 SPPPPV--HSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVF-SPPPSQSPPVV 637

Query: 170 KSPPPPVKHYSPPPVYHSPPPP---KKHYVYKSPPPPVKHYSPPPV----YHSPPPP 319
            SPPP     + PPV   PP P   K+     +P P    +  PP     Y SPPPP
Sbjct: 638 YSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAPAPSDDEFIIPPFIGHQYASPPPP 694

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 45/112 (40%), Positives = 53/112 (47%), Gaps = 4/112 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSP---PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           SP P    + P PV  +P   P P      + P PP +   P   Y   P  K+    +S
Sbjct: 462 SPVPTTPVHEPSPVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKR----RS 517

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPKKH 328
           PPP   +  PPPVY  PPPP   +   SPPPPV    PPPVY   PPPP  H
Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVH---SPPPPVHSPPPPPVYSPPPPPPPVH 566

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 48/162 (29%), Positives = 53/162 (32%), Gaps = 66/162 (40%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYK-----------------------SPPPPVKHYSPPPV---- 130
           S P   H P P     V+K                       SP P    + P PV    
Sbjct: 420 SKPSPVHKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATP 479

Query: 131 -----------YHSPPPPKKH----------------------------YVYKSPPPPVK 193
                         P PPK+                              VY  PPPP  
Sbjct: 480 VDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPP 539

Query: 194 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            +SPPP  HSPPPP    VY  PPPP   +SPPP   SPPPP
Sbjct: 540 VHSPPPPVHSPPPPP---VYSPPPPPPPVHSPPPPVFSPPPP 578

[88][TOP]
>UniRef100_Q9XIB6 F13F21.7 protein n=1 Tax=Arabidopsis thaliana RepID=Q9XIB6_ARATH
          Length = 847

 Score =  117 bits (292), Expect = 5e-25
 Identities = 63/105 (60%), Positives = 63/105 (60%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SP PP   YSPPP  HSPPPP    VY SPPPP   YSPPP   SPPPP       SPPP
Sbjct: 542 SPSPPSPIYSPPPPVHSPPPP----VYSSPPPP-HVYSPPPPVASPPPP-------SPPP 589

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV H  PPP   SPPPP       SPPPP   YSPPP  HSPPPP
Sbjct: 590 PV-HSPPPPPVFSPPPP-----VFSPPPPSPVYSPPPPSHSPPPP 628

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 55/118 (46%), Positives = 60/118 (50%), Gaps = 11/118 (9%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYH--SPPPPKKHYVYKSPPPPVKH---------YSPPPVYHSPPPPKK 157
           P P   Y   PV +  SPPPPK     + PPP             YSPPP  HSPPPP  
Sbjct: 506 PTPDDPYDASPVKNRRSPPPPKVEDT-RVPPPQPPMPSPSPPSPIYSPPPPVHSPPPP-- 562

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
             VY SPPPP  +  PPPV   PPP     V+  PPPPV  +SPPP   SPPPP   Y
Sbjct: 563 --VYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPV--FSPPPPVFSPPPPSPVY 616

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 54/113 (47%), Positives = 59/113 (52%), Gaps = 10/113 (8%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVY-----KSPPPPVKHYS--PPPVYHSPPPPKKHYVY 169
           P P K  SPP     P P   +        +SPPPP    +  PPP    P P     +Y
Sbjct: 491 PEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIY 550

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPVYHSPPPP 319
            SPPPPV H  PPPVY SPPPP   +VY SPPPPV      SPPP  HSPPPP
Sbjct: 551 -SPPPPV-HSPPPPVYSSPPPP---HVY-SPPPPVASPPPPSPPPPVHSPPPP 597

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 51/117 (43%), Positives = 53/117 (45%), Gaps = 13/117 (11%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSP---PPPVKHYSPPPVYH--SPPPPKKHYVYK 172
           P  P    SP P     P P K     +    P P   Y   PV +  SPPPPK      
Sbjct: 474 PEQPKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRV 533

Query: 173 SPP--------PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PP        PP   YSPPP  HSPPPP    VY SPPPP   YSPPP   SPPPP
Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPP----VYSSPPPP-HVYSPPPPVASPPPP 585

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 40/112 (35%), Positives = 49/112 (43%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP   YSPPP  HSPPPP    VY SPPPP   +SPPP +++  PP         P 
Sbjct: 608 SPPPPSPVYSPPPPSHSPPPP----VY-SPPPPT--FSPPPTHNTNQPPMGAPTPTQAPT 660

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           P    +  P   S     +       P PV+  +P       P P     Y+
Sbjct: 661 PSSETTQVPTPSSESDQSQILSPVQAPTPVQSSTPSSEPTQVPTPSSSESYQ 712

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 44/114 (38%), Positives = 51/114 (44%), Gaps = 10/114 (8%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSP---PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY--- 169
           P P     SP P    P   P P++  +    P P K  SPP     P P   +      
Sbjct: 463 PQPSKPEDSPKPEQPKPEESPKPEQPQI----PEPTKPVSPPNEAQGPTPDDPYDASPVK 518

Query: 170 --KSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             +SPPPP    +  PPP    P P     +Y SPPPPV H  PPPVY SPPPP
Sbjct: 519 NRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIY-SPPPPV-HSPPPPVYSSPPPP 570

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 44/109 (40%), Positives = 50/109 (45%), Gaps = 7/109 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           PPPPV  +SPPP   SPPPP   Y       SPPPPV  YSPPP   SPPP   H   + 
Sbjct: 595 PPPPV--FSPPPPVFSPPPPSPVYSPPPPSHSPPPPV--YSPPPPTFSPPP--THNTNQP 648

Query: 176 P---PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
           P   P P +  +P       P P           PV+  +P PV  S P
Sbjct: 649 PMGAPTPTQAPTPSSETTQVPTPSSESDQSQILSPVQ--APTPVQSSTP 695

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 47/132 (35%), Positives = 49/132 (37%), Gaps = 29/132 (21%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-- 184
           P P KH SP P      P  KH + K    P    S P     P  PK     K   P  
Sbjct: 435 PQPPKHESPKP----EEPENKHELPKQKESPKPQPSKPEDSPKPEQPKPEESPKPEQPQI 490

Query: 185 --PVKHYSPP---------------PVYH--SPPPPKKHYVYKSPP--------PPVKHY 283
             P K  SPP               PV +  SPPPPK       PP        PP   Y
Sbjct: 491 PEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIY 550

Query: 284 SPPPVYHSPPPP 319
           SPPP  HSPPPP
Sbjct: 551 SPPPPVHSPPPP 562

[89][TOP]
>UniRef100_B9N4U0 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9N4U0_POPTR
          Length = 499

 Score =  117 bits (292), Expect = 5e-25
 Identities = 63/107 (58%), Positives = 68/107 (63%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV+   PPP  HSPPPP      +SPPPPV   SPPP  HSPPPP      +SPPP
Sbjct: 396 SPPPPVQSPPPPPPVHSPPPP-----VQSPPPPVH--SPPPPVHSPPPP-----VQSPPP 443

Query: 185 PVKHYSPPPVYHSPPPP--KKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV  +SPPP  HSPPPP         SPPPPV+  SPPP  HSPPPP
Sbjct: 444 PV--HSPPPPVHSPPPPVHSPPPPVHSPPPPVQ--SPPPPVHSPPPP 486

 Score =  115 bits (287), Expect = 2e-24
 Identities = 63/104 (60%), Positives = 68/104 (65%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV+  SPPP  HSPPPP       SPPPPV+  SPPP  HSPPPP       SPPP
Sbjct: 412 SPPPPVQ--SPPPPVHSPPPP-----VHSPPPPVQ--SPPPPVHSPPPP-----VHSPPP 457

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           PV  +SPPP  HSPPPP      +SPPPPV  +SPPP  HSPPP
Sbjct: 458 PV--HSPPPPVHSPPPP-----VQSPPPPV--HSPPPPVHSPPP 492

 Score =  109 bits (273), Expect = 8e-23
 Identities = 63/106 (59%), Positives = 68/106 (64%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPPV   SPPP  HSPPPP      +SPPPPV  +SPPP  HSPPPP       SPP
Sbjct: 418 QSPPPPVH--SPPPPVHSPPPP-----VQSPPPPV--HSPPPPVHSPPPP-----VHSPP 463

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV  +SPPP   SPPPP       SPPPPV  +SPPPV  SPPPP
Sbjct: 464 PPV--HSPPPPVQSPPPP-----VHSPPPPV--HSPPPV-QSPPPP 499

 Score =  107 bits (268), Expect = 3e-22
 Identities = 58/98 (59%), Positives = 61/98 (62%)
 Frame = +2

Query: 26  HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 205
           H  PPPV   PPPP  H    SPPPPV+  SPPP  HSPPPP       SPPPPV+  SP
Sbjct: 395 HSPPPPVQSPPPPPPVH----SPPPPVQ--SPPPPVHSPPPP-----VHSPPPPVQ--SP 441

Query: 206 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP  HSPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 442 PPPVHSPPPP-----VHSPPPPV--HSPPPPVHSPPPP 472

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/91 (56%), Positives = 58/91 (63%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 226
           +HSPPPP      +SPPPP      PPV+ SPPPP      +SPPPPV  +SPPP  HSP
Sbjct: 394 FHSPPPP-----VQSPPPP------PPVH-SPPPP-----VQSPPPPV--HSPPPPVHSP 434

Query: 227 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPP      +SPPPPV  +SPPP  HSPPPP
Sbjct: 435 PPP-----VQSPPPPV--HSPPPPVHSPPPP 458

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 26/43 (60%), Positives = 29/43 (67%)
 Frame = +2

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           K +SPPP   SPPPP   +   SPPPPV+  SPPP  HSPPPP
Sbjct: 393 KFHSPPPPVQSPPPPPPVH---SPPPPVQ--SPPPPVHSPPPP 430

[90][TOP]
>UniRef100_Q9SPM1 Extensin-like protein n=1 Tax=Solanum lycopersicum
           RepID=Q9SPM1_SOLLC
          Length = 711

 Score =  116 bits (291), Expect = 7e-25
 Identities = 64/105 (60%), Positives = 67/105 (63%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV   SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP       SPPP
Sbjct: 494 SPPPPVH--SPPPPVHSPPPP-----VASPPPPV--HSPPPPVHSPPPP-----VHSPPP 539

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV  +SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 540 PV--HSPPPPVHSPPPP-----VASPPPPV--HSPPPPVHSPPPP 575

 Score =  115 bits (287), Expect = 2e-24
 Identities = 63/104 (60%), Positives = 66/104 (63%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPPV   SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP       SPPPP
Sbjct: 474 PPPPVA--SPPPPVHSPPPP-----VASPPPPV--HSPPPPVHSPPPP-----VASPPPP 519

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           V  +SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 520 V--HSPPPPVHSPPPP-----VHSPPPPV--HSPPPPVHSPPPP 554

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/105 (60%), Positives = 67/105 (63%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  +SPPP   SPPPP    V+  PPPPV   SPPP  HSPPPP       SPPP
Sbjct: 451 SPPPPV--HSPPPPVASPPPP----VHSPPPPPVA--SPPPPVHSPPPP-----VASPPP 497

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV  +SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 498 PV--HSPPPPVHSPPPP-----VASPPPPV--HSPPPPVHSPPPP 533

 Score =  113 bits (283), Expect = 6e-24
 Identities = 63/112 (56%), Positives = 66/112 (58%), Gaps = 7/112 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  +SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP       SPPP
Sbjct: 515 SPPPPV--HSPPPPVHSPPPP-----VHSPPPPV--HSPPPPVHSPPPP-----VASPPP 560

Query: 185 PVKH-----YSPPPVYHSPPPP--KKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV       +SPPP  HSPPPP         SPPPP    SPPP  HSPPPP
Sbjct: 561 PVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPPPVASPPPPVHSPPPP 612

 Score =  112 bits (280), Expect = 1e-23
 Identities = 65/111 (58%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY------HSPPPPKKHYV 166
           SPPPPV   SPPP  HSPPPP       SPPPPV H  PPPV+      HSPPPP     
Sbjct: 508 SPPPPVA--SPPPPVHSPPPP-----VHSPPPPV-HSPPPPVHSPPPPVHSPPPP----- 554

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             SPPPPV  +SPPP  HSPPPP       SPPPPV   SPPP  HSPPPP
Sbjct: 555 VASPPPPV--HSPPPPVHSPPPP-----VHSPPPPVA--SPPPPVHSPPPP 596

 Score =  111 bits (277), Expect = 3e-23
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 6/111 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV    PPP   SPPPP       SPPPPV   SPPP  HSPPPP       SPPP
Sbjct: 585 SPPPPVHSPPPPPPVASPPPP-----VHSPPPPVA--SPPPPVHSPPPP-----VASPPP 632

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH------YSPPPVYHSPPPP 319
           PV  +SPPP  HSPPPP       SPPPPV        +SPPP  HSPPPP
Sbjct: 633 PV--HSPPPPVHSPPPP-----VHSPPPPVASPPPALVFSPPPPVHSPPPP 676

 Score =  110 bits (274), Expect = 6e-23
 Identities = 65/116 (56%), Positives = 67/116 (57%), Gaps = 11/116 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVY------HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 166
           SPPPPV H  PPPV+      HSPPPP       SPPPPV  +SPPP  HSPPPP     
Sbjct: 529 SPPPPV-HSPPPPVHSPPPPVHSPPPP-----VASPPPPV--HSPPPPVHSPPPP----- 575

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-----YSPPPVYHSPPPP 319
             SPPPPV   SPPP  HSPPPP       SPPPPV        SPPP  HSPPPP
Sbjct: 576 VHSPPPPVA--SPPPPVHSPPPPPP---VASPPPPVHSPPPPVASPPPPVHSPPPP 626

 Score =  110 bits (274), Expect = 6e-23
 Identities = 63/111 (56%), Positives = 65/111 (58%), Gaps = 6/111 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVY------HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 166
           SPPPPV H  PPPV+      HSPPPP       SPPPPV    PPP   SPPPP     
Sbjct: 557 SPPPPV-HSPPPPVHSPPPPVHSPPPP-----VASPPPPVHSPPPPPPVASPPPP----- 605

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             SPPPPV   SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 606 VHSPPPPVA--SPPPPVHSPPPP-----VASPPPPV--HSPPPPVHSPPPP 647

 Score =  107 bits (267), Expect = 4e-22
 Identities = 61/106 (57%), Positives = 65/106 (61%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K+ PPP    SPPP  HSPPPP       SPPPPV  +SPPP   SPPPP    V+  PP
Sbjct: 426 KTLPPPPPKTSPPPPVHSPPPPP----VASPPPPV--HSPPPPVASPPPP----VHSPPP 475

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV   SPPP  HSPPPP       SPPPPV H  PPPV+ SPPPP
Sbjct: 476 PPVA--SPPPPVHSPPPP-----VASPPPPV-HSPPPPVH-SPPPP 512

 Score =  103 bits (258), Expect = 5e-21
 Identities = 61/109 (55%), Positives = 64/109 (58%), Gaps = 4/109 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP  HSPPPP       SPPPPV  +SPPP   SPPPP       SPPP
Sbjct: 592 SPPPPPPVASPPPPVHSPPPP-----VASPPPPV--HSPPPPVASPPPP-----VHSPPP 639

Query: 185 PVKHYSPPPVYHSPPPPKKH---YVYKSPPPPVKHYSPPPV-YHSPPPP 319
           PV  +SPPP  HSPPPP       +  SPPPPV H  PPP    SPPPP
Sbjct: 640 PV--HSPPPPVHSPPPPVASPPPALVFSPPPPV-HSPPPPAPVMSPPPP 685

 Score =  103 bits (257), Expect = 6e-21
 Identities = 60/115 (52%), Positives = 65/115 (56%), Gaps = 10/115 (8%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV   SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP       SPPP
Sbjct: 608 SPPPPVA--SPPPPVHSPPPP-----VASPPPPV--HSPPPPVHSPPPP-----VHSPPP 653

Query: 185 PVKH------YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPP 319
           PV        +SPPP  HSPPPP    V   PPP  +  + PP    +Y SPPPP
Sbjct: 654 PVASPPPALVFSPPPPVHSPPPPAP--VMSPPPPTFEDVALPPTLGSLYASPPPP 706

 Score =  103 bits (256), Expect = 8e-21
 Identities = 62/108 (57%), Positives = 63/108 (58%), Gaps = 3/108 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV H  PPP   SPPPP       SPPPPV   SPPP  HSPPPP       SPPP
Sbjct: 436 SPPPPV-HSPPPPPVASPPPP-----VHSPPPPVA--SPPPPVHSPPPPP----VASPPP 483

Query: 185 PVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPP 319
           PV H  PPPV  + PPP  H       SPPPPV   SPPP  HSPPPP
Sbjct: 484 PV-HSPPPPV--ASPPPPVHSPPPPVHSPPPPVA--SPPPPVHSPPPP 526

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 55/105 (52%), Positives = 60/105 (57%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           +PP P    +P P   SPPPPK       PPPP K   PPPV+  PPPP       SPPP
Sbjct: 406 TPPKPSTPTTPKP-NPSPPPPKT-----LPPPPPKTSPPPPVHSPPPPP-----VASPPP 454

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV  +SPPP   SPPPP    V+  PPPPV   SPPP  HSPPPP
Sbjct: 455 PV--HSPPPPVASPPPP----VHSPPPPPVA--SPPPPVHSPPPP 491

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 53/109 (48%), Positives = 59/109 (54%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SP  P K  +PP    +P  PK +    SPPPP K   PPP   SPPPP    V+  PP
Sbjct: 396 QSPKDPPKTVTPPKP-STPTTPKPN---PSPPPP-KTLPPPPPKTSPPPP----VHSPPP 446

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PPV   SPPP  HSPPPP       SPPPPV    PPPV  + PPP  H
Sbjct: 447 PPVA--SPPPPVHSPPPP-----VASPPPPVHSPPPPPV--ASPPPPVH 486

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 38/86 (44%), Positives = 42/86 (48%), Gaps = 24/86 (27%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH------YSPPPVYHSPPPPKKHY- 163
           SPPPPV  +SPPP  HSPPPP       SPPPPV        +SPPP  HSPPPP     
Sbjct: 629 SPPPPV--HSPPPPVHSPPPP-----VHSPPPPVASPPPALVFSPPPPVHSPPPPAPVMS 681

Query: 164 -----------------VYKSPPPPV 190
                            +Y SPPPP+
Sbjct: 682 PPPPTFEDVALPPTLGSLYASPPPPI 707

[91][TOP]
>UniRef100_Q9STN0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STN0_ARATH
          Length = 437

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/132 (50%), Positives = 72/132 (54%), Gaps = 21/132 (15%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPP-----PKKHYVYKSP------PPPVKHYSPPPVYHSPPPPK 154
           PP P  + SPP VY SPPP     P   YVYKSP      PPP  + SPPP  +SPPP  
Sbjct: 99  PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPPYAYSPPP-- 156

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHYVYKSPP-----PPVKHYSPPPVYH 304
             Y Y  PP P  + SPP VY SPP     PP   YVYKSPP     PP   YSPPP  +
Sbjct: 157 --YAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYAY 214

Query: 305 SPPPPKKHYVYK 340
           SPPP    YVYK
Sbjct: 215 SPPP--SPYVYK 224

 Score =  115 bits (287), Expect = 2e-24
 Identities = 70/142 (49%), Positives = 74/142 (52%), Gaps = 30/142 (21%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHYVY 169
           S PPP  + SPPP  +SPPP    Y Y  PP P  + SPP VY SPP     PP   YVY
Sbjct: 137 SSPPPYVYSSPPPYAYSPPP----YAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVY 192

Query: 170 KSPP-----PPVKHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPP---VYHSP 310
           KSPP     PP   YSPPP  +SPPP    YVYKSPP     PP   YSPPP   VY SP
Sbjct: 193 KSPPYVYSSPPPYAYSPPPYAYSPPP--SPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSP 250

Query: 311 P------------PPKKHYVYK 340
           P            PP   YVYK
Sbjct: 251 PYVYSSPPPYAYSPPPSPYVYK 272

 Score =  111 bits (278), Expect = 2e-23
 Identities = 66/135 (48%), Positives = 69/135 (51%), Gaps = 30/135 (22%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHYVY 169
           SPPP    Y  PP  +S PPP   Y Y  PP P  + SPP VY SPP     PP   YVY
Sbjct: 263 SPPPSPYVYKSPPYVYSSPPP---YAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVY 319

Query: 170 KSPP-----PPVKHYSPPP---VYHSPP------------PPKKHYVYKSPP-----PPV 274
           KSPP     PP   YSPPP   VY SPP            PP   YVYKSPP     PP 
Sbjct: 320 KSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 379

Query: 275 KHYSPPPVYHSPPPP 319
             YSPPP  +SPPPP
Sbjct: 380 YTYSPPPYAYSPPPP 394

 Score =  111 bits (277), Expect = 3e-23
 Identities = 73/156 (46%), Positives = 75/156 (48%), Gaps = 45/156 (28%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPP-----PKKHYVYKSPP-----PPVKHYSPPP---------- 127
           PP P  + SPP VY SPPP     P   YVYKSPP     PP   YSPPP          
Sbjct: 217 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPY 276

Query: 128 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHYVYKSPP-----PPVK 277
           VY SPPP    Y Y  PP P  + SPP VY SPP     PP   YVYKSPP     PP  
Sbjct: 277 VYSSPPP----YAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPY 332

Query: 278 HYSPPP---VYHSPP------------PPKKHYVYK 340
            YSPPP   VY SPP            PP   YVYK
Sbjct: 333 AYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYK 368

 Score =  109 bits (272), Expect = 1e-22
 Identities = 76/161 (47%), Positives = 77/161 (47%), Gaps = 50/161 (31%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPP-----PKKHYVYKSPP-----PPVKHYSPPP---------- 127
           PP P  + SPP VY SPPP     P   YVYKSPP     PP   YSPPP          
Sbjct: 241 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPY 300

Query: 128 VYHSPPP-----PKKHYVYKSPP-----PPVKHYSPPP----------VYHSPPP----- 232
           VY SPPP     P   YVYKSPP     PP   YSPPP          VY SPPP     
Sbjct: 301 VYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSP 360

Query: 233 PKKHYVYKSPP-----PPVKHYSPPPVYHSPPPPKKHYVYK 340
           P   YVYKSPP     PP   YSPPP Y   PPP    VYK
Sbjct: 361 PPSPYVYKSPPYVYSSPPPYTYSPPP-YAYSPPPPCPDVYK 400

 Score =  108 bits (269), Expect = 2e-22
 Identities = 70/148 (47%), Positives = 73/148 (49%), Gaps = 36/148 (24%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHYVY 169
           SPP P     PP VY SPPP    Y Y  PP P  + SPP VY SPP     PP   YVY
Sbjct: 31  SPPSP-----PPYVYSSPPP----YTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVY 81

Query: 170 KSPP-----PPVKHYSPPP---VYHSPP------------PPKKHYVYKSP------PPP 271
           KSPP     PP   YSPPP   VY SPP            PP   YVYKSP      PPP
Sbjct: 82  KSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 141

Query: 272 VKHYSPPPVYHSPP-----PPKKHYVYK 340
             + SPPP  +SPP     PP   YVYK
Sbjct: 142 YVYSSPPPYAYSPPPYAYSPPPSPYVYK 169

 Score =  103 bits (257), Expect = 6e-21
 Identities = 72/154 (46%), Positives = 74/154 (48%), Gaps = 44/154 (28%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPP-----PKKHYVYKSPP-----PPVKHYSPPP---------- 127
           PP P  + SPP VY SPPP     P   YVYKSPP     PP   YSPPP          
Sbjct: 265 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPY 324

Query: 128 VYHSPPP-----PKKHYVYKSPP-----PPVKHYSPPP----------VYHSPPP---PK 238
           VY SPPP     P   YVYKSPP     PP   YSPPP          VY SPPP     
Sbjct: 325 VYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSP 384

Query: 239 KHYVYKSPPPPVKH-YSPPPVYHSPPPPKKHYVY 337
             Y Y SPPPP    Y PPP  +S PPP   YVY
Sbjct: 385 PPYAY-SPPPPCPDVYKPPPYVYSSPPP---YVY 414

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/105 (52%), Positives = 59/105 (56%), Gaps = 16/105 (15%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPP-----PKKHYVYKSPP-----PPVKHYSPPPVYHSPPPP-- 151
           PP P  + SPP VY SPPP     P   YVYKSPP     PP   YSPPP  +SPPPP  
Sbjct: 337 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCP 396

Query: 152 ----KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
                  YVY SPPP V  Y+PPP   S PPP   Y Y SPPPP+
Sbjct: 397 DVYKPPPYVYSSPPPYV--YNPPP---SSPPPSPSYSYSSPPPPI 436

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 60/127 (47%), Positives = 63/127 (49%), Gaps = 23/127 (18%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPP-----PKKHYVYKSPP-----PPVKHYSPPP---------- 127
           PP P  + SPP VY SPPP     P   YVYKSPP     PP   YSPPP          
Sbjct: 313 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPY 372

Query: 128 VYHSPPP---PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
           VY SPPP       Y Y  PPP    Y PPP  +S PPP   YVY +PPP     SP   
Sbjct: 373 VYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPP---YVY-NPPPSSPPPSPSYS 428

Query: 299 YHSPPPP 319
           Y SPPPP
Sbjct: 429 YSSPPPP 435

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 52/108 (48%), Positives = 53/108 (49%), Gaps = 20/108 (18%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPP---------- 211
           Y Y  P PP   YS PP Y   PPP   YVYKSPP     PP   YSPPP          
Sbjct: 28  YPYSPPSPPPYVYSSPPPYTYSPPPSP-YVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPY 86

Query: 212 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHYVYK 340
           VY SPPP    Y Y  PP P  + SPP VY SPP     PP   YVYK
Sbjct: 87  VYSSPPP----YAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYK 130

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 39/74 (52%), Positives = 42/74 (56%), Gaps = 11/74 (14%)
 Frame = +2

Query: 2   KSPP-----PPVKHYSPPPVYHSPPPP------KKHYVYKSPPPPVKHYSPPPVYHSPPP 148
           KSPP     PP   YSPPP  +SPPPP         YVY SPPP V  Y+PPP   S PP
Sbjct: 368 KSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYV--YNPPP---SSPP 422

Query: 149 PKKHYVYKSPPPPV 190
           P   Y Y SPPPP+
Sbjct: 423 PSPSYSYSSPPPPI 436

[92][TOP]
>UniRef100_Q9T0L0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0L0_ARATH
          Length = 429

 Score =  115 bits (287), Expect = 2e-24
 Identities = 67/123 (54%), Positives = 74/123 (60%), Gaps = 11/123 (8%)
 Frame = +2

Query: 2   KSPPPPVKH-YSPPPVYHSPPP------PKKHYVYKSPPPPVKHYSPPPV--YHSPPPPK 154
           KSPPPP  + + PPP Y+SP P      P   YVY SPPPP  +YSP P   Y SPPPP 
Sbjct: 200 KSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPP-PYYSPSPKVNYKSPPPP- 257

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKH 328
             YVY SPPPP    SP   + SPPPP   Y+Y SPPPP  +YSP P   Y SPPPP   
Sbjct: 258 --YVYSSPPPPPYSPSPKVEFKSPPPP---YIYNSPPPP-SYYSPSPKIDYKSPPPP--- 308

Query: 329 YVY 337
           YVY
Sbjct: 309 YVY 311

 Score =  115 bits (287), Expect = 2e-24
 Identities = 74/156 (47%), Positives = 82/156 (52%), Gaps = 43/156 (27%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV----------YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPP 145
           KSPPPP  + SPPP           Y SPPPP   YVY SPPPP  +YSP P   Y SPP
Sbjct: 277 KSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPP---YVYSSPPPPT-YYSPSPRVDYKSPP 332

Query: 146 PPKKH------YVYKSPPPP--------VKHYSPPP--VYHSPPPPKKH-----YVYKSP 262
           PP  +      YVY SPPPP        V + SPPP  VY+SPPPP  +       YKSP
Sbjct: 333 PPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSP 392

Query: 263 PPPVKHYSPPP----------VYHSPPPPKKHYVYK 340
           PPP  + SPPP           Y SPPPP   Y+YK
Sbjct: 393 PPPYIYNSPPPPPYYSPSPKITYKSPPPP---YIYK 425

 Score =  113 bits (282), Expect = 7e-24
 Identities = 68/126 (53%), Positives = 73/126 (57%), Gaps = 14/126 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV----------YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 151
           KSPP P  + SPPP           Y SPPPP   YVY SPPPP    SP   + SPPPP
Sbjct: 226 KSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPP---YVYSSPPPPPYSPSPKVEFKSPPPP 282

Query: 152 KKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPP 319
              Y+Y SPPPP  +YSP P   Y SPPPP   YVY SPPPP  +YSP P   Y SPPPP
Sbjct: 283 ---YIYNSPPPP-SYYSPSPKIDYKSPPPP---YVYSSPPPPT-YYSPSPRVDYKSPPPP 334

Query: 320 KKHYVY 337
              YVY
Sbjct: 335 ---YVY 337

 Score =  111 bits (277), Expect = 3e-23
 Identities = 66/128 (51%), Positives = 72/128 (56%), Gaps = 23/128 (17%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           S PPP  +YSP P   Y SPPPP   YVY SPPPP    SP   + SPPPP   Y+Y SP
Sbjct: 235 SSPPPPPYYSPSPKVNYKSPPPP---YVYSSPPPPPYSPSPKVEFKSPPPP---YIYNSP 288

Query: 179 PPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPP--------VKHYSPPP----------- 295
           PPP  +YSP P   Y SPPPP   YVY SPPPP        V + SPPP           
Sbjct: 289 PPP-SYYSPSPKIDYKSPPPP---YVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPY 344

Query: 296 VYHSPPPP 319
           VY+SPPPP
Sbjct: 345 VYNSPPPP 352

 Score =  110 bits (274), Expect = 6e-23
 Identities = 69/145 (47%), Positives = 82/145 (56%), Gaps = 33/145 (22%)
 Frame = +2

Query: 2   KSPPPP-VKHYSPPPVYHSPPPPKKHYVYKSPPPP--------VKHYSPPP--VYHSPPP 148
           KSPPPP V  +SPP +Y+SP P  +   YKSPPPP        + +YSP P  +Y+SPPP
Sbjct: 96  KSPPPPSVYTFSPPQLYYSPSPKVE---YKSPPPPYVYSSLPPLTYYSPSPKVIYNSPPP 152

Query: 149 PKKHYVYKSPPPP--------VKHYSPPP--VYHSPPPPKKH-----YVYKSPPPP-VKH 280
           P   Y+Y SPPPP        V + SPPP  VY SPPPP  +       YKSPPPP V  
Sbjct: 153 P---YIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYS 209

Query: 281 YSPPPVYHSPPP------PKKHYVY 337
           + PPP Y+SP P      P   YVY
Sbjct: 210 FPPPPPYYSPSPKVGYKSPPAPYVY 234

 Score =  110 bits (274), Expect = 6e-23
 Identities = 68/133 (51%), Positives = 78/133 (58%), Gaps = 23/133 (17%)
 Frame = +2

Query: 2   KSPPPP--------VKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPP 145
           KSPPPP        + +YSP P  +Y+SPPPP   Y+Y SPPPP  +YSP P   Y SPP
Sbjct: 122 KSPPPPYVYSSLPPLTYYSPSPKVIYNSPPPP---YIYSSPPPP-PYYSPSPKVDYKSPP 177

Query: 146 PPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPP--------VKHYSPP- 292
           PP   YVY SPPPP  +YSP P   Y SPPPP   YVY  PPPP        V + SPP 
Sbjct: 178 PP---YVYSSPPPP-PYYSPSPKVEYKSPPPP---YVYSFPPPPPYYSPSPKVGYKSPPA 230

Query: 293 PVYHSPPPPKKHY 331
           P  +S PPP  +Y
Sbjct: 231 PYVYSSPPPPPYY 243

 Score =  107 bits (268), Expect = 3e-22
 Identities = 66/122 (54%), Positives = 70/122 (57%), Gaps = 17/122 (13%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYK 172
           S PPP  +YSP P   Y SPPPP   YVY SPPPP  +YSP P   Y SPPPP   YVY 
Sbjct: 157 SSPPPPPYYSPSPKVDYKSPPPP---YVYSSPPPP-PYYSPSPKVEYKSPPPP---YVYS 209

Query: 173 SPPPPVKHYSPPP-----------VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPP 313
            PPPP  +YSP P           VY SPPPP     Y SP P V + SPPP  VY SPP
Sbjct: 210 FPPPP-PYYSPSPKVGYKSPPAPYVYSSPPPPP----YYSPSPKVNYKSPPPPYVYSSPP 264

Query: 314 PP 319
           PP
Sbjct: 265 PP 266

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 64/141 (45%), Positives = 77/141 (54%), Gaps = 29/141 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYS----------PPPVYHSPPPPKKHYVY-----KSPPPP-VKHYSPPPVY 133
           +SPPPP   Y            P VY SP P   ++ +     KSPPPP V  +SPP +Y
Sbjct: 53  ESPPPPPPQYRRQEPKYTPHPEPNVYDSPTPLPYYFPFPKLDIKSPPPPSVYTFSPPQLY 112

Query: 134 H---------SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKH 280
           +         SPPPP   YVY S  PP+ +YSP P  +Y+SPPPP   Y+Y SPPPP  +
Sbjct: 113 YSPSPKVEYKSPPPP---YVYSS-LPPLTYYSPSPKVIYNSPPPP---YIYSSPPPP-PY 164

Query: 281 YSPPPV--YHSPPPPKKHYVY 337
           YSP P   Y SPPPP   YVY
Sbjct: 165 YSPSPKVDYKSPPPP---YVY 182

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 54/130 (41%), Positives = 69/130 (53%), Gaps = 28/130 (21%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKH--YVYKSPPPPVKHYS----------PPPVYHSPPPPKKHYVY-- 169
           S  P Y SP PPK +  Y+ +SPPPP   Y            P VY SP P   ++ +  
Sbjct: 33  SSTPQYTSPYPPKNYSPYLSESPPPPPPQYRRQEPKYTPHPEPNVYDSPTPLPYYFPFPK 92

Query: 170 ---KSPPPP-VKHYSPPPVYHSPPPPKKHYVYKSPP--------PPVKHYSPPP--VYHS 307
              KSPPPP V  +SPP +Y+SP P  +   YKSPP        PP+ +YSP P  +Y+S
Sbjct: 93  LDIKSPPPPSVYTFSPPQLYYSPSPKVE---YKSPPPPYVYSSLPPLTYYSPSPKVIYNS 149

Query: 308 PPPPKKHYVY 337
           PPPP   Y+Y
Sbjct: 150 PPPP---YIY 156

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 49/98 (50%), Positives = 56/98 (57%), Gaps = 12/98 (12%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPP--------VKHYSPPPVYHSPPPPK 154
           SPPPP  +YSP P   Y SPPPP   YVY SPPPP        V++ SPPP         
Sbjct: 348 SPPPP-PYYSPSPTVNYKSPPPP---YVYNSPPPPPYYSPFPKVEYKSPPP--------- 394

Query: 155 KHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSP 262
             Y+Y SPPPP  +YSP P   Y SPPPP   Y+YK+P
Sbjct: 395 -PYIYNSPPPP-PYYSPSPKITYKSPPPP---YIYKTP 427

[93][TOP]
>UniRef100_C6TK91 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TK91_SOYBN
          Length = 146

 Score =  115 bits (287), Expect = 2e-24
 Identities = 60/110 (54%), Positives = 63/110 (57%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           P PP      PP Y+  PP    Y YKSPPPP     PP VY SPPPP       SPPPP
Sbjct: 40  PTPPTYRQINPPYYYKSPP----YYYKSPPPPSPSPPPPYVYKSPPPPSP-----SPPPP 90

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
             + SPPP   SPPPP   YVYKSPPPP    SPPP  HSPPPP   Y+Y
Sbjct: 91  YIYKSPPPPSPSPPPPSP-YVYKSPPPPSPSPSPPPS-HSPPPPHHPYLY 138

 Score =  111 bits (277), Expect = 3e-23
 Identities = 56/91 (61%), Positives = 58/91 (63%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP     PP VY SPPPP       SPPPP  + SPPP   SPPPP   YVYKSPP
Sbjct: 62  KSPPPPSPSPPPPYVYKSPPPPSP-----SPPPPYIYKSPPPPSPSPPPPSP-YVYKSPP 115

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
           PP    SPPP  HSPPPP   Y+Y SPPPPV
Sbjct: 116 PPSPSPSPPPS-HSPPPPHHPYLYNSPPPPV 145

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/105 (47%), Positives = 56/105 (53%)
 Frame = +2

Query: 26  HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 205
           +Y  P  Y+  P P     Y+   PP  + SPP  Y SPPPP       SPPPP  + SP
Sbjct: 29  YYGQPSNYYPHPTPP---TYRQINPPYYYKSPPYYYKSPPPPSP-----SPPPPYVYKSP 80

Query: 206 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           PP   SPPPP   Y+YKSPPPP    SP     SPPPP   YVYK
Sbjct: 81  PPPSPSPPPP---YIYKSPPPP----SP-----SPPPPS-PYVYK 112

[94][TOP]
>UniRef100_Q76KW2 Hydroxyproline-rich glycoprotein-3 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW2_PEA
          Length = 137

 Score =  114 bits (284), Expect = 4e-24
 Identities = 67/123 (54%), Positives = 68/123 (55%), Gaps = 11/123 (8%)
 Frame = +2

Query: 2   KSPPPPVKHYS--PPPV-----YHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPK 154
           KSPPPPV  Y   PPPV     Y SPPPP   Y Y SPPPPV  Y   PPPVY    PP 
Sbjct: 4   KSPPPPVYKYKSPPPPVKKPYKYSSPPPPV--YKYNSPPPPVYKYKSPPPPVYKYKSPPP 61

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKH 328
             Y YKSPPPPVK    P  Y SPPPP   Y Y SPPPPV  Y  P  P+Y    PP   
Sbjct: 62  PVYKYKSPPPPVK---KPYKYTSPPPPV--YKYNSPPPPVYKYKSPXTPIYKYKSPPPXV 116

Query: 329 YVY 337
           Y Y
Sbjct: 117 YKY 119

 Score =  110 bits (275), Expect = 5e-23
 Identities = 68/112 (60%), Positives = 70/112 (62%), Gaps = 14/112 (12%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVK---HYS--PPPV--YHSPPPPKKHYVYKSPPPPVKHYS- 202
           Y SPPPP   Y YKSPPPPVK    YS  PPPV  Y+SPPPP   Y YKSPPPPV  Y  
Sbjct: 3   YKSPPPPV--YKYKSPPPPVKKPYKYSSPPPPVYKYNSPPPPV--YKYKSPPPPVYKYKS 58

Query: 203 -PPPV--YHSPPPP-KKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYK 340
            PPPV  Y SPPPP KK Y Y SPPPPV  Y+  PPPVY    P    Y YK
Sbjct: 59  PPPPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKYKSPXTPIYKYK 110

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 57/101 (56%), Positives = 59/101 (58%), Gaps = 16/101 (15%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYS--PPPV-----YHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPP 229
           Y YKSPPPPV  Y   PPPV     Y SPPPP   Y Y SPPPPV  Y   PPPVY    
Sbjct: 1   YKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPV--YKYNSPPPPVYKYKSPPPPVYKYKS 58

Query: 230 PPKKHYVYKSPPPPV----KHYSPPP---VYHSPPPPKKHY 331
           PP   Y YKSPPPPV    K+ SPPP    Y+SPPPP   Y
Sbjct: 59  PPPPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKY 99

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 56/107 (52%), Positives = 59/107 (55%), Gaps = 11/107 (10%)
 Frame = +2

Query: 5   SPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPV-----YHSPPPPKK 157
           SPPPPV  Y+  PPPVY    PP   Y YKSPPPPV  Y   PPPV     Y SPPPP  
Sbjct: 28  SPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYTSPPPPV- 86

Query: 158 HYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP 292
            Y Y SPPPPV  Y  P  P+Y    PP   Y Y S    V+ YSPP
Sbjct: 87  -YKYNSPPPPVYKYKSPXTPIYKYKSPPPXVYKYNSLLNSVQVYSPP 132

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/78 (51%), Positives = 42/78 (53%), Gaps = 9/78 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYS--PPPV-----YHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPK 154
           KSPPPPV  Y   PPPV     Y SPPPP   Y Y SPPPPV  Y  P  P+Y    PP 
Sbjct: 57  KSPPPPVYKYKSPPPPVKKPYKYTSPPPPV--YKYNSPPPPVYKYKSPXTPIYKYKSPPP 114

Query: 155 KHYVYKSPPPPVKHYSPP 208
             Y Y S    V+ YSPP
Sbjct: 115 XVYKYNSLLNSVQVYSPP 132

[95][TOP]
>UniRef100_Q01945 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01945_SOLLC
          Length = 90

 Score =  112 bits (279), Expect = 2e-23
 Identities = 59/99 (59%), Positives = 61/99 (61%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   YVYKSPPPP     PP VY SPPPP       SPPP
Sbjct: 5   SPPPPYVYKSPPPPSPSPPPP---YVYKSPPPPSPSPPPPYVYKSPPPPS-----HSPPP 56

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 301
           P  + SPPP   SPPPP   Y YKSPPPP    SPPP Y
Sbjct: 57  PYYYKSPPPPSPSPPPP---YYYKSPPPPSP--SPPPPY 90

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/93 (59%), Positives = 56/93 (60%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 220
           P   SPPPP   YVYKSPPPP     PP VY SPPPP       SPPPP  + SPPP  H
Sbjct: 1   PPSPSPPPP---YVYKSPPPPSPSPPPPYVYKSPPPPS-----PSPPPPYVYKSPPPPSH 52

Query: 221 SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP   Y YKSPPPP     PP  Y SPPPP
Sbjct: 53  SPPPP---YYYKSPPPPSPSPPPPYYYKSPPPP 82

[96][TOP]
>UniRef100_Q01942 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q01942_SOLLC
          Length = 132

 Score =  112 bits (279), Expect = 2e-23
 Identities = 61/115 (53%), Positives = 64/115 (55%), Gaps = 6/115 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SP PP  +Y YKSPPPP     PP  Y SPPPP       SPPP
Sbjct: 5   SPPPPYYYKSPPPP--SPSPPPPYY-YKSPPPPSPSPPPPYYYKSPPPPS-----PSPPP 56

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSP------PPPVKHYSPPPVYHSPPPPKKHY 331
           P  + SPPP   SPPPP   Y YKSP      PPP     PPP Y SPPPP   Y
Sbjct: 57  PYYYKSPPPPDPSPPPP---YYYKSPPPPSPSPPPPSPSPPPPTYSSPPPPPPFY 108

 Score =  105 bits (261), Expect = 2e-21
 Identities = 61/113 (53%), Positives = 62/113 (54%), Gaps = 7/113 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP     PP  Y SPPPP       SPPPP  + SPPP   SPPPP   Y YKSPP
Sbjct: 29  KSPPPPSPSPPPPYYYKSPPPPS-----PSPPPPYYYKSPPPPDPSPPPP---YYYKSPP 80

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP---PPV----YHSPPPP 319
           PP    SPPP   SPPPP     Y SPPPP   Y     PPV    Y SPPPP
Sbjct: 81  PPSP--SPPPPSPSPPPP----TYSSPPPPPPFYENIPLPPVIGVSYASPPPP 127

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 45/88 (51%), Positives = 47/88 (53%)
 Frame = +2

Query: 56  PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 235
           PP P       SPPPP  + SPPP   SPPPP   Y YKSPPPP           SP PP
Sbjct: 1   PPSP-------SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPP-----------SPSPP 39

Query: 236 KKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             +Y YKSPPPP     PP  Y SPPPP
Sbjct: 40  PPYY-YKSPPPPSPSPPPPYYYKSPPPP 66

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 40/82 (48%), Positives = 41/82 (50%), Gaps = 17/82 (20%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH------YSPPPVYHSPPPPKKHYV 166
           SPPPP  + SPPP   SPPPP   Y YKSPPPP           PPP Y SPPPP   Y 
Sbjct: 53  SPPPPYYYKSPPPPDPSPPPP---YYYKSPPPPSPSPPPPSPSPPPPTYSSPPPPPPFYE 109

Query: 167 -----------YKSPPPPVKHY 199
                      Y SPPPPV  Y
Sbjct: 110 NIPLPPVIGVSYASPPPPVIPY 131

[97][TOP]
>UniRef100_Q41400 Root nodule extensin (Fragment) n=1 Tax=Sesbania rostrata
           RepID=Q41400_SESRO
          Length = 91

 Score =  111 bits (277), Expect = 3e-23
 Identities = 59/96 (61%), Positives = 60/96 (62%), Gaps = 7/96 (7%)
 Frame = +2

Query: 17  PVKHYSPPPVYHSPPPP-KKHYVYKSPPPPVKHYS---PPPVYHSPPPP---KKHYVYKS 175
           P  H  P PVYHSPPPP KK Y Y SPPPPV  Y    P PVYHSPPPP   KK Y Y S
Sbjct: 7   PHPHPHPHPVYHSPPPPYKKPYKYHSPPPPVHTYPPHIPHPVYHSPPPPTPYKKPYKYHS 66

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
           PPPPV         HSPPPP  HY YKSPPPP  H+
Sbjct: 67  PPPPV---------HSPPPP--HYYYKSPPPPPYHH 91

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/93 (61%), Positives = 60/93 (64%), Gaps = 9/93 (9%)
 Frame = +2

Query: 80  VYKSPPPPVKHYSPPPVYHSPPPP-KKHYVYKSPPPPVKHYSPP---PVYHSPPPP---K 238
           V+K P P   H  P PVYHSPPPP KK Y Y SPPPPV  Y P    PVYHSPPPP   K
Sbjct: 3   VHKYPHP---HPHPHPVYHSPPPPYKKPYKYHSPPPPVHTYPPHIPHPVYHSPPPPTPYK 59

Query: 239 KHYVYKSPPPPVKHYSPPPVYH--SPPPPKKHY 331
           K Y Y SPPPPV H  PPP Y+  SPPPP  H+
Sbjct: 60  KPYKYHSPPPPV-HSPPPPHYYYKSPPPPPYHH 91

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 42/75 (56%), Positives = 48/75 (64%), Gaps = 10/75 (13%)
 Frame = +2

Query: 5   SPPPPVK----HYSPPPVYHSPPPPKKHYVYKSPPPPV------KHYSPPPVYHSPPPPK 154
           SPPPP K    ++SPPP  H+ PP   H VY SPPPP       K++SPPP  HSPPPP 
Sbjct: 19  SPPPPYKKPYKYHSPPPPVHTYPPHIPHPVYHSPPPPTPYKKPYKYHSPPPPVHSPPPP- 77

Query: 155 KHYVYKSPPPPVKHY 199
            HY YKSPPPP  H+
Sbjct: 78  -HYYYKSPPPPPYHH 91

[98][TOP]
>UniRef100_UPI0001A7B0C1 protein binding / structural constituent of cell wall n=1
            Tax=Arabidopsis thaliana RepID=UPI0001A7B0C1
          Length = 857

 Score =  110 bits (276), Expect = 4e-23
 Identities = 59/123 (47%), Positives = 68/123 (55%), Gaps = 14/123 (11%)
 Frame = +2

Query: 5    SPPPPVKHY-----SPPPVYHSPPPPKKHYVYKSPPPP-VKHYSPPPVYHSPPPPKKHYV 166
            SPPPP  +Y      PPP ++S PPP   Y Y SPPPP    +SPPP  H P        
Sbjct: 719  SPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPP-----CIE 773

Query: 167  YKSPPPPVKHYSPP----PVYHSPPPPKKHYVYKS-PPPPVKHYSPPP---VYHSPPPPK 322
            Y  PPPP  HY+PP    P ++SPPP    Y Y S PPPP  HYSPPP   ++HS PPP 
Sbjct: 774  YSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPP 833

Query: 323  KHY 331
              Y
Sbjct: 834  PIY 836

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/132 (41%), Positives = 67/132 (50%), Gaps = 22/132 (16%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            PPPP  +Y P P   SP  P +  +Y +PPP P+ +   PP + SPPPP  +Y     PP
Sbjct: 678  PPPPQTYYPPQP---SPSQPPQSPIYGTPPPSPIPYLPSPPQFASPPPPAPYYYSSPQPP 734

Query: 185  PVKHYS---PPPVYH--SPPPP---------KKH---YVYKSPPPPVKHYSPPP----VY 301
            P  HYS   P P YH  SPPPP         + H     Y  PPPP  HY+PPP     +
Sbjct: 735  PPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAH 794

Query: 302  HSPPPPKKHYVY 337
            +SPPP    Y Y
Sbjct: 795  YSPPPSPPVYYY 806

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 53/118 (44%), Positives = 64/118 (54%), Gaps = 14/118 (11%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSP---PPPKKH---YVYKSPPPPVKHYSPPP----VYHSPPPPKK 157
            PP P  HY  PP   +P   PPP+ H     Y  PPPP  HY+PPP     ++SPPP   
Sbjct: 743  PPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPP 802

Query: 158  HYVYKSPPPP--VKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             Y Y SPPPP  V +  PPP  ++HS PPP    +Y+ P PP+    P   Y SPPPP
Sbjct: 803  VYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP--IYEGPLPPI----PGISYASPPPP 854

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 56/132 (42%), Positives = 66/132 (50%), Gaps = 27/132 (20%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYH-----SPPPPKKHYVYKSP---PPPVKHYSPPPVYHSPPPPKKH 160
            SPPPP   Y PPP +      SPPPP       SP   PPP + YSP P    PPPP+ +
Sbjct: 626  SPPPPSTGYPPPPPFTGYSPPSPPPPPPPTFSPSPSIPPPPPQTYSPFPP-PPPPPPQTY 684

Query: 161  Y-------------VYKSPPP-PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS---P 289
            Y             +Y +PPP P+ +   PP + SPPPP  +Y     PPP  HYS   P
Sbjct: 685  YPPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQFASPPPPAPYYYSSPQPPPPPHYSLPPP 744

Query: 290  PPVYH--SPPPP 319
             P YH  SPPPP
Sbjct: 745  TPTYHYISPPPP 756

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 50/123 (40%), Positives = 63/123 (51%), Gaps = 14/123 (11%)
 Frame = +2

Query: 5   SPPP--PVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS-----PPPPKK 157
           SPPP  P   YSPPP    + PPPP   Y   SPPPP     PPP +       PPPP+ 
Sbjct: 615 SPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSPPPP-----PPPTFSPSPSIPPPPPQT 669

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPP----PKKHYVYKSPPP-PVKHYSPPPVYHSPPPPK 322
           +  +  PPPP     PP  Y+ P P    P +  +Y +PPP P+ +   PP + SPPPP 
Sbjct: 670 YSPFPPPPPP-----PPQTYYPPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQFASPPPPA 724

Query: 323 KHY 331
            +Y
Sbjct: 725 PYY 727

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 53/127 (41%), Positives = 61/127 (48%), Gaps = 18/127 (14%)
 Frame = +2

Query: 5   SPPPPVKH-YSPPPVYHSPP-----PPKKHYVYKSPPPPVKHYSPP---PVYHSPPPPKK 157
           +PP P+    + PP+  SPP     PP       SPP P    SPP   P   SPPP   
Sbjct: 566 TPPTPISPGQNSPPIIPSPPFTGPSPPSS----PSPPLPPVIPSPPIVGPTPSSPPPSTP 621

Query: 158 HYVYKSPPPPVKHYSPPPVY-----HSPPPPKKHYVYKS---PPPPVKHYSP-PPVYHSP 310
             VY SPPPP   Y PPP +      SPPPP       S   PPPP + YSP PP    P
Sbjct: 622 TPVY-SPPPPSTGYPPPPPFTGYSPPSPPPPPPPTFSPSPSIPPPPPQTYSPFPP--PPP 678

Query: 311 PPPKKHY 331
           PPP+ +Y
Sbjct: 679 PPPQTYY 685

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 49/114 (42%), Positives = 52/114 (45%), Gaps = 3/114 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SP PP+    P P    P P        SPPP     +P PVY SPPPP   Y    PPP
Sbjct: 594 SPSPPLPPVIPSPPIVGPTP-------SSPPPS----TPTPVY-SPPPPSTGY---PPPP 638

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSP---PPPVKHYSPPPVYHSPPPPKKHYVY 337
           P   YSPP    SPPPP       SP   PPP + YSP P    PPPP     Y
Sbjct: 639 PFTGYSPP----SPPPPPPPTFSPSPSIPPPPPQTYSPFP---PPPPPPPQTYY 685

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/128 (39%), Positives = 56/128 (43%), Gaps = 23/128 (17%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSP--PP----PKKHYVYKSPPPPVKHYSP-------PPVYHSPP 145
           SP PP+   SPP    SP  PP    P       SPP P    +P       PP+  SPP
Sbjct: 526 SPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPP 585

Query: 146 -----PPKKHYVYKSPPPPVKHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 301
                PP       SPP P    SPP   P   SPPP     VY SPPPP   Y PPP +
Sbjct: 586 FTGPSPPSS----PSPPLPPVIPSPPIVGPTPSSPPPSTPTPVY-SPPPPSTGYPPPPPF 640

Query: 302 --HSPPPP 319
             +SPP P
Sbjct: 641 TGYSPPSP 648

[99][TOP]
>UniRef100_Q9SN46 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9SN46_ARATH
          Length = 839

 Score =  110 bits (276), Expect = 4e-23
 Identities = 59/123 (47%), Positives = 68/123 (55%), Gaps = 14/123 (11%)
 Frame = +2

Query: 5    SPPPPVKHY-----SPPPVYHSPPPPKKHYVYKSPPPP-VKHYSPPPVYHSPPPPKKHYV 166
            SPPPP  +Y      PPP ++S PPP   Y Y SPPPP    +SPPP  H P        
Sbjct: 701  SPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPP-----CIE 755

Query: 167  YKSPPPPVKHYSPP----PVYHSPPPPKKHYVYKS-PPPPVKHYSPPP---VYHSPPPPK 322
            Y  PPPP  HY+PP    P ++SPPP    Y Y S PPPP  HYSPPP   ++HS PPP 
Sbjct: 756  YSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPP 815

Query: 323  KHY 331
              Y
Sbjct: 816  PIY 818

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 53/118 (44%), Positives = 64/118 (54%), Gaps = 14/118 (11%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSP---PPPKKH---YVYKSPPPPVKHYSPPP----VYHSPPPPKK 157
            PP P  HY  PP   +P   PPP+ H     Y  PPPP  HY+PPP     ++SPPP   
Sbjct: 725  PPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPP 784

Query: 158  HYVYKSPPPP--VKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             Y Y SPPPP  V +  PPP  ++HS PPP    +Y+ P PP+    P   Y SPPPP
Sbjct: 785  VYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP--IYEGPLPPI----PGISYASPPPP 836

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/99 (44%), Positives = 51/99 (51%), Gaps = 4/99 (4%)
 Frame = +2

Query: 53  SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 232
           SPPPP  +Y Y SP PP     PPP Y  PPP   ++    PPPP   +SPPP  H P  
Sbjct: 701 SPPPPAPYY-YSSPQPP-----PPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPC- 753

Query: 233 PKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVY 337
                 Y  PPPP  HY+PPP     ++SPPP    Y Y
Sbjct: 754 ----IEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYY 788

[100][TOP]
>UniRef100_UPI0000ECB104 UPI0000ECB104 related cluster n=1 Tax=Gallus gallus
           RepID=UPI0000ECB104
          Length = 559

 Score =  110 bits (274), Expect = 6e-23
 Identities = 59/120 (49%), Positives = 67/120 (55%), Gaps = 8/120 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSP--PPPKKHYVYKSPPPPVKH--YSPPPV-YHSPPPPKKHYV 166
           + PPP   HY PPP YH P  PPP  H+    PPPP  H  Y PPP  +H PPPP  H+ 
Sbjct: 340 RRPPPHGHHYPPPPPYHWPYCPPPHGHHY---PPPPPYHGPYCPPPHGHHHPPPPPHHHR 396

Query: 167 YKSPPPPVKHYSPPPVYHSP--PPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPKKHYVY 337
            + PPP   H+ PPP YH P  PPP  H+ Y  PPP    Y PPP  +H PPPP  H  Y
Sbjct: 397 PRRPPPHGHHHLPPPPYHWPYCPPPHGHH-YPPPPPYHGPYCPPPHGHHYPPPPPYHGPY 455

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 57/129 (44%), Positives = 63/129 (48%), Gaps = 20/129 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHS----PPPPKKHYVYKSPPPPVKH--YSPPPV-YHSPPPPKKHY 163
           +PPP  +  SPPP  H     PPP   HY    PPPP  H  Y PPP  +H PPPP  H 
Sbjct: 321 TPPPYDEQQSPPPPPHHRPRRPPPHGHHY----PPPPPYHWPYCPPPHGHHYPPPPPYHG 376

Query: 164 VYKSPPPPVKHYSPPPVYHSP-----------PPPKKHYVYKSPPPPVKHYSPPPVYHSP 310
            Y  PP    H  PPP +H P           PPP  H+ Y  PPP   HY PPP YH P
Sbjct: 377 PYCPPPHGHHHPPPPPHHHRPRRPPPHGHHHLPPPPYHWPY-CPPPHGHHYPPPPPYHGP 435

Query: 311 --PPPKKHY 331
             PPP  H+
Sbjct: 436 YCPPPHGHH 444

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 56/164 (34%), Positives = 68/164 (41%), Gaps = 54/164 (32%)
 Frame = +2

Query: 2   KSPPPPV---KHYSPPPVYHSPPPPKKHYV------------------------------ 82
           K+PPPP    +H+ P P +H  PPP +                                 
Sbjct: 263 KAPPPPCHNRQHHHPHPPHHDQPPPTQEETEHPSSIPPLYDKQDRPLLIQEKSDFPPSTP 322

Query: 83  -----YKSPPPPVKHYS---PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS----- 223
                 +SPPPP  H     PP  +H PPPP  H+ Y  PPP   HY PPP YH      
Sbjct: 323 PPYDEQQSPPPPPHHRPRRPPPHGHHYPPPPPYHWPY-CPPPHGHHYPPPPPYHGPYCPP 381

Query: 224 ------PPPPKKHYVYKSPPPPVKHYSPPPVYHSP--PPPKKHY 331
                 PPPP  H+  + PPP   H+ PPP YH P  PPP  H+
Sbjct: 382 PHGHHHPPPPPHHHRPRRPPPHGHHHLPPPPYHWPYCPPPHGHH 425

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/112 (44%), Positives = 55/112 (49%), Gaps = 4/112 (3%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           PPPP  H  Y PPP  +H PPPP  H+  + PPP   H+ PPP YH P           P
Sbjct: 369 PPPPPYHGPYCPPPHGHHHPPPPPHHHRPRRPPPHGHHHLPPPPYHWP---------YCP 419

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP-PPPKKHY 331
           PP   HY PPP YH P           PPP   HY PPP YH P  PP  H+
Sbjct: 420 PPHGHHYPPPPPYHGP---------YCPPPHGHHYPPPPPYHGPYCPPHGHH 462

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/83 (42%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           + PPP   H+ PPP YH P           PPP   HY PPP YH P           PP
Sbjct: 398 RRPPPHGHHHLPPPPYHWP---------YCPPPHGHHYPPPPPYHGP---------YCPP 439

Query: 182 PPVKHYSPPPVYHSP-PPPKKHY 247
           P   HY PPP YH P  PP  H+
Sbjct: 440 PHGHHYPPPPPYHGPYCPPHGHH 462

[101][TOP]
>UniRef100_C5YWZ0 Putative uncharacterized protein Sb09g030460 n=1 Tax=Sorghum
           bicolor RepID=C5YWZ0_SORBI
          Length = 642

 Score =  110 bits (274), Expect = 6e-23
 Identities = 54/115 (46%), Positives = 62/115 (53%), Gaps = 7/115 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHS--PPPPKKHYVYKSPPPPVKHYSPPPVY-HSPPPPKKHYVYKSP 178
           PPPP + Y PPP  H   PPPP + Y    PPPP +H  PPP   + PPPP +H     P
Sbjct: 94  PPPPPRGYGPPPPQHQHVPPPPPRGY---GPPPPGQHMPPPPPRGYGPPPPGQHMPPPPP 150

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSP----PPPVKHYSPPPVYHSPPPPKKHY 331
           PPP  H  PPP  H PPPP   +    P    PPP  H  PPP  H PPPP +H+
Sbjct: 151 PPPHGHGPPPPGQHVPPPPPHGHGPPLPGQHMPPPHGHGPPPPGQHMPPPPPRHH 205

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/120 (46%), Positives = 62/120 (51%), Gaps = 13/120 (10%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVY----HSPPPPKKHYVYKSPPPPVKH-------YSPPPVYHSPPPPK 154
           PPPP +H  PPP      H PPPP +H     PPPP  H       + PPP  H PPPP 
Sbjct: 138 PPPPGQHMPPPPPPPPHGHGPPPPGQHV---PPPPPHGHGPPLPGQHMPPPHGHGPPPPG 194

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKH 328
           +H     PPPP  H  PPP  H PPPP  H     PPPP +H  PPP    H PPPP +H
Sbjct: 195 QHM---PPPPPRHHGPPPPGQHVPPPPPPH--GHGPPPPGQHVPPPPPPHGHGPPPPGQH 249

 Score =  105 bits (261), Expect = 2e-21
 Identities = 54/114 (47%), Positives = 62/114 (54%), Gaps = 7/114 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVY-HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP-- 178
           PPPP +H  PPP   + PPPP +H     PPPP  H  PPP  H PPPP   +    P  
Sbjct: 121 PPPPGQHMPPPPPRGYGPPPPGQHMPPPPPPPPHGHGPPPPGQHVPPPPPHGHGPPLPGQ 180

Query: 179 --PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH 328
             PPP  H  PPP  H PPPP +H+    PPPP +H  PPP  H   PPPP +H
Sbjct: 181 HMPPPHGHGPPPPGQHMPPPPPRHH---GPPPPGQHVPPPPPPHGHGPPPPGQH 231

 Score =  103 bits (257), Expect = 6e-21
 Identities = 52/113 (46%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSP----PPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           PPPP  H  PPP  H PPPP   +    P    PPP  H  PPP  H PPPP +H+    
Sbjct: 150 PPPPHGHGPPPPGQHVPPPPPHGHGPPLPGQHMPPPHGHGPPPPGQHMPPPPPRHH---G 206

Query: 176 PPPPVKHYSPPPVYHS--PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PPPP +H  PPP  H   PPPP +H     PPPP   + PPP     PPP+ H
Sbjct: 207 PPPPGQHVPPPPPPHGHGPPPPGQHV---PPPPPPHGHGPPPPGQHVPPPRGH 256

 Score =  101 bits (251), Expect = 3e-20
 Identities = 53/113 (46%), Positives = 58/113 (51%), Gaps = 9/113 (7%)
 Frame = +2

Query: 8   PPPPVKH-------YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 166
           PPPP  H       + PPP  H PPPP +H     PPPP  H  PPP  H PPPP  H  
Sbjct: 167 PPPPHGHGPPLPGQHMPPPHGHGPPPPGQHM---PPPPPRHHGPPPPGQHVPPPPPPH-- 221

Query: 167 YKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              PPPP +H  PPP    H PPPP +H      PPP  H  PPP   +PPPP
Sbjct: 222 GHGPPPPGQHVPPPPPPHGHGPPPPGQHV-----PPPRGHGPPPPHQQAPPPP 269

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/119 (44%), Positives = 64/119 (53%), Gaps = 10/119 (8%)
 Frame = +2

Query: 2   KSPPPPVK--------HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPK 154
           ++PPPP          H  PPP  + PPPP+  +V   PPPP + Y PPP   H PPPP 
Sbjct: 77  RNPPPPGPPPQWSSQGHPPPPPRGYGPPPPQHQHV---PPPPPRGYGPPPPGQHMPPPPP 133

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY-HSPPPPKKH 328
           + Y    PPPP +H  PPP    PPPP  H     PPPP +H  PPP + H PP P +H
Sbjct: 134 RGY---GPPPPGQHMPPPP----PPPPHGH----GPPPPGQHVPPPPPHGHGPPLPGQH 181

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/115 (45%), Positives = 61/115 (53%), Gaps = 11/115 (9%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVY-HSPPPPKKHYVYK---SPPPPVKHYSPPPV-YHSPPPPKKHYVYK 172
           PPPP +H  PPP + H PP P +H        PPPP +H  PPP  +H PPPP +H    
Sbjct: 158 PPPPGQHVPPPPPHGHGPPLPGQHMPPPHGHGPPPPGQHMPPPPPRHHGPPPPGQHV--P 215

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP----PPVKHYSPPPVYH--SPPPP 319
            PPPP  H  PPP  H PPPP  H     PP    PP + + PPP +    PPPP
Sbjct: 216 PPPPPHGHGPPPPGQHVPPPPPPHGHGPPPPGQHVPPPRGHGPPPPHQQAPPPPP 270

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/102 (45%), Positives = 54/102 (52%), Gaps = 3/102 (2%)
 Frame = +2

Query: 23  KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS--PPPPKKHYVYKSPPPPVKH 196
           +H+ PP     P PP +      PPPP + Y PPP  H   PPPP + Y    PPPP +H
Sbjct: 71  EHWVPPRNPPPPGPPPQWSSQGHPPPPPRGYGPPPPQHQHVPPPPPRGY---GPPPPGQH 127

Query: 197 YSPPPVY-HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             PPP   + PPPP +H     PPPP  H  PPP  H PPPP
Sbjct: 128 MPPPPPRGYGPPPPGQHMPPPPPPPPHGHGPPPPGQHVPPPP 169

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/97 (49%), Positives = 55/97 (56%), Gaps = 1/97 (1%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           PPPP +H  PPP  +H PPPP +H     PPPP  H  PPP  H PPPP  H     PPP
Sbjct: 190 PPPPGQHMPPPPPRHHGPPPPGQHV--PPPPPPHGHGPPPPGQHVPPPPPPHG--HGPPP 245

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 295
           P +H  PPP  H PPPP +    ++PPPP     PPP
Sbjct: 246 PGQHV-PPPRGHGPPPPHQ----QAPPPP-----PPP 272

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/93 (44%), Positives = 48/93 (51%), Gaps = 4/93 (4%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKS 175
           PPPP +H+ PPP   +  PPPP   +    PPPP +H  PPP    H PPPP +H     
Sbjct: 198 PPPPPRHHGPPPPGQHVPPPPPPHGH---GPPPPGQHVPPPPPPHGHGPPPPGQHV---- 250

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
            PPP  H  PPP   +PPPP        PP PV
Sbjct: 251 -PPPRGHGPPPPHQQAPPPP-------PPPEPV 275

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 47/126 (37%), Positives = 60/126 (47%), Gaps = 18/126 (14%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVY-KSPPPPVKHYSPPPVYHS---PPPPKKHYVYK 172
           +P     H   PP +H     ++H+V  ++PPPP     PPP + S   PPPP + Y   
Sbjct: 53  APAAAPNHVHHPPHHHQ----QEHWVPPRNPPPP----GPPPQWSSQGHPPPPPRGY--- 101

Query: 173 SPPPPVKHY----------SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV----YHSP 310
            PPPP   +           PPP  H PPPP + Y    PPPP +H  PPP      H P
Sbjct: 102 GPPPPQHQHVPPPPPRGYGPPPPGQHMPPPPPRGY---GPPPPGQHMPPPPPPPPHGHGP 158

Query: 311 PPPKKH 328
           PPP +H
Sbjct: 159 PPPGQH 164

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 39/104 (37%), Positives = 51/104 (49%), Gaps = 4/104 (3%)
 Frame = +2

Query: 29  YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-PPKKHYVYKSPPPPVKHYSP 205
           Y P P   + P    ++V+  P    + +  PP    PP PP +      PPPP + Y P
Sbjct: 44  YRPFPSQAAAPAAAPNHVHHPPHHHQQEHWVPPRNPPPPGPPPQWSSQGHPPPPPRGYGP 103

Query: 206 PPVYHS--PPPPKKHYVYKSPPPPVKHYSPPPVY-HSPPPPKKH 328
           PP  H   PPPP + Y    PPPP +H  PPP   + PPPP +H
Sbjct: 104 PPPQHQHVPPPPPRGY---GPPPPGQHMPPPPPRGYGPPPPGQH 144

[102][TOP]
>UniRef100_B9IKD0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IKD0_POPTR
          Length = 190

 Score =  110 bits (274), Expect = 6e-23
 Identities = 63/136 (46%), Positives = 70/136 (51%), Gaps = 26/136 (19%)
 Frame = +2

Query: 2   KSPPPPV--KHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKK 157
           KSPPPP   KH SPPP    Y SPPPP     Y  PPP   + SPPP   ++H  PPP  
Sbjct: 39  KSPPPPFHNKHKSPPPPPHKYKSPPPPHHKCKYSPPPPVYTYRSPPPPTPMHHKSPPPSP 98

Query: 158 HYVYKSPPPPVKHYSPPPV----------YHSPPPPKKHYVYKSPPPPVKH------YSP 289
           H     PPPP ++ SPPP           Y SPPPP   Y Y SPPPP  H      +SP
Sbjct: 99  HMFKSPPPPPYRYISPPPPPPHPPCHAYKYLSPPPPPS-YKYASPPPPKHHHHHKHKWSP 157

Query: 290 PP--VYHSPPPPKKHY 331
            P   Y SPPPP  +Y
Sbjct: 158 YPFITYMSPPPPHHNY 173

 Score =  102 bits (254), Expect = 1e-20
 Identities = 59/119 (49%), Positives = 68/119 (57%), Gaps = 21/119 (17%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHYSPPPVYH----SPPPPKKHYVYKSPPPP--VKHYSPP 208
           Y SPPPP  +     PPPP K+ SPPP +H    SPPPP   Y Y+SPPPP  + H SPP
Sbjct: 38  YKSPPPPFHNKHKSPPPPPHKYKSPPPPHHKCKYSPPPPV--YTYRSPPPPTPMHHKSPP 95

Query: 209 PVYH---SPPPPKKHYVYKSPPPP--------VKHYSPPP----VYHSPPPPKKHYVYK 340
           P  H   SPPPP   Y+  SPPPP         K+ SPPP     Y SPPPPK H+ +K
Sbjct: 96  PSPHMFKSPPPPPYRYI--SPPPPPPHPPCHAYKYLSPPPPPSYKYASPPPPKHHHHHK 152

 Score =  101 bits (252), Expect = 2e-20
 Identities = 58/126 (46%), Positives = 67/126 (53%), Gaps = 15/126 (11%)
 Frame = +2

Query: 5   SPPPPVKHY-SPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 172
           SPPPPV  Y SPPP   ++H  PPP  H     PPPP ++ SPPP    P PP   Y Y 
Sbjct: 72  SPPPPVYTYRSPPPPTPMHHKSPPPSPHMFKSPPPPPYRYISPPP--PPPHPPCHAYKYL 129

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYK---SPPPPVKHYSPPPVYH--------SPPPP 319
           SPPPP     P   Y SPPPPK H+ +K   SP P + + SPPP +H        SPPPP
Sbjct: 130 SPPPP-----PSYKYASPPPPKHHHHHKHKWSPYPFITYMSPPPPHHNYPDYHYSSPPPP 184

Query: 320 KKHYVY 337
                Y
Sbjct: 185 PPIVAY 190

[103][TOP]
>UniRef100_Q9STN1 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STN1_ARATH
          Length = 350

 Score =  109 bits (273), Expect = 8e-23
 Identities = 66/135 (48%), Positives = 77/135 (57%), Gaps = 24/135 (17%)
 Frame = +2

Query: 8   PPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHY 163
           PPPP  + SPPP    +Y+SPP P   YVYKSPPPP   YS PP    +Y+SPPPP   Y
Sbjct: 66  PPPPYVYNSPPPPPPYIYNSPPRPP--YVYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVY 123

Query: 164 --------VYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYSPPP---- 295
                   +Y SPPPP   Y+  P    +Y SPPPP   YVY S P  +  YS PP    
Sbjct: 124 KSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPPPPP--YVYNSAPRVLFIYSSPPPPPY 181

Query: 296 VYHSPPPPKKHYVYK 340
           VY+SPPPP   YVY+
Sbjct: 182 VYNSPPPPP--YVYE 194

 Score =  108 bits (270), Expect = 2e-22
 Identities = 64/128 (50%), Positives = 73/128 (57%), Gaps = 19/128 (14%)
 Frame = +2

Query: 11  PPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           P P  + SPPP   +Y SPPPP   YVY SPPPP     PP +Y+SPP P   YVYKSPP
Sbjct: 47  PSPYVYKSPPPSPYLYSSPPPPP--YVYNSPPPP-----PPYIYNSPPRPP--YVYKSPP 97

Query: 182 PPVKHYSPPP----VYHSPPPPKKHY--------VYKSPPPPVKHYSPPP----VYHSPP 313
           PP   YS PP    +Y+SPPPP   Y        +Y SPPPP   Y+  P    +Y SPP
Sbjct: 98  PPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPP 157

Query: 314 PPKKHYVY 337
           PP   YVY
Sbjct: 158 PPP--YVY 163

 Score =  103 bits (256), Expect = 8e-21
 Identities = 63/117 (53%), Positives = 69/117 (58%), Gaps = 4/117 (3%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPP    YSPP     P P    YVYKSPPP       P +Y SPPPP   YVY SPP
Sbjct: 33  QSPPPQPYVYSPP----LPSP----YVYKSPPPS------PYLYSSPPPPP--YVYNSPP 76

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYK 340
           PP     PP +Y+SPP P   YVYKSPPPP   YS PP    +Y+SPPPP   YVYK
Sbjct: 77  PP-----PPYIYNSPPRPP--YVYKSPPPPPFVYSSPPPPTYIYNSPPPPP--YVYK 124

 Score =  103 bits (256), Expect = 8e-21
 Identities = 69/165 (41%), Positives = 77/165 (46%), Gaps = 52/165 (31%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP----VYHSPPPPKKHY--------VYKSPPPPVKHY---------- 115
           KSPPPP   YS PP    +Y+SPPPP   Y        +Y SPPPP   Y          
Sbjct: 94  KSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIY 153

Query: 116 -SPPP-------------VYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKK 241
            SPPP             +Y SPPPP   YVY SPPPP   Y   P    +Y SPPPP  
Sbjct: 154 SSPPPPPYVYNSAPRVLFIYSSPPPPP--YVYNSPPPPPYVYESVPRIPFIYSSPPPPPY 211

Query: 242 HY--------VYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYK 340
            Y        +Y SPPPP   Y+  P    +Y SPPPP   YVYK
Sbjct: 212 VYNSAPRIPFIYSSPPPPPYVYNSAPRVPFIYSSPPPPP--YVYK 254

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 66/163 (40%), Positives = 75/163 (46%), Gaps = 52/163 (31%)
 Frame = +2

Query: 5   SPPPPVKHY-----------SPPP---VYHSPPPPKKHY--------VYKSPPPPVKHYS 118
           SPPPP   Y           SPPP   VY+SPPPP   Y        +Y SPPPP   Y+
Sbjct: 155 SPPPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYN 214

Query: 119 PPP----VYHSPPP--------PKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYV 250
             P    +Y SPPP        P+  ++Y SPPPP   Y   P    +Y SPPPP   YV
Sbjct: 215 SAPRIPFIYSSPPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPP--YV 272

Query: 251 YKS-----------PPPPVKHYSPPPV---YHSPPPPKKHYVY 337
           Y S           PPPP  + S P V   Y SPPPP   YVY
Sbjct: 273 YNSAPRIPFIYSSLPPPPYVYNSAPRVPFIYSSPPPPP--YVY 313

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 52/126 (41%), Positives = 62/126 (49%), Gaps = 22/126 (17%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP----VYHSPPPPKKHY--------VYKSPPPPVKHYSPPP----VYH 136
           SPPPP   Y+  P    +Y SPPPP   Y        +Y SPPPP   Y   P    +Y 
Sbjct: 205 SPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYS 264

Query: 137 SPPPPKKHYVYKSPP--PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP----V 298
           SPPPP   YVY S P  P +    PPP Y     P+  ++Y SPPPP   Y+  P    +
Sbjct: 265 SPPPPP--YVYNSAPRIPFIYSSLPPPPYVYNSAPRVPFIYSSPPPPPYVYNSAPRIPFI 322

Query: 299 YHSPPP 316
           Y SPPP
Sbjct: 323 YSSPPP 328

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 59/160 (36%), Positives = 72/160 (45%), Gaps = 50/160 (31%)
 Frame = +2

Query: 8   PPPPVKHYSPPP-------------VYHSPPPPKKHY--------VYKSPPPPVKHYSPP 124
           PPPP  + SPPP             +Y SPPPP   Y        +Y SPPPP   Y+  
Sbjct: 177 PPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSA 236

Query: 125 P----VYHSPPPPKKHY--------VYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYK 256
           P    +Y SPPPP   Y        +Y SPPPP   Y+  P    +Y S PPP   YVY 
Sbjct: 237 PRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSLPPPP--YVYN 294

Query: 257 S-----------PPPPVKHYSPP--PVYHSPPPPKKHYVY 337
           S           PPPP  + S P  P  +S PPP  H+++
Sbjct: 295 SAPRVPFIYSSPPPPPYVYNSAPRIPFIYSSPPP--HHMF 332

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 44/114 (38%), Positives = 54/114 (47%), Gaps = 29/114 (25%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP----VYHSPPPPKKHY--------VYKSPPPPVKHYSPPP----VYH 136
           SPPPP   Y+  P    +Y SPPPP   Y        +Y SPPPP   Y+  P    +Y 
Sbjct: 225 SPPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYS 284

Query: 137 SPPPPKKHYVYKS-----------PPPPVKHYSPP--PVYHSPPPPKKHYVYKS 259
           S PPP   YVY S           PPPP  + S P  P  +S PPP  H+++ S
Sbjct: 285 SLPPPP--YVYNSAPRVPFIYSSPPPPPYVYNSAPRIPFIYSSPPP--HHMFTS 334

[104][TOP]
>UniRef100_Q43504 Extensin-like protein Dif10 (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q43504_SOLLC
          Length = 396

 Score =  109 bits (273), Expect = 8e-23
 Identities = 58/118 (49%), Positives = 64/118 (54%), Gaps = 11/118 (9%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPP-PKKHYVYK 172
           P P K+Y  P  Y SPPPP  +Y      YKSPPPP  +    P Y SPPP P     YK
Sbjct: 247 PAPQKYYKSPVYYKSPPPPTTYYEKSPSYYKSPPPPPYYKESTPYYKSPPPSPYYKESYK 306

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPV-YHSPPPPKKHY 331
           SPPPP  +    P Y SPPPP  +      YKSPPPP KHY   P  Y+SPPPP   Y
Sbjct: 307 SPPPPPYYEEFTPSYKSPPPPPYYKESTPSYKSPPPPPKHYDQSPTSYNSPPPPPPAY 364

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/121 (49%), Positives = 65/121 (53%), Gaps = 11/121 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY----V 166
           KSPPPP  +    P Y SPPP P     YKSPPPP  +    P Y SPPPP  +      
Sbjct: 277 KSPPPPPYYKESTPYYKSPPPSPYYKESYKSPPPPPYYEEFTPSYKSPPPPPYYKESTPS 336

Query: 167 YKSPPPPVKHYSPPPV-YHSPPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           YKSPPPP KHY   P  Y+SPPPP   Y      Y SPPPP K Y     Y SPPPP  +
Sbjct: 337 YKSPPPPPKHYDQSPTSYNSPPPPPPAYYKQTPTYASPPPPQK-YEQSVTYASPPPPSTN 395

Query: 329 Y 331
           Y
Sbjct: 396 Y 396

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 55/129 (42%), Positives = 68/129 (52%), Gaps = 19/129 (14%)
 Frame = +2

Query: 2   KSPPPPVKHY---SPPPVYHSPPPPKKHYVYKSPPP--------PVKHY--SPPP-VYHS 139
           KSP P   +Y   +P   Y+  P P K+Y YKSP P        P K+Y  SP P  Y+ 
Sbjct: 158 KSPAPSKNYYKAPTPSKYYYKSPAPSKYY-YKSPSPAKYYKSPAPSKYYYKSPSPRKYYK 216

Query: 140 PPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHY----VYKSPPPPVKHYSPPPVYH 304
            P P KHY YKSP P   + SP P  Y+  P P+K+Y     YKSPPPP  +Y   P Y+
Sbjct: 217 SPAPSKHYYYKSPSPSKYYKSPAPYKYYKSPAPQKYYKSPVYYKSPPPPTTYYEKSPSYY 276

Query: 305 SPPPPKKHY 331
             PPP  +Y
Sbjct: 277 KSPPPPPYY 285

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 57/147 (38%), Positives = 67/147 (45%), Gaps = 42/147 (28%)
 Frame = +2

Query: 17  PVKHYSPPPV----YHSPPPPKKHY-------VYKSPPPPVKHY---SPPPVYHSPPPPK 154
           P KHY   PV    Y SP P K++Y        YKSP P   +Y   +P   Y+  P P 
Sbjct: 124 PSKHYYKAPVVAKYYKSPAPSKQYYKAPVVVKYYKSPAPSKNYYKAPTPSKYYYKSPAPS 183

Query: 155 KHYVYKSP--------PPPVKHY--SPPP-VYHSPPPPKKHYVYKSP------------- 262
           K+Y YKSP        P P K+Y  SP P  Y+  P P KHY YKSP             
Sbjct: 184 KYY-YKSPSPAKYYKSPAPSKYYYKSPSPRKYYKSPAPSKHYYYKSPSPSKYYKSPAPYK 242

Query: 263 ----PPPVKHYSPPPVYHSPPPPKKHY 331
               P P K+Y  P  Y SPPPP  +Y
Sbjct: 243 YYKSPAPQKYYKSPVYYKSPPPPTTYY 269

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 56/144 (38%), Positives = 66/144 (45%), Gaps = 36/144 (25%)
 Frame = +2

Query: 17  PVKHYSPPPV---YHSPPPPKKHYVYKSP--------PPPVKHYSPPPV----YHSPPPP 151
           P KHY   P+   Y+    P KHY YK+P          P KHY   PV    Y SP P 
Sbjct: 86  PSKHYYKAPIVAKYYKSHAPSKHY-YKAPIVTKYYRSHAPSKHYYKAPVVAKYYKSPAPS 144

Query: 152 KKHY-------VYKSPPPPVKHY---SPPPVYHSPPPPKKHYVYKSP--------PPPVK 277
           K++Y        YKSP P   +Y   +P   Y+  P P K Y YKSP        P P K
Sbjct: 145 KQYYKAPVVVKYYKSPAPSKNYYKAPTPSKYYYKSPAPSK-YYYKSPSPAKYYKSPAPSK 203

Query: 278 HY--SPPP-VYHSPPPPKKHYVYK 340
           +Y  SP P  Y+  P P KHY YK
Sbjct: 204 YYYKSPSPRKYYKSPAPSKHYYYK 227

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 48/119 (40%), Positives = 56/119 (47%), Gaps = 17/119 (14%)
 Frame = +2

Query: 26  HYSPPPVYHSPPPP-KKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSP------ 178
           H SP P Y  P      HY YKS  P   +Y  P V  Y+    P KHY YK+P      
Sbjct: 61  HESPSPYYKKPEKHVPSHYYYKSHAPSKHYYKAPIVAKYYKSHAPSKHY-YKAPIVTKYY 119

Query: 179 --PPPVKHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHY-SPPPV--YHSPPPPKKHY 331
               P KHY   PV   Y+  P P K Y YK+P   VK+Y SP P   Y+  P P K+Y
Sbjct: 120 RSHAPSKHYYKAPVVAKYYKSPAPSKQY-YKAPVV-VKYYKSPAPSKNYYKAPTPSKYY 176

[105][TOP]
>UniRef100_Q41805 Extensin-like protein n=1 Tax=Zea mays RepID=Q41805_MAIZE
          Length = 1188

 Score =  109 bits (273), Expect = 8e-23
 Identities = 59/108 (54%), Positives = 59/108 (54%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPPP    SPPP   SPPPP       SPPPPVK   PP    SPPPP      KSPP
Sbjct: 1010 KSPPPPAPVSSPPPPVKSPPPPAP---VSSPPPPVKSPPPPAPVSSPPPP-----VKSPP 1061

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            PP    SPPP   SPPPP       SPPPPVK   PP    SPPPP K
Sbjct: 1062 PPAPISSPPPPVKSPPPPAP---VSSPPPPVKSPPPPAPVSSPPPPIK 1106

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/107 (55%), Positives = 61/107 (57%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPVK  SPP    SP PP    V  SPPPPVK   PP    SPPPP+     KSPPP
Sbjct: 515 SPPPPVKTTSPPAPIGSPSPPPPVSVV-SPPPPVKSPPPPAPVGSPPPPE-----KSPPP 568

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           P    SPPP   SPPPP    +  SPPPPVK   PP    SPPPP K
Sbjct: 569 PAPVASPPPPVKSPPPPT---LVASPPPPVKSPPPPAPVASPPPPVK 612

 Score =  105 bits (263), Expect = 1e-21
 Identities = 57/106 (53%), Positives = 58/106 (54%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP    SPPP   SPPPP       SPPPPVK   PP +  SPPPP      KSPP
Sbjct: 548 KSPPPPAPVGSPPPPEKSPPPPAP---VASPPPPVKSPPPPTLVASPPPP-----VKSPP 599

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP    SPPP   SPPPP       SPPPP    S PP   SPPPP
Sbjct: 600 PPAPVASPPPPVKSPPPPTP---VASPPPPAPVASSPPPMKSPPPP 642

 Score =  104 bits (260), Expect = 3e-21
 Identities = 59/109 (54%), Positives = 60/109 (55%), Gaps = 3/109 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP    SPPP   SPPPP    +  SPPPPVK   PP    SPPPP      KSPP
Sbjct: 564 KSPPPPAPVASPPPPVKSPPPPT---LVASPPPPVKSPPPPAPVASPPPP-----VKSPP 615

Query: 182 PPVKHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP    SPP   PV  SPPP       KSPPPP    SPPP   SPPPP
Sbjct: 616 PPTPVASPPPPAPVASSPPP------MKSPPPPTPVSSPPPPEKSPPPP 658

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/108 (50%), Positives = 59/108 (54%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPVK   PP +  SPPPP      KSPPPP    SPPP   SPPPP       SPPP
Sbjct: 574 SPPPPVKSPPPPTLVASPPPP-----VKSPPPPAPVASPPPPVKSPPPPTP---VASPPP 625

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           P    S PP   SPPPP       SPPPP K   PPP   S PPP+++
Sbjct: 626 PAPVASSPPPMKSPPPPTP---VSSPPPPEKSPPPPPPAKSTPPPEEY 670

 Score =  102 bits (254), Expect = 1e-20
 Identities = 57/111 (51%), Positives = 57/111 (51%), Gaps = 5/111 (4%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPPPKKHYV 166
            KS PPP    SPPP   S PPP           KSPPPP    SPPP   SPPPP     
Sbjct: 977  KSSPPPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAP--- 1033

Query: 167  YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              SPPPPVK   PP    SPPPP      KSPPPP    SPPP   SPPPP
Sbjct: 1034 VSSPPPPVKSPPPPAPVSSPPPP-----VKSPPPPAPISSPPPPVKSPPPP 1079

 Score =  100 bits (249), Expect = 5e-20
 Identities = 60/117 (51%), Positives = 61/117 (52%), Gaps = 9/117 (7%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPPP    SPPP   SPPPP       SPPPPVK   PP    SPPPP      KSPP
Sbjct: 1042 KSPPPPAPVSSPPPPVKSPPPPAP---ISSPPPPVKSPPPPAPVSSPPPP-----VKSPP 1093

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH---------YSPPPVYHSPPPPKK 325
            PP    SPPP   SPPPP    V   PP PVK           SPPPV  +P PPKK
Sbjct: 1094 PPAPVSSPPPPIKSPPPPAP--VSSPPPAPVKPPSLPPPAPVSSPPPVV-TPAPPKK 1147

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 58/108 (53%), Positives = 58/108 (53%), Gaps = 1/108 (0%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPP 181
            SPPP      PPP   SPPPP       SPPPPVK   PP PV  SPPPP      KSPP
Sbjct: 995  SPPPAPMSSPPPPEVKSPPPPAP---VSSPPPPVKSPPPPAPVS-SPPPP-----VKSPP 1045

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            PP    SPPP   SPPPP       SPPPPVK   PP    SPPPP K
Sbjct: 1046 PPAPVSSPPPPVKSPPPPAP---ISSPPPPVKSPPPPAPVSSPPPPVK 1090

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 54/112 (48%), Positives = 59/112 (52%), Gaps = 4/112 (3%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP    SPPP   SPPPP       SPPPP    S PP   SPPPP       SPP
Sbjct: 596 KSPPPPAPVASPPPPVKSPPPPTP---VASPPPPAPVASSPPPMKSPPPPTP---VSSPP 649

Query: 182 PPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKK 325
           PP K   PPP   S PPP+++       KS PPP K   PP +  SPPP +K
Sbjct: 650 PPEKSPPPPPPAKSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPPPQEK 701

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 57/112 (50%), Positives = 60/112 (53%), Gaps = 5/112 (4%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP----KKHYVY 169
           KSPPPP    SPPP   SPPPP       SPPPPVK   PP    SPPPP          
Sbjct: 580 KSPPPPTLVASPPPPVKSPPPPAP---VASPPPPVKSPPPPTPVASPPPPAPVASSPPPM 636

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPK 322
           KSPPPP    SPPP   SPPPP      KS PPP ++ +PP  V  SPPP K
Sbjct: 637 KSPPPPTPVSSPPPPEKSPPPPPPA---KSTPPPEEYPTPPTSVKSSPPPEK 685

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 56/110 (50%), Positives = 60/110 (54%), Gaps = 3/110 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPP-VYH-SPPPPKKHYVYKS 175
           +PPP +   SPP     SPPPP K     SPP P+   SPPP V   SPPPP      KS
Sbjct: 498 TPPPSLVKLSPPQAPVGSPPPPVKT---TSPPAPIGSPSPPPPVSVVSPPPP-----VKS 549

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           PPPP    SPPP   SPPPP       SPPPPVK   PP +  SPPPP K
Sbjct: 550 PPPPAPVGSPPPPEKSPPPPAP---VASPPPPVKSPPPPTLVASPPPPVK 596

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/115 (45%), Positives = 55/115 (47%), Gaps = 11/115 (9%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPP-----PKKHYV 166
           P PPV   SPP    SP P  +     +PPP +   SPP  PV   PPP     P     
Sbjct: 473 PTPPVPGKSPPAT--SPSPQVQPPAASTPPPSLVKLSPPQAPVGSPPPPVKTTSPPAPIG 530

Query: 167 YKSPPPPVKHYSPPPVYHSPPPP----KKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             SPPPPV   SPPP   SPPPP          KSPPPP    SPPP   SPPPP
Sbjct: 531 SPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVASPPPPVKSPPPP 585

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/115 (43%), Positives = 52/115 (45%), Gaps = 8/115 (6%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPP----KKHYVYKSPPPPVKHYSPPPVYHSPPPP----KK 157
            KS PPP     PPP+  S PPP          KS PPPV   SPPP   S PPP      
Sbjct: 897  KSSPPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPPPAPVSSP 956

Query: 158  HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
                KS PPP     PPP   S PPP       SPPP  K   PP    SPPPP+
Sbjct: 957  PATPKSSPPPAPVNLPPPEVKSSPPPTP---VSSPPPAPKSSPPPAPMSSPPPPE 1008

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/110 (49%), Positives = 56/110 (50%), Gaps = 2/110 (1%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KS PPPV   SPPP   S PPP       S PP     SPPP   + PPP+     KS P
Sbjct: 929  KSSPPPVVVSSPPPTVKSSPPPAP----VSSPPATPKSSPPPAPVNLPPPE----VKSSP 980

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-VKHYSPP-PVYHSPPPPKK 325
            PP    SPPP   S PPP       SPPPP VK   PP PV  SPPPP K
Sbjct: 981  PPTPVSSPPPAPKSSPPPAP---MSSPPPPEVKSPPPPAPVS-SPPPPVK 1026

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 52/130 (40%), Positives = 57/130 (43%), Gaps = 25/130 (19%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV----YK 172
            SPPPP    S PP   SPPPP       SPPPP K   PPP   S PPP+++       K
Sbjct: 622  SPPPPAPVASSPPPMKSPPPPTP---VSSPPPPEKSPPPPPPAKSTPPPEEYPTPPTSVK 678

Query: 173  SPPPPVKHYSPPPVYHSPPP----------------PKKHYVYKSP---PPPVKHYSPPP 295
            S PPP K   PP +  SPPP                P+K    K P   PP     SPPP
Sbjct: 679  SSPPPEKSLPPPTLIPSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPP 738

Query: 296  --VYHSPPPP 319
              V   PP P
Sbjct: 739  APVSSPPPTP 748

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 52/108 (48%), Positives = 54/108 (50%), Gaps = 5/108 (4%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            S PP VK  SPPP   S PPP      KS PPPV+  SPPP   S PP        S PP
Sbjct: 759  SSPPSVKS-SPPPAPLSSPPPAPQ--VKSSPPPVQVSSPPPAPKSSPP----LAPVSSPP 811

Query: 185  PVKHYSPPPVYHSPPP--PKK---HYVYKSPPPPVKHYSPPPVYHSPP 313
             V+  SPPP   S PP  PK    H V  SPPP VK   PP    SPP
Sbjct: 812  QVEKTSPPPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPP 859

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 52/119 (43%), Positives = 58/119 (48%), Gaps = 14/119 (11%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSP---PPVYHSPPP------ 148
           P PV   +P P+     PP   YV  +PP     PP    SP   PP   +PPP      
Sbjct: 448 PSPVPAPAPMPMPTPHSPPADDYVPPTPPVPGKSPPATSPSPQVQPPAASTPPPSLVKLS 507

Query: 149 PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           P +  V  SPPPPVK  SPP    SP PP    V  SPPPPVK   PP    SPPPP+K
Sbjct: 508 PPQAPV-GSPPPPVKTTSPPAPIGSPSPPPPVSVV-SPPPPVKSPPPPAPVGSPPPPEK 564

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/122 (40%), Positives = 53/122 (43%), Gaps = 25/122 (20%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPPVK   PP    SPPPP      KSPPPP    SPPP   SPPPP    V   PP 
Sbjct: 1068 SPPPPVKSPPPPAPVSSPPPP-----VKSPPPPAPVSSPPPPIKSPPPPAP--VSSPPPA 1120

Query: 185  PVKH---------YSPPPVY----------------HSPPPPKKHYVYKSPPPPVKHYSP 289
            PVK           SPPPV                  S PPP  + +   P    K+ SP
Sbjct: 1121 PVKPPSLPPPAPVSSPPPVVTPAPPKKEEQSLPPPAESQPPPSFNDIILPPIMANKYASP 1180

Query: 290  PP 295
            PP
Sbjct: 1181 PP 1182

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 47/105 (44%), Positives = 50/105 (47%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KS PPP    SPPP   S PP        S PP VK   PP    SPPP  +    KS P
Sbjct: 733  KSSPPPAPVSSPPPTPVSSPPALAPV---SSPPSVKSSPPPAPLSSPPPAPQ---VKSSP 786

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
            PPV+  SPPP   S PP        S PP V+  SPPP   S PP
Sbjct: 787  PPVQVSSPPPAPKSSPP----LAPVSSPPQVEKTSPPPAPLSSPP 827

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 52/139 (37%), Positives = 54/139 (38%), Gaps = 33/139 (23%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP------------ 145
            K+ PPP    SPP    S PP   H V  SPPP VK   PP    SPP            
Sbjct: 815  KTSPPPAPLSSPPLAPKSSPP---HVVVSSPPPVVKSSPPPAPVSSPPLTPKPASPPAHV 871

Query: 146  -----------PPKKHYVY------KSPPPPVKHYSPPPVYHSPPPP----KKHYVYKSP 262
                       PP    V       KS PPP     PPP+  S PPP          KS 
Sbjct: 872  SSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSS 931

Query: 263  PPPVKHYSPPPVYHSPPPP 319
            PPPV   SPPP   S PPP
Sbjct: 932  PPPVVVSSPPPTVKSSPPP 950

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/126 (38%), Positives = 55/126 (43%), Gaps = 22/126 (17%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 172
            SPPPP K   PPP   S PPP+++       KS PPP K   PP +  SPPP +K     
Sbjct: 647  SPPPPEKSPPPPPPAKSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPPPQEKPTPPS 706

Query: 173  SP-----------PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-------YSPPPV 298
            +P           PP     SPP    S PPP    V   PP PV          SPP V
Sbjct: 707  TPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPPAP--VSSPPPTPVSSPPALAPVSSPPSV 764

Query: 299  YHSPPP 316
              SPPP
Sbjct: 765  KSSPPP 770

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 52/131 (39%), Positives = 55/131 (41%), Gaps = 26/131 (19%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP----------------PKKHYVYKSP---PPPVKHYSPP 124
            KS PPP K   PP +  SPPP                P+K    K P   PP     SPP
Sbjct: 678  KSSPPPEKSLPPPTLIPSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPP 737

Query: 125  PVYHSPPPPKKHYVYKSPP-------PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
            P   S PPP       SPP       PP    SPPP   S PPP      KS PPPV+  
Sbjct: 738  PAPVSSPPPTP---VSSPPALAPVSSPPSVKSSPPPAPLSSPPPAPQ--VKSSPPPVQVS 792

Query: 284  SPPPVYHSPPP 316
            SPPP   S PP
Sbjct: 793  SPPPAPKSSPP 803

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 45/99 (45%), Positives = 48/99 (48%), Gaps = 9/99 (9%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH---------YSPPPVYHSPPPPK 154
            KSPPPP    SPPP   SPPPP    V   PP PVK           SPPPV  +P PPK
Sbjct: 1090 KSPPPPAPVSSPPPPIKSPPPPAP--VSSPPPAPVKPPSLPPPAPVSSPPPVV-TPAPPK 1146

Query: 155  KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 271
            K    +S PPP +   PP       PP     Y SPPPP
Sbjct: 1147 KE--EQSLPPPAESQPPPSFNDIILPPIMANKYASPPPP 1183

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 53/134 (39%), Positives = 54/134 (40%), Gaps = 26/134 (19%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-------PPKKH 160
            KS PP V   SPPPV  S PPP       SPP   K  SPP    SPP       PP   
Sbjct: 831  KSSPPHVVVSSPPPVVKSSPPPAP---VSSPPLTPKPASPPAHVSSPPEVVKPSTPPAPT 887

Query: 161  YVYKSP--------------PPPVKHYSPPPVYHSPPP--PKKH---YVYKSPPPPVKHY 283
             V   P              PPP+   SPPP   S PP  PK      V  SPPP VK  
Sbjct: 888  TVISPPSEPKSSPPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSS 947

Query: 284  SPPPVYHSPPPPKK 325
             PP    SPP   K
Sbjct: 948  PPPAPVSSPPATPK 961

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 47/106 (44%), Positives = 48/106 (45%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            S PP     SPPP   S PPP       SPP      SPP V  SPPP        SPPP
Sbjct: 726  SSPPQTPKSSPPPAPVSSPPPTP---VSSPPALAPVSSPPSVKSSPPPAP----LSSPPP 778

Query: 185  -PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             P    SPPPV  S PPP      KS PP     SPP V  + PPP
Sbjct: 779  APQVKSSPPPVQVSSPPPAP----KSSPPLAPVSSPPQVEKTSPPP 820

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 46/117 (39%), Positives = 48/117 (41%), Gaps = 12/117 (10%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPPP----K 154
            + P PP     PP     P PPK+         KS PPP    SPPP   S PP      
Sbjct: 700  EKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPPAPVSSPPPTPVSSPPALAPVS 759

Query: 155  KHYVYKSPPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
                 KS PPP    SPPP   V  SPPP     V  S PPP    SPP    S PP
Sbjct: 760  SPPSVKSSPPPAPLSSPPPAPQVKSSPPP-----VQVSSPPPAPKSSPPLAPVSSPP 811

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 36/99 (36%), Positives = 43/99 (43%), Gaps = 1/99 (1%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 211
           +P P  H+PP      + +  P P     P P  HSPP       Y  P PPV   SPP 
Sbjct: 429 APMPSPHTPPDVSPEPLPEPSPVPAPAPMPMPTPHSPPADD----YVPPTPPVPGKSPPA 484

Query: 212 VYHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKK 325
              SP P  +     +PPP +   SPP     SPPPP K
Sbjct: 485 T--SPSPQVQPPAASTPPPSLVKLSPPQAPVGSPPPPVK 521

[106][TOP]
>UniRef100_B9RL73 LRX2, putative n=1 Tax=Ricinus communis RepID=B9RL73_RICCO
          Length = 766

 Score =  109 bits (273), Expect = 8e-23
 Identities = 57/121 (47%), Positives = 65/121 (53%), Gaps = 10/121 (8%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKKHYV 166
           SPPPPV+ Y+P P  HS PPP ++Y          PPPP   Y  PP +H PPPP     
Sbjct: 527 SPPPPVE-YTPSPPKHSSPPPVEYYPPPYQHQTSPPPPPPVQYQSPPYHHKPPPPPPPIE 585

Query: 167 YKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
           Y+SPP   K   PPP     Y SPPPP K+    SPPP   HY  PP   SPPPPK  Y 
Sbjct: 586 YQSPPYQHKTSPPPPPGYDTYSSPPPPPKNEYAHSPPPTHGHY--PPKRESPPPPKNEYT 643

Query: 335 Y 337
           +
Sbjct: 644 H 644

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/131 (44%), Positives = 65/131 (49%), Gaps = 20/131 (15%)
 Frame = +2

Query: 8   PPPPVKHYSP----------PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 157
           PPPP K  SP          PPV    PPP  HY   +PPPP K  SP   +  PPPP  
Sbjct: 459 PPPPTKRVSPKTHLPPPPPPPPVVEQSPPPPAHYHSYAPPPPTKKVSPSTHHAPPPPPPV 518

Query: 158 HYV---YKSPPPPV-------KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 307
            Y      SPPPPV       KH SPPPV + PPP  +H     PPPPV+ Y  PP +H 
Sbjct: 519 DYTPTPKHSPPPPVEYTPSPPKHSSPPPVEYYPPP-YQHQTSPPPPPPVQ-YQSPPYHHK 576

Query: 308 PPPPKKHYVYK 340
           PPPP     Y+
Sbjct: 577 PPPPPPPIEYQ 587

 Score =  103 bits (257), Expect = 6e-21
 Identities = 57/122 (46%), Positives = 65/122 (53%), Gaps = 14/122 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYV---YKSPPPPV-------KHYSPPPVYHSPPPPK 154
           +PPPP K  SP   +  PPPP   Y      SPPPPV       KH SPPPV +  PPP 
Sbjct: 496 APPPPTKKVSPSTHHAPPPPPPVDYTPTPKHSPPPPVEYTPSPPKHSSPPPVEYY-PPPY 554

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPK 322
           +H     PPPPV+ Y  PP +H PPPP     Y+SPP   K   PPP     Y SPPPP 
Sbjct: 555 QHQTSPPPPPPVQ-YQSPPYHHKPPPPPPPIEYQSPPYQHKTSPPPPPGYDTYSSPPPPP 613

Query: 323 KH 328
           K+
Sbjct: 614 KN 615

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/125 (45%), Positives = 67/125 (53%), Gaps = 20/125 (16%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKS--------PPPPVKHYSPPPVYH--SPPPPK 154
           S PPPV++Y PP  + + PPP     Y+S        PPPP   Y  PP  H  SPPPP 
Sbjct: 542 SSPPPVEYYPPPYQHQTSPPPPPPVQYQSPPYHHKPPPPPPPIEYQSPPYQHKTSPPPPP 601

Query: 155 KHYVYKSPPPPVKH---YSPPPVY-------HSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
            +  Y SPPPP K+   +SPPP +        SPPPPK  Y + SPPP   HY  PP   
Sbjct: 602 GYDTYSSPPPPPKNEYAHSPPPTHGHYPPKRESPPPPKNEYTH-SPPPTHGHY--PPKRE 658

Query: 305 SPPPP 319
           SPPPP
Sbjct: 659 SPPPP 663

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/127 (42%), Positives = 61/127 (48%), Gaps = 19/127 (14%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKK------HYVYKSPPPPVKHYS----------PPPVYHS 139
           PPPP    SP    H PPPP +      H     PPPP K  S          PPPV   
Sbjct: 425 PPPPTSKSSPSTRSHPPPPPPQTPAKSYHPPPSPPPPPTKRVSPKTHLPPPPPPPPVVEQ 484

Query: 140 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV---YKSPPPPVKHYSPPPVYHSP 310
            PPP  HY   +PPPP K  SP   +  PPPP   Y      SPPPPV+ Y+P P  HS 
Sbjct: 485 SPPPPAHYHSYAPPPPTKKVSPSTHHAPPPPPPVDYTPTPKHSPPPPVE-YTPSPPKHSS 543

Query: 311 PPPKKHY 331
           PPP ++Y
Sbjct: 544 PPPVEYY 550

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 59/143 (41%), Positives = 70/143 (48%), Gaps = 31/143 (21%)
 Frame = +2

Query: 2   KSPPPPVK-HYSPPPVYH--SPPPPKKHYVYKSPPPPVKH---YSPPPVY-------HSP 142
           K PPPP    Y  PP  H  SPPPP  +  Y SPPPP K+   +SPPP +        SP
Sbjct: 576 KPPPPPPPIEYQSPPYQHKTSPPPPPGYDTYSSPPPPPKNEYAHSPPPTHGHYPPKRESP 635

Query: 143 PPPKKHYVYKSPPPPVKHYSP----PPVYHSPPPPKKHYVYKSPPP-------------- 268
           PPPK  Y + SPPP   HY P    PP    PPP +  +   SPPP              
Sbjct: 636 PPPKNEYTH-SPPPTHGHYPPKRESPPPPPPPPPQEPFHPLPSPPPTGCITTPPSPPSST 694

Query: 269 PVKHYSPPPVYHSPPPPKKHYVY 337
           P  H+SP P    PPPP++H+ Y
Sbjct: 695 PSYHHSPSP---PPPPPEQHWHY 714

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/136 (38%), Positives = 63/136 (46%), Gaps = 26/136 (19%)
 Frame = +2

Query: 2    KSPPPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP--------- 148
            +SPPPP   Y  SPPP +   PP ++      PPPP + + P P   SPPP         
Sbjct: 633  ESPPPPKNEYTHSPPPTHGHYPPKRESPPPPPPPPPQEPFHPLP---SPPPTGCITTPPS 689

Query: 149  -----PKKHYVYKSPPPPVK---HYSPPPVY---HSPPPPKKHYVYKSPPPPVKHYSPPP 295
                 P  H+    PPPP +   HY  PP Y    SPPPP     + SPPPP  +   PP
Sbjct: 690  PPSSTPSYHHSPSPPPPPPEQHWHYPTPPSYSHHQSPPPPPPLSPFPSPPPPADNTPLPP 749

Query: 296  V----YHSPPPPKKHY 331
            +    Y SPPPP   Y
Sbjct: 750  IVGVSYASPPPPTIPY 765

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/126 (40%), Positives = 58/126 (46%), Gaps = 21/126 (16%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 172
           SP P  K   P PV + P P    P++ +V  SPPPP    S P     PPPP      K
Sbjct: 394 SPSPRRK---PRPVGNPPSPKLAPPRRPFVKPSPPPPPTSKSSPSTRSHPPPPPPQTPAK 450

Query: 173 S-------PPPPVKHYS----------PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 301
           S       PPPP K  S          PPPV    PPP  HY   +PPPP K  S P  +
Sbjct: 451 SYHPPPSPPPPPTKRVSPKTHLPPPPPPPPVVEQSPPPPAHYHSYAPPPPTKKVS-PSTH 509

Query: 302 HSPPPP 319
           H+PPPP
Sbjct: 510 HAPPPP 515

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 46/113 (40%), Positives = 50/113 (44%), Gaps = 22/113 (19%)
 Frame = +2

Query: 53  SPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPP---------KKHYVYKSPPPPVKHY 199
           SP P +K     +PP P K   P   +   SPPPP         + H     P  P K Y
Sbjct: 394 SPSPRRKPRPVGNPPSP-KLAPPRRPFVKPSPPPPPTSKSSPSTRSHPPPPPPQTPAKSY 452

Query: 200 SPPPVYHSPPP-------PKKHYVYKSPPPPVKHYSPPPV--YHS--PPPPKK 325
            PPP   SPPP       PK H     PPPPV   SPPP   YHS  PPPP K
Sbjct: 453 HPPP---SPPPPPTKRVSPKTHLPPPPPPPPVVEQSPPPPAHYHSYAPPPPTK 502

[107][TOP]
>UniRef100_UPI0001982EE5 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982EE5
          Length = 746

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/111 (54%), Positives = 65/111 (58%), Gaps = 5/111 (4%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-----YSPPPVYHSPPPPKKHYV 166
           +SPPPP    SPPP   SPPPP+      SPPPPV+      YSP P  HSPPPP  H  
Sbjct: 584 RSPPPPTPVRSPPPSVSSPPPPEH-----SPPPPVQSPPPPLYSPSPPVHSPPPPPVH-- 636

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             SPPPPV+  SPPP   SPPPP       SPPPPV   SPPP   SPPPP
Sbjct: 637 --SPPPPVR--SPPPPVSSPPPPP----VSSPPPPVH--SPPPPVSSPPPP 677

 Score =  107 bits (267), Expect = 4e-22
 Identities = 60/108 (55%), Positives = 65/108 (60%), Gaps = 2/108 (1%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPP+  YSP P  HSPPPP  H    SPPPPV+  SPPP   SPPPP       SPP
Sbjct: 614 QSPPPPL--YSPSPPVHSPPPPPVH----SPPPPVR--SPPPPVSSPPPPP----VSSPP 661

Query: 182 PPVKHYSPPPVYHSPPPP--KKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV  +SPPP   SPPPP    H     PPPPV    PPPV+  PPPP
Sbjct: 662 PPV--HSPPPPVSSPPPPVSSPHPPVAFPPPPVSS-PPPPVHSPPPPP 706

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/119 (51%), Positives = 66/119 (55%), Gaps = 11/119 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP---PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           SPPPPV H +PPPV   PPP   P      +SPPPP    SPPP   SPPPP+      S
Sbjct: 555 SPPPPV-HSTPPPVRSPPPPVFSPPPPIPVRSPPPPTPVRSPPPSVSSPPPPEH-----S 608

Query: 176 PPPPVKH-----YSPPPVYHSPPPPKKHYV---YKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PPPPV+      YSP P  HSPPPP  H      +SPPPPV    PPPV  S PPP  H
Sbjct: 609 PPPPVQSPPPPLYSPSPPVHSPPPPPVHSPPPPVRSPPPPVSSPPPPPV--SSPPPPVH 665

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/106 (55%), Positives = 64/106 (60%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPPV    PP    SPPPP      +SPPP V   SPPP  HSPPPP      +SPP
Sbjct: 568 RSPPPPVFSPPPPIPVRSPPPPTP---VRSPPPSVS--SPPPPEHSPPPP-----VQSPP 617

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP+  YSP P  HSPPPP  H    SPPPPV+  SPPP   SPPPP
Sbjct: 618 PPL--YSPSPPVHSPPPPPVH----SPPPPVR--SPPPPVSSPPPP 655

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/106 (51%), Positives = 59/106 (55%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           P P    SPPP  HS PPP      +SPPPPV    PP    SPPPP      +SPPP V
Sbjct: 548 PSPAPISSPPPPVHSTPPP-----VRSPPPPVFSPPPPIPVRSPPPPTP---VRSPPPSV 599

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
              SPPP  HSPPPP      +SPPPP+  YSP P  HSPPPP  H
Sbjct: 600 S--SPPPPEHSPPPP-----VQSPPPPL--YSPSPPVHSPPPPPVH 636

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 49/110 (44%), Positives = 54/110 (49%), Gaps = 4/110 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH-SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +PP P    +P P    SP PPK      SPPPP K   P P     P P       SPP
Sbjct: 507 APPTPTPTPTPTPKPKPSPHPPKT----SSPPPPHKATPPTPTPKPSPAP-----ISSPP 557

Query: 182 PPVKHYSPPPVYHSPPP---PKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           PPV H +PPPV   PPP   P      +SPPPP    SPPP   SPPPP+
Sbjct: 558 PPV-HSTPPPVRSPPPPVFSPPPPIPVRSPPPPTPVRSPPPSVSSPPPPE 606

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 48/91 (52%), Positives = 49/91 (53%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPPV    PPPV  S PPP  H    SPPPPV   SPPP   SP PP        PP
Sbjct: 643 RSPPPPVSSPPPPPV--SSPPPPVH----SPPPPVS--SPPPPVSSPHPP-----VAFPP 689

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
           PPV   SPPP  HSPPPP       SPP  V
Sbjct: 690 PPVS--SPPPPVHSPPPPPVF----SPPSAV 714

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 48/119 (40%), Positives = 52/119 (43%), Gaps = 14/119 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP---------PVKHYSP-PPVYHSPPPPK 154
           +PP P    SPP    S P P+      S PP         P    SP PP   SPPPP 
Sbjct: 478 TPPTPKPRPSPPKSVPSTPKPQPSPSPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPPPPH 537

Query: 155 KHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           K        K  P P+   SPPP  HS PPP      +SPPPPV    PP    SPPPP
Sbjct: 538 KATPPTPTPKPSPAPIS--SPPPPVHSTPPP-----VRSPPPPVFSPPPPIPVRSPPPP 589

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 46/123 (37%), Positives = 52/123 (42%), Gaps = 20/123 (16%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-- 184
           P P  H SP P   SPP P+      +PP P    SPP    S P P+      S PP  
Sbjct: 455 PKPQPHPSPSP---SPPKPQPAPPKSTPPTPKPRPSPPKSVPSTPKPQPSPSPVSAPPTP 511

Query: 185 ---------------PVKHYSPPPVYHSPPP---PKKHYVYKSPPPPVKHYSPPPVYHSP 310
                          P K  SPPP + + PP   PK      S PPP  H +PPPV  SP
Sbjct: 512 TPTPTPTPKPKPSPHPPKTSSPPPPHKATPPTPTPKPSPAPISSPPPPVHSTPPPV-RSP 570

Query: 311 PPP 319
           PPP
Sbjct: 571 PPP 573

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 41/117 (35%), Positives = 46/117 (39%), Gaps = 10/117 (8%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPP P      PPV    PPP         P P  H SP P   SPP P+      +PP 
Sbjct: 430 SPPKP-----RPPVRSPTPPPASTPRSPPTPKPQPHPSPSP---SPPKPQPAPPKSTPPT 481

Query: 185 PVKHYSPP-PVYHSPPPPKKHYVYKSPPPPVKHYSP---------PPVYHSPPPPKK 325
           P    SPP  V  +P P        +PP P    +P         PP   SPPPP K
Sbjct: 482 PKPRPSPPKSVPSTPKPQPSPSPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPPPPHK 538

[108][TOP]
>UniRef100_Q40150 Tomato cell wall HRGP (hydroxproline-rich glycoprotein) (Fragment)
           n=1 Tax=Solanum lycopersicum RepID=Q40150_SOLLC
          Length = 93

 Score =  108 bits (271), Expect = 1e-22
 Identities = 62/108 (57%), Positives = 65/108 (60%), Gaps = 3/108 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP---KKHYVYKS 175
           SPPPP K   PPP   SPPPP    V+  PPPPV   SPPP  HSPPPP       V+  
Sbjct: 1   SPPPP-KTLPPPPPKTSPPPP----VHSPPPPPVA--SPPPPVHSPPPPVASPPPPVHSP 53

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPPPV   SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP
Sbjct: 54  PPPPVA--SPPPPVHSPPPP-----VASPPPPV--HSPPPPVHSPPPP 92

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 44/80 (55%), Positives = 46/80 (57%)
 Frame = +2

Query: 89  SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 268
           SPPPP K   PPP   SPPPP    V+  PPPPV   SPPP  HSPPPP       SPPP
Sbjct: 1   SPPPP-KTLPPPPPKTSPPPP----VHSPPPPPVA--SPPPPVHSPPPP-----VASPPP 48

Query: 269 PVKHYSPPPVYHSPPPPKKH 328
           PV    PPPV  + PPP  H
Sbjct: 49  PVHSPPPPPV--ASPPPPVH 66

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 42/70 (60%), Positives = 43/70 (61%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV   SPPP  HSPPPP       SPPPPV  +SPPP   SPPPP       SPPP
Sbjct: 38  SPPPPVA--SPPPPVHSPPPPP----VASPPPPV--HSPPPPVASPPPP-----VHSPPP 84

Query: 185 PVKHYSPPPV 214
           PV H  PPPV
Sbjct: 85  PV-HSPPPPV 93

[109][TOP]
>UniRef100_Q43505 Extensin-like protein Dif54 n=1 Tax=Solanum lycopersicum
           RepID=Q43505_SOLLC
          Length = 436

 Score =  107 bits (268), Expect = 3e-22
 Identities = 56/117 (47%), Positives = 66/117 (56%), Gaps = 4/117 (3%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKS 175
           KSP P   + SP P  Y+  P P KHY YKSP P   + SP P  Y+  P P K+Y YKS
Sbjct: 180 KSPSPAKYYKSPSPAKYYKSPAPSKHYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYKS 239

Query: 176 PPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYK 340
           P P   + SP P  Y+  P P K+Y YKSP P   + SP PV Y+  P P KHY YK
Sbjct: 240 PSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPVKYYKSPAPSKHYYYK 296

 Score =  106 bits (265), Expect = 7e-22
 Identities = 55/113 (48%), Positives = 64/113 (56%), Gaps = 5/113 (4%)
 Frame = +2

Query: 17  PVKHY-SPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPP 187
           P K+Y SP P  Y+  P P KHY YKSP P   + SP P  Y+  P P KHY YKSP P 
Sbjct: 126 PAKYYKSPSPAKYYKSPTPSKHYYYKSPSPSKYYKSPSPAKYYKSPAPSKHYYYKSPSPA 185

Query: 188 VKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYK 340
             + SP P  Y+  P P KHY YKSP P   + SP P  Y+  P P K+Y YK
Sbjct: 186 KYYKSPSPAKYYKSPAPSKHYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYK 238

 Score =  106 bits (265), Expect = 7e-22
 Identities = 55/117 (47%), Positives = 65/117 (55%), Gaps = 4/117 (3%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKS 175
           KSP P   + SP P  Y+  P P KHY YKSP P   + SP P  Y+  P P KHY YKS
Sbjct: 151 KSPSPSKYYKSPSPAKYYKSPAPSKHYYYKSPSPAKYYKSPSPAKYYKSPAPSKHYYYKS 210

Query: 176 PPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYK 340
           P P   + SP P  Y+  P P K+Y YKSP P   + SP P  Y+  P P K+Y YK
Sbjct: 211 PSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYK 267

 Score =  106 bits (264), Expect = 9e-22
 Identities = 56/116 (48%), Positives = 66/116 (56%), Gaps = 9/116 (7%)
 Frame = +2

Query: 11  PPPVKHY-SPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPP 181
           P PVK+Y SP P  Y+  P P K+Y YKSP P   + SP PV Y+  P P KHY YKSP 
Sbjct: 240 PSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPVKYYKSPAPSKHYYYKSPS 299

Query: 182 PPVKHYSPPP--VYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           P   + SP P   Y SPPPP  +Y     YKSPPPP  +Y   P Y+  P P  +Y
Sbjct: 300 PSQYYKSPAPSKYYKSPPPPPTYYKSPVYYKSPPPPPTYYEKSPSYYKSPLPPPYY 355

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/113 (49%), Positives = 66/113 (58%), Gaps = 6/113 (5%)
 Frame = +2

Query: 11  PPPVKHY-SPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPP 181
           P PVK+Y SP P  Y+  P P K+Y YKSP P   + SP P  Y+  P P K+Y YKSP 
Sbjct: 211 PSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYKSPS 270

Query: 182 PPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHY 331
           P   + SP PV Y+  P P KHY YKSP P   + SP P   Y SPPPP  +Y
Sbjct: 271 PVKYYKSPSPVKYYKSPAPSKHYYYKSPSPSQYYKSPAPSKYYKSPPPPPTYY 323

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/117 (49%), Positives = 65/117 (55%), Gaps = 14/117 (11%)
 Frame = +2

Query: 11  PPPVKHY-SPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHY---- 163
           P PVK+Y SP PV  Y SP P  KHY YKSP P   + SP P   Y SPPPP  +Y    
Sbjct: 269 PSPVKYYKSPSPVKYYKSPAP-SKHYYYKSPSPSQYYKSPAPSKYYKSPPPPPTYYKSPV 327

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPPP 319
            YKSPPPP  +Y   P Y+  P P  +Y      YKSPPPP  +    P Y SPPPP
Sbjct: 328 YYKSPPPPPTYYEKSPSYYKSPLPPPYYKESMPYYKSPPPPPYYKESTPYYKSPPPP 384

 Score =  102 bits (255), Expect = 1e-20
 Identities = 55/121 (45%), Positives = 63/121 (52%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPP--VYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           KSP P   + SP P   Y SPPPP  +Y     YKSPPPP  +Y   P Y+  P P  +Y
Sbjct: 296 KSPSPSQYYKSPAPSKYYKSPPPPPTYYKSPVYYKSPPPPPTYYEKSPSYYKSPLPPPYY 355

Query: 164 -----VYKSPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPP 316
                 YKSPPPP  +    P Y SPPPP  +      YKSPPPP  +    P Y SPPP
Sbjct: 356 KESMPYYKSPPPPPYYKESTPYYKSPPPPPYYKESTPSYKSPPPPPYYKESTPYYKSPPP 415

Query: 317 P 319
           P
Sbjct: 416 P 416

 Score =  102 bits (255), Expect = 1e-20
 Identities = 54/117 (46%), Positives = 61/117 (52%), Gaps = 13/117 (11%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPPPKKHY- 163
           KSPPPP  +Y  P  Y SPPPP  +Y      YKSP PP  +    P Y SPPPP  +  
Sbjct: 314 KSPPPPPTYYKSPVYYKSPPPPPTYYEKSPSYYKSPLPPPYYKESMPYYKSPPPPPYYKE 373

Query: 164 ---VYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPP 313
               YKSPPPP  +    P Y SPPPP  +      YKSPPPP  +    P Y SPP
Sbjct: 374 STPYYKSPPPPPYYKESTPSYKSPPPPPYYKESTPYYKSPPPPPYYKESTPSYKSPP 430

 Score =  100 bits (249), Expect = 5e-20
 Identities = 59/135 (43%), Positives = 66/135 (48%), Gaps = 25/135 (18%)
 Frame = +2

Query: 11  PPPVKHYSPPPV----YHSPPPPKKHY--------VYKSPPPPVKHY----------SPP 124
           P P KHY   PV    Y SP P KK+Y         YKS  P  K+Y          SP 
Sbjct: 75  PTPSKHYYKSPVVVKYYKSPAPSKKYYKSPSPSKYYYKSHTPSKKYYKSLSPAKYYKSPS 134

Query: 125 PV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
           P  Y+  P P KHY YKSP P   + SP P  Y+  P P KHY YKSP P   + SP P 
Sbjct: 135 PAKYYKSPTPSKHYYYKSPSPSKYYKSPSPAKYYKSPAPSKHYYYKSPSPAKYYKSPSPA 194

Query: 299 -YHSPPPPKKHYVYK 340
            Y+  P P KHY YK
Sbjct: 195 KYYKSPAPSKHYYYK 209

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 58/134 (43%), Positives = 66/134 (49%), Gaps = 21/134 (15%)
 Frame = +2

Query: 2   KSPPPPV------KH--YSPPPVYHSPPPPKKHY-------VYKSPPPPVKHY---SPPP 127
           KSP P        KH  +SP   Y SP P K +Y        YKSP P  K+Y   SP  
Sbjct: 49  KSPSPSPYYKKSEKHAEHSPSHYYKSPTPSKHYYKSPVVVKYYKSPAPSKKYYKSPSPSK 108

Query: 128 VYHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHY-SPPPV- 298
            Y+    P K Y YKS  P   + SP P  Y+  P P KHY YKSP P  K+Y SP P  
Sbjct: 109 YYYKSHTPSKKY-YKSLSPAKYYKSPSPAKYYKSPTPSKHYYYKSPSPS-KYYKSPSPAK 166

Query: 299 YHSPPPPKKHYVYK 340
           Y+  P P KHY YK
Sbjct: 167 YYKSPAPSKHYYYK 180

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 43/108 (39%), Positives = 47/108 (43%), Gaps = 7/108 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPP---KKH 160
           KSP PP  +    P Y SPPPP  +      YKSPPPP  +    P Y SPPPP   K+ 
Sbjct: 347 KSPLPPPYYKESMPYYKSPPPPPYYKESTPYYKSPPPPPYYKESTPSYKSPPPPPYYKES 406

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
             Y   PP      PPP Y    P      YKSPP         P YH
Sbjct: 407 TPYYKSPP------PPPYYKESTPS-----YKSPP-------SSPTYH 436

[110][TOP]
>UniRef100_UPI0000E125D3 Os05g0552600 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E125D3
          Length = 510

 Score =  107 bits (267), Expect = 4e-22
 Identities = 60/105 (57%), Positives = 60/105 (57%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV   SPPP   SPPPP    V  SPPP      PPPV  SPPPP       SPPP
Sbjct: 121 SPPPPVS--SPPPPVPSPPPP----VPTSPPPSPLPSPPPPVPSSPPPP-----VSSPPP 169

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PV    PPPV  SPPPP    V  SPPPPV    PPPV  SPPPP
Sbjct: 170 PVPSSPPPPVVPSPPPP----VLSSPPPPVVASPPPPVVPSPPPP 210

 Score =  105 bits (261), Expect = 2e-21
 Identities = 58/106 (54%), Positives = 60/106 (56%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  H SPPP   SPPPP    VY  PPPP +   PPP  +SPPPP       SPP
Sbjct: 67  KSPPPP-HHDSPPPPRASPPPP----VYSPPPPPPRSSPPPPPVYSPPPP-----VSSPP 116

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV   SPPP   SPPPP       SPPPPV    PP    SPPPP
Sbjct: 117 PPVP--SPPPPVSSPPPP-----VPSPPPPVPTSPPPSPLPSPPPP 155

 Score =  103 bits (258), Expect = 5e-21
 Identities = 58/106 (54%), Positives = 59/106 (55%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +S PPP   YSPPP   SPPPP       SPPPPV   SPPP   SPPPP    V  SPP
Sbjct: 97  RSSPPPPPVYSPPPPVSSPPPP-----VPSPPPPVS--SPPPPVPSPPPP----VPTSPP 145

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P      PPPV  SPPPP       SPPPPV    PPPV  SPPPP
Sbjct: 146 PSPLPSPPPPVPSSPPPP-----VSSPPPPVPSSPPPPVVPSPPPP 186

[111][TOP]
>UniRef100_B9FLI1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FLI1_ORYSJ
          Length = 518

 Score =  107 bits (267), Expect = 4e-22
 Identities = 60/106 (56%), Positives = 62/106 (58%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  H SPPP   SPPPP    VY  PPPP +   PPP  +SPPPP       SPP
Sbjct: 98  KSPPPP-HHDSPPPPRASPPPP----VYSPPPPPPRSSPPPPPVYSPPPP-----VSSPP 147

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV   SPPP   SPPPP       SPPPPV   SPPP   SPPPP
Sbjct: 148 PPVP--SPPPPVSSPPPP-----VPSPPPPVS--SPPPPVSSPPPP 184

 Score =  106 bits (264), Expect = 9e-22
 Identities = 60/106 (56%), Positives = 61/106 (57%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +S PPP   YSPPP   SPPPP       SPPPPV   SPPP   SPPPP       SPP
Sbjct: 128 RSSPPPPPVYSPPPPVSSPPPP-----VPSPPPPVS--SPPPPVPSPPPP-----VSSPP 175

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV   SPPP   SPPPP       SPPPPV   SPPP  HSPPPP
Sbjct: 176 PPVS--SPPPPVSSPPPP-----VSSPPPPVS--SPPPPVHSPPPP 212

 Score =  103 bits (258), Expect = 5e-21
 Identities = 60/112 (53%), Positives = 62/112 (55%), Gaps = 1/112 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           SPPPP  +  PPPV   PPP P       SPPPPV   SPPP   SPPPP       SPP
Sbjct: 130 SPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVP--SPPPPVSSPPPP-----VSSPP 182

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PPV   SPPP   SPPPP       SPPPPV  +SPPP   SPPPP    VY
Sbjct: 183 PPVS--SPPPPVSSPPPP-----VSSPPPPV--HSPPPPVSSPPPPASDVVY 225

[112][TOP]
>UniRef100_A2Y786 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2Y786_ORYSI
          Length = 493

 Score =  107 bits (267), Expect = 4e-22
 Identities = 60/106 (56%), Positives = 62/106 (58%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP  H SPPP   SPPPP    VY  PPPP +   PPP  +SPPPP       SPP
Sbjct: 73  KSPPPPY-HDSPPPPRASPPPP----VYSPPPPPPRSSPPPPPVYSPPPP-----VSSPP 122

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV   SPPP   SPPPP       SPPPPV   SPPP   SPPPP
Sbjct: 123 PPVP--SPPPPVSSPPPP-----VPSPPPPVS--SPPPPVSSPPPP 159

 Score =  106 bits (264), Expect = 9e-22
 Identities = 60/106 (56%), Positives = 61/106 (57%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +S PPP   YSPPP   SPPPP       SPPPPV   SPPP   SPPPP       SPP
Sbjct: 103 RSSPPPPPVYSPPPPVSSPPPP-----VPSPPPPVS--SPPPPVPSPPPP-----VSSPP 150

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV   SPPP   SPPPP       SPPPPV   SPPP  HSPPPP
Sbjct: 151 PPVS--SPPPPVSSPPPP-----VSSPPPPVS--SPPPPVHSPPPP 187

 Score =  103 bits (258), Expect = 5e-21
 Identities = 60/112 (53%), Positives = 62/112 (55%), Gaps = 1/112 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           SPPPP  +  PPPV   PPP P       SPPPPV   SPPP   SPPPP       SPP
Sbjct: 105 SPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVP--SPPPPVSSPPPP-----VSSPP 157

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PPV   SPPP   SPPPP       SPPPPV  +SPPP   SPPPP    VY
Sbjct: 158 PPVS--SPPPPVSSPPPP-----VSSPPPPV--HSPPPPVSSPPPPASDVVY 200

[113][TOP]
>UniRef100_Q7PNI8 AGAP000892-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=Q7PNI8_ANOGA
          Length = 157

 Score =  107 bits (266), Expect = 5e-22
 Identities = 52/104 (50%), Positives = 62/104 (59%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP   Y PPPV+H+PPPP     Y  PP PV +  PPP  + PPPP+ +     PPPP
Sbjct: 46  PPPPRPVYGPPPVHHAPPPPPPP-AYGPPPAPV-YGPPPPQSYGPPPPQSY----GPPPP 99

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           V H  PPP    PPPP+  Y    PPP   +  PPPV+H+PPPP
Sbjct: 100 VHHAPPPP---PPPPPRPVY---GPPPQQSYGPPPPVHHAPPPP 137

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 49/102 (48%), Positives = 56/102 (54%), Gaps = 1/102 (0%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP   Y PPP     PPP + Y    PPPPV H  PPP    PPPP+  Y    PPP  
Sbjct: 72  PPPAPVYGPPPPQSYGPPPPQSY---GPPPPVHHAPPPP---PPPPPRPVY---GPPPQQ 122

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-PPPVYHSPP 313
            +  PPPV+H+PPPP        PPPP   Y  PPPV+H+PP
Sbjct: 123 SYGPPPPVHHAPPPP-------PPPPPRPVYGPPPPVHHAPP 157

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 35/79 (44%), Positives = 39/79 (49%)
 Frame = +2

Query: 92  PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 271
           PPPP   Y PPPV+H+PP            PP     PPP Y  PP P    VY  PPPP
Sbjct: 46  PPPPRPVYGPPPVHHAPP------------PP-----PPPAYGPPPAP----VY-GPPPP 83

Query: 272 VKHYSPPPVYHSPPPPKKH 328
             +  PPP  + PPPP  H
Sbjct: 84  QSYGPPPPQSYGPPPPVHH 102

[114][TOP]
>UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC
          Length = 620

 Score =  106 bits (264), Expect = 9e-22
 Identities = 58/139 (41%), Positives = 63/139 (45%), Gaps = 30/139 (21%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKK-----------HYVYKSPPPPV--------KHYSPPP 127
           SPPPP  +  PPP Y  PPPP              Y    PPPP           YSPPP
Sbjct: 354 SPPPPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPPP 413

Query: 128 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY-----------VYKSPPPPV 274
             +SPPPP     Y  PPP    YSPPP  +SPPPP  +             Y  PPPP 
Sbjct: 414 PTYSPPPP----TYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQPPPPP 469

Query: 275 KHYSPPPVYHSPPPPKKHY 331
             YSPPP  +SPPPP   Y
Sbjct: 470 PTYSPPPPAYSPPPPSPIY 488

 Score =  100 bits (250), Expect = 4e-20
 Identities = 57/117 (48%), Positives = 63/117 (53%), Gaps = 12/117 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP   YSPPP  +SPPPP     Y  PPPP   YSPPP  +SPPPP    +Y  PPP
Sbjct: 441 SPPPPPT-YSPPPPTYSPPPP----AYAQPPPPPPTYSPPPPAYSPPPPSP--IYSPPPP 493

Query: 185 PVKH----YSPPPV--YHSPPPPKKHY-----VYKSPPPPVKHYSPPP-VYHSPPPP 319
            V+     +SPPP    H PPPP +        Y  PP P     PPP   HSPPPP
Sbjct: 494 QVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPP 550

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 55/105 (52%), Positives = 57/105 (54%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP   YSPPP  +SP PP       SPPPP   YSPPP Y SPPPP     Y   P 
Sbjct: 290 SPPPPSPIYSPPPPAYSPSPPPTPTPTFSPPPPA--YSPPPTY-SPPPP----TYLPLPS 342

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              +  PPPVY  PPPP       SPPPP   Y PPP   SPPPP
Sbjct: 343 SPIYSPPPPVYSPPPPPS-----YSPPPPT--YLPPPPPSSPPPP 380

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 58/130 (44%), Positives = 62/130 (47%), Gaps = 25/130 (19%)
 Frame = +2

Query: 5   SPPPPV-------KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           SPPPP          YSPPP  +SPPPP  +    SPPPP   Y PPP   SPPPP    
Sbjct: 331 SPPPPTYLPLPSSPIYSPPPPVYSPPPPPSY----SPPPPT--YLPPPPPSSPPPPSF-- 382

Query: 164 VYKSPPPPVKH------------------YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 289
              SPPPP                     YSPPP  +SPPPP     Y  PPP    YSP
Sbjct: 383 ---SPPPPTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSPPPP----TYAQPPPLPPTYSP 435

Query: 290 PPVYHSPPPP 319
           PP  +SPPPP
Sbjct: 436 PPPAYSPPPP 445

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/109 (51%), Positives = 61/109 (55%), Gaps = 1/109 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           SPPPP    SP P   +SPPPP       SPPPP   YSPPP  +SP PP       SPP
Sbjct: 266 SPPPPAYAQSPQPSPTYSPPPPTY-----SPPPPSPIYSPPPPAYSPSPPPTPTPTFSPP 320

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PP   YSPPP Y SPPPP   Y+   P P    YSPPP  +SPPPP  +
Sbjct: 321 PPA--YSPPPTY-SPPPPT--YL---PLPSSPIYSPPPPVYSPPPPPSY 361

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 52/135 (38%), Positives = 61/135 (45%), Gaps = 27/135 (20%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYK-----------SPPPPVKHYSPPPVYHSPPPPK 154
           PPPP   YSPPP  +SPPPP   Y              SPPPP + + PPP +  P PP 
Sbjct: 465 PPPPPPTYSPPPPAYSPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPT 524

Query: 155 KHYVYK------SPPPPVKHYSPPP----------VYHSPPPPKKHYVYKSPPPPVKHYS 286
             Y         SPPPP + +SPPP           Y  PP P       S PPP + +S
Sbjct: 525 PTYGQPPSPPTFSPPPPRQIHSPPPPHWQPRTPTPTYGQPPSPPTF----SAPPPRQIHS 580

Query: 287 PPPVYHSPPPPKKHY 331
           PPP +  P PP   Y
Sbjct: 581 PPPPHRQPRPPTPTY 595

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/132 (34%), Positives = 56/132 (42%), Gaps = 22/132 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           + P PP +H  PPP  ++ PPP   Y       P   YSPPP  H  P P        P 
Sbjct: 167 RRPSPPSRHGHPPPPTYAQPPPTPIYSPSPQVQPPPTYSPPPPTHVQPTPSPPSRGHQPQ 226

Query: 182 PPVKHYSPP------------PVYHSPPPPKKH---YVYKSPPP-------PVKHYSPPP 295
           PP   ++PP            P+ H PP P++      Y  PPP       P   YSPPP
Sbjct: 227 PPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPSPTYSPPP 286

Query: 296 VYHSPPPPKKHY 331
             +SPPPP   Y
Sbjct: 287 PTYSPPPPSPIY 298

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/129 (37%), Positives = 58/129 (44%), Gaps = 24/129 (18%)
 Frame = +2

Query: 5   SPPPPVKHYSP-PPVYHSPPPPKKHYVYKSPPPPVKHYSP-------PPVYHSPPPPKKH 160
           +P PP + + P PP +   PP  +H      P P++H  P       PP Y SPPPP   
Sbjct: 215 TPSPPSRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTY-SPPPP--- 270

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK----------------HYSPP 292
             Y   P P   YSPPP  +SPPPP    +Y  PPP                    YSPP
Sbjct: 271 -AYAQSPQPSPTYSPPPPTYSPPPPSP--IYSPPPPAYSPSPPPTPTPTFSPPPPAYSPP 327

Query: 293 PVYHSPPPP 319
           P Y SPPPP
Sbjct: 328 PTY-SPPPP 335

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 47/116 (40%), Positives = 56/116 (48%), Gaps = 12/116 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYK------SPPPPVKHYSPPPVYHSPPPPKKHYV 166
           SPPPP + + PPP +  P PP   Y         SPPPP + +SPPP +  P  P   Y 
Sbjct: 503 SPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPPHWQPRTPTPTYG 562

Query: 167 YK------SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
                   S PPP + +SPPP +  P PP     Y  PP P   YSPP    SPPP
Sbjct: 563 QPPSPPTFSAPPPRQIHSPPPPHRQPRPPTP--TYGQPPSPPTTYSPP----SPPP 612

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 50/123 (40%), Positives = 61/123 (49%), Gaps = 20/123 (16%)
 Frame = +2

Query: 11  PPPVKHYSP-----PPVYHSPPPPKKHYVYKSPPPPVKHYSP-PPVYHSPPPPKKHYVYK 172
           PPP   YSP     PP  +SPPPP   +V  +P PP + + P PP +   PP  +H    
Sbjct: 186 PPPTPIYSPSPQVQPPPTYSPPPPT--HVQPTPSPPSRGHQPQPPTHRHAPPTHRHAPPT 243

Query: 173 SPPPPVKHYSP-------PPVYHSPPP-----PKKHYVYKSPPPPVKHYSPPP--VYHSP 310
             P P++H  P       PP Y  PPP     P+    Y SPPPP   YSPPP    +SP
Sbjct: 244 HQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPSPTY-SPPPPT--YSPPPPSPIYSP 300

Query: 311 PPP 319
           PPP
Sbjct: 301 PPP 303

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/108 (38%), Positives = 58/108 (53%), Gaps = 1/108 (0%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PP P   ++PP   H+PP  +    ++ P PP +H  PPP  ++ PPP   Y   SP P 
Sbjct: 141 PPSPSHGHAPPSGGHTPPRGQHPPSHRRPSPPSRHGHPPPPTYAQPPPTPIY---SPSPQ 197

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP-PPVYHSPPPPKKH 328
           V+   PPP Y SPPPP   +V  +P PP + + P PP +   PP  +H
Sbjct: 198 VQ---PPPTY-SPPPPT--HVQPTPSPPSRGHQPQPPTHRHAPPTHRH 239

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 41/105 (39%), Positives = 52/105 (49%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SP  P   Y  PP  H P     H   + PP P   ++PP   H+PP  +    ++ P P
Sbjct: 114 SPSHPPPSYGAPPPSHGPGHLPSH--GQRPPSPSHGHAPPSGGHTPPRGQHPPSHRRPSP 171

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P +H  PPP  ++ PPP   Y   SP P V+   PPP Y SPPPP
Sbjct: 172 PSRHGHPPPPTYAQPPPTPIY---SPSPQVQ---PPPTY-SPPPP 209

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 41/115 (35%), Positives = 53/115 (46%), Gaps = 9/115 (7%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYS-PPPVYHSPPPPKKHYVYKS- 175
           PP  H   PP    PPP + H      +  PP PV   S PPP Y +PPP        S 
Sbjct: 78  PPPSHGHLPPSVGGPPPHRGHLPPSRGFNPPPSPVISPSHPPPSYGAPPPSHGPGHLPSH 137

Query: 176 ---PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
              PP P   ++PP   H+PP  +    ++ P PP +H  PPP  ++ PPP   Y
Sbjct: 138 GQRPPSPSHGHAPPSGGHTPPRGQHPPSHRRPSPPSRHGHPPPPTYAQPPPTPIY 192

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 36/91 (39%), Positives = 44/91 (48%), Gaps = 5/91 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPKKHYVYKSPP 181
           SPPPP + +SPPP +  P  P     Y  PP P    +PPP   HSPPPP     ++ P 
Sbjct: 537 SPPPPRQIHSPPPPHWQPRTPTP--TYGQPPSPPTFSAPPPRQIHSPPPP-----HRQPR 589

Query: 182 PPVKHY----SPPPVYHSPPPPKKHYVYKSP 262
           PP   Y    SPP  Y  P PP    +  +P
Sbjct: 590 PPTPTYGQPPSPPTTYSPPSPPPYGLLLSTP 620

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 44/135 (32%), Positives = 57/135 (42%), Gaps = 28/135 (20%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY-HSP-----PPPKKHYV- 166
           PPP     SPP    + PP + H       PP +H  PPP + H P     PPP + ++ 
Sbjct: 42  PPPSSIGLSPPSAPTTTPPSRGHVPSPRHAPP-RHAYPPPSHGHLPPSVGGPPPHRGHLP 100

Query: 167 ----YKSPPPPVKHYS-PPPVYHSPPPPKKHYVYKS----PPPPVKHYSPPPVYHSPP-- 313
               +  PP PV   S PPP Y +PPP        S    PP P   ++PP   H+PP  
Sbjct: 101 PSRGFNPPPSPVISPSHPPPSYGAPPPSHGPGHLPSHGQRPPSPSHGHAPPSGGHTPPRG 160

Query: 314 ----------PPKKH 328
                     PP +H
Sbjct: 161 QHPPSHRRPSPPSRH 175

[115][TOP]
>UniRef100_UPI00001631D5 LRX2 (LEUCINE-RICH REPEAT/EXTENSIN 2); protein binding / structural
           constituent of cell wall n=1 Tax=Arabidopsis thaliana
           RepID=UPI00001631D5
          Length = 826

 Score =  105 bits (261), Expect = 2e-21
 Identities = 62/131 (47%), Positives = 72/131 (54%), Gaps = 22/131 (16%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH------SPPPPKKHYV------YKSPPPPVKHYS---PPPVYHS 139
           SPPPP  + SPPPV +      SPPPPK          Y SP PP   Y+   PPP Y++
Sbjct: 555 SPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYA 614

Query: 140 -----PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPV 298
                PPPP  +Y  +SPPPP   Y PP V  SPPPP  +Y  V +SPPPP  +YS  PV
Sbjct: 615 TQSPPPPPPPTYYAVQSPPPPPPVYYPP-VTASPPPPPVYYTPVIQSPPPPPVYYS--PV 671

Query: 299 YHSPPPPKKHY 331
             SPPPP   Y
Sbjct: 672 TQSPPPPPPVY 682

 Score =  103 bits (258), Expect = 5e-21
 Identities = 60/123 (48%), Positives = 72/123 (58%), Gaps = 13/123 (10%)
 Frame = +2

Query: 5   SPPPPVKHYS---PPPVYHS-----PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 160
           SP PP   Y+   PPP Y++     PPPP  +Y  +SPPPP   Y PP V  SPPPP  +
Sbjct: 595 SPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPP-VTASPPPPPVY 653

Query: 161 Y--VYKSPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKK 325
           Y  V +SPPPP  +YSP  V  SPPPP   Y   V +SPPP   +Y  PPV  SPPPP  
Sbjct: 654 YTPVIQSPPPPPVYYSP--VTQSPPPPPPVYYPPVTQSPPPSPVYY--PPVTQSPPPPPV 709

Query: 326 HYV 334
           +Y+
Sbjct: 710 YYL 712

 Score =  102 bits (254), Expect = 1e-20
 Identities = 63/126 (50%), Positives = 73/126 (57%), Gaps = 18/126 (14%)
 Frame = +2

Query: 8   PPPPVKHYS------PPPVYH-----SPPPPKKHY--VYKSPPPPVKHYSPPPVYHSPPP 148
           PPPP  +Y+      PPPVY+     SPPPP  +Y  V +SPPPP  +YS  PV  SPPP
Sbjct: 620 PPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYS--PVTQSPPP 677

Query: 149 PKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVYHSPP 313
           P   Y   V +SPPP   +Y  PPV  SPPPP  +Y  V +SPPPP   Y  PPV  SPP
Sbjct: 678 PPPVYYPPVTQSPPPSPVYY--PPVTQSPPPPPVYYLPVTQSPPPPSPVYY-PPVAKSPP 734

Query: 314 PPKKHY 331
           PP   Y
Sbjct: 735 PPSPVY 740

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 64/134 (47%), Positives = 76/134 (56%), Gaps = 30/134 (22%)
 Frame = +2

Query: 5    SPPPPVKHYS-------PPPVYHS------PPPPKKHY--VYKSPPPPVKHYSPPPVYHS 139
            SPPPP  +Y+       PPPVY+S      PPPP  +Y  V +SPPP   +Y  PPV  S
Sbjct: 646  SPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYY--PPVTQS 703

Query: 140  PPPPKKHY--VYKSPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPP---PVKHY---- 283
            PPPP  +Y  V +SPPPP   Y  PPV  SPPPP   Y   V +SPPP   PV+++    
Sbjct: 704  PPPPPVYYLPVTQSPPPPSPVYY-PPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPAS 762

Query: 284  ---SPPPVYHSPPP 316
               SPPP Y SPPP
Sbjct: 763  PNQSPPPEYQSPPP 776

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 54/128 (42%), Positives = 64/128 (50%), Gaps = 19/128 (14%)
 Frame = +2

Query: 5   SPPPP-------VKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK- 157
           SPPPP       V+ Y PPP    PPP P   Y+Y SPPPP     PP +Y SPPP    
Sbjct: 512 SPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNC 571

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-------PPPVYH---S 307
               +SPPPP    +P P  + P P   +Y Y S PPP  +Y+       PPP Y+   S
Sbjct: 572 PPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQS 631

Query: 308 PPPPKKHY 331
           PPPP   Y
Sbjct: 632 PPPPPPVY 639

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/120 (44%), Positives = 60/120 (50%), Gaps = 11/120 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS------PPPVYHSPPPPKKHYV 166
           +PPPP    SP    + PPPP   Y   SPPPP    S      PPP   SPPPP     
Sbjct: 485 TPPPPSSKMSPSVKAYPPPPPPPEYE-PSPPPPSSEMSPSVRAYPPPPPLSPPPP----- 538

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPPVYHSPPPPKKHY 331
             SPPPP  + SPPP   SPPPP   Y+Y SPP     PP     PPP Y   P P+++Y
Sbjct: 539 --SPPPPYIYSSPPPPSPSPPPP---YIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYY 593

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 62/141 (43%), Positives = 75/141 (53%), Gaps = 31/141 (21%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVYHSPPPPKKHY---V 166
            +SPPP   +Y  PPV  SPPPP  +Y  V +SPPPP   Y  PPV  SPPPP   Y   V
Sbjct: 688  QSPPPSPVYY--PPVTQSPPPPPVYYLPVTQSPPPPSPVYY-PPVAKSPPPPSPVYYPPV 744

Query: 167  YKSPPP---PVKHY-------SPPPVYHSPPP------PKKHYVYKSP-----PPPVKHY 283
             +SPPP   PV+++       SPPP Y SPPP      P   + Y++P     PPP    
Sbjct: 745  TQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKGCNDSPSNDHHYQTPTPPSLPPPYYED 804

Query: 284  SP-PPV----YHSPPPPKKHY 331
            +P PP+    Y SPPPP   Y
Sbjct: 805  TPLPPIRGVSYASPPPPSIPY 825

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 56/136 (41%), Positives = 65/136 (47%), Gaps = 28/136 (20%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYH-SPPPPKKHY---VYKSPPPPVKHYSPPP-------VYHSPPPPK 154
           PPPP     PPP Y  SPPPP       V   PPPP    SPPP       +Y SPPPP 
Sbjct: 501 PPPP-----PPPEYEPSPPPPSSEMSPSVRAYPPPPPL--SPPPPSPPPPYIYSSPPPPS 553

Query: 155 KH----YVYKSPP-----PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS---PPPV 298
                 Y+Y SPP     PP     PPP Y   P P+++  Y SP PP   Y+   PPP 
Sbjct: 554 PSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREY--YPSPSPPYYQYTSSPPPPT 611

Query: 299 YHS-----PPPPKKHY 331
           Y++     PPPP  +Y
Sbjct: 612 YYATQSPPPPPPPTYY 627

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 49/115 (42%), Positives = 56/115 (48%), Gaps = 11/115 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           +PPPP    SP     +PPPP          +PPPP    SP    + PPPP   Y   S
Sbjct: 455 TPPPPSSKMSPS-FRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEY-EPS 512

Query: 176 PPPP-------VKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           PPPP       V+ Y PPP    PPP P   Y+Y SPPPP     PP +Y SPPP
Sbjct: 513 PPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 48/126 (38%), Positives = 55/126 (43%), Gaps = 15/126 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           SPPPP    SP      PPPP          +PPPP    SP   + + PPP    +  S
Sbjct: 424 SPPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPS--FRATPPPPSSKMSPS 481

Query: 176 ----PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPPVYHSPPP-P 319
               PPPP    SP    + PPPP   Y   SPPPP       V+ Y PPP    PPP P
Sbjct: 482 FRATPPPPSSKMSPSVKAYPPPPPPPEY-EPSPPPPSSEMSPSVRAYPPPPPLSPPPPSP 540

Query: 320 KKHYVY 337
              Y+Y
Sbjct: 541 PPPYIY 546

[116][TOP]
>UniRef100_O48809 F24O1.18 n=1 Tax=Arabidopsis thaliana RepID=O48809_ARATH
          Length = 786

 Score =  105 bits (261), Expect = 2e-21
 Identities = 62/131 (47%), Positives = 72/131 (54%), Gaps = 22/131 (16%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH------SPPPPKKHYV------YKSPPPPVKHYS---PPPVYHS 139
           SPPPP  + SPPPV +      SPPPPK          Y SP PP   Y+   PPP Y++
Sbjct: 515 SPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYA 574

Query: 140 -----PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPV 298
                PPPP  +Y  +SPPPP   Y PP V  SPPPP  +Y  V +SPPPP  +YS  PV
Sbjct: 575 TQSPPPPPPPTYYAVQSPPPPPPVYYPP-VTASPPPPPVYYTPVIQSPPPPPVYYS--PV 631

Query: 299 YHSPPPPKKHY 331
             SPPPP   Y
Sbjct: 632 TQSPPPPPPVY 642

 Score =  103 bits (258), Expect = 5e-21
 Identities = 60/123 (48%), Positives = 72/123 (58%), Gaps = 13/123 (10%)
 Frame = +2

Query: 5   SPPPPVKHYS---PPPVYHS-----PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 160
           SP PP   Y+   PPP Y++     PPPP  +Y  +SPPPP   Y PP V  SPPPP  +
Sbjct: 555 SPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPP-VTASPPPPPVY 613

Query: 161 Y--VYKSPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKK 325
           Y  V +SPPPP  +YSP  V  SPPPP   Y   V +SPPP   +Y  PPV  SPPPP  
Sbjct: 614 YTPVIQSPPPPPVYYSP--VTQSPPPPPPVYYPPVTQSPPPSPVYY--PPVTQSPPPPPV 669

Query: 326 HYV 334
           +Y+
Sbjct: 670 YYL 672

 Score =  102 bits (254), Expect = 1e-20
 Identities = 63/126 (50%), Positives = 73/126 (57%), Gaps = 18/126 (14%)
 Frame = +2

Query: 8   PPPPVKHYS------PPPVYH-----SPPPPKKHY--VYKSPPPPVKHYSPPPVYHSPPP 148
           PPPP  +Y+      PPPVY+     SPPPP  +Y  V +SPPPP  +YS  PV  SPPP
Sbjct: 580 PPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYS--PVTQSPPP 637

Query: 149 PKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVYHSPP 313
           P   Y   V +SPPP   +Y  PPV  SPPPP  +Y  V +SPPPP   Y  PPV  SPP
Sbjct: 638 PPPVYYPPVTQSPPPSPVYY--PPVTQSPPPPPVYYLPVTQSPPPPSPVYY-PPVAKSPP 694

Query: 314 PPKKHY 331
           PP   Y
Sbjct: 695 PPSPVY 700

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 64/134 (47%), Positives = 76/134 (56%), Gaps = 30/134 (22%)
 Frame = +2

Query: 5   SPPPPVKHYS-------PPPVYHS------PPPPKKHY--VYKSPPPPVKHYSPPPVYHS 139
           SPPPP  +Y+       PPPVY+S      PPPP  +Y  V +SPPP   +Y  PPV  S
Sbjct: 606 SPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYY--PPVTQS 663

Query: 140 PPPPKKHY--VYKSPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPP---PVKHY---- 283
           PPPP  +Y  V +SPPPP   Y  PPV  SPPPP   Y   V +SPPP   PV+++    
Sbjct: 664 PPPPPVYYLPVTQSPPPPSPVYY-PPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPAS 722

Query: 284 ---SPPPVYHSPPP 316
              SPPP Y SPPP
Sbjct: 723 PNQSPPPEYQSPPP 736

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 54/128 (42%), Positives = 64/128 (50%), Gaps = 19/128 (14%)
 Frame = +2

Query: 5   SPPPP-------VKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK- 157
           SPPPP       V+ Y PPP    PPP P   Y+Y SPPPP     PP +Y SPPP    
Sbjct: 472 SPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNC 531

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-------PPPVYH---S 307
               +SPPPP    +P P  + P P   +Y Y S PPP  +Y+       PPP Y+   S
Sbjct: 532 PPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQS 591

Query: 308 PPPPKKHY 331
           PPPP   Y
Sbjct: 592 PPPPPPVY 599

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/120 (44%), Positives = 60/120 (50%), Gaps = 11/120 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS------PPPVYHSPPPPKKHYV 166
           +PPPP    SP    + PPPP   Y   SPPPP    S      PPP   SPPPP     
Sbjct: 445 TPPPPSSKMSPSVKAYPPPPPPPEYE-PSPPPPSSEMSPSVRAYPPPPPLSPPPP----- 498

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPPVYHSPPPPKKHY 331
             SPPPP  + SPPP   SPPPP   Y+Y SPP     PP     PPP Y   P P+++Y
Sbjct: 499 --SPPPPYIYSSPPPPSPSPPPP---YIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYY 553

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 62/141 (43%), Positives = 75/141 (53%), Gaps = 31/141 (21%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVYHSPPPPKKHY---V 166
            +SPPP   +Y  PPV  SPPPP  +Y  V +SPPPP   Y  PPV  SPPPP   Y   V
Sbjct: 648  QSPPPSPVYY--PPVTQSPPPPPVYYLPVTQSPPPPSPVYY-PPVAKSPPPPSPVYYPPV 704

Query: 167  YKSPPP---PVKHY-------SPPPVYHSPPP------PKKHYVYKSP-----PPPVKHY 283
             +SPPP   PV+++       SPPP Y SPPP      P   + Y++P     PPP    
Sbjct: 705  TQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKGCNDSPSNDHHYQTPTPPSLPPPYYED 764

Query: 284  SP-PPV----YHSPPPPKKHY 331
            +P PP+    Y SPPPP   Y
Sbjct: 765  TPLPPIRGVSYASPPPPSIPY 785

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 56/136 (41%), Positives = 65/136 (47%), Gaps = 28/136 (20%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYH-SPPPPKKHY---VYKSPPPPVKHYSPPP-------VYHSPPPPK 154
           PPPP     PPP Y  SPPPP       V   PPPP    SPPP       +Y SPPPP 
Sbjct: 461 PPPP-----PPPEYEPSPPPPSSEMSPSVRAYPPPPPL--SPPPPSPPPPYIYSSPPPPS 513

Query: 155 KH----YVYKSPP-----PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS---PPPV 298
                 Y+Y SPP     PP     PPP Y   P P+++  Y SP PP   Y+   PPP 
Sbjct: 514 PSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREY--YPSPSPPYYQYTSSPPPPT 571

Query: 299 YHS-----PPPPKKHY 331
           Y++     PPPP  +Y
Sbjct: 572 YYATQSPPPPPPPTYY 587

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 49/115 (42%), Positives = 56/115 (48%), Gaps = 11/115 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           +PPPP    SP     +PPPP          +PPPP    SP    + PPPP   Y   S
Sbjct: 415 TPPPPSSKMSPS-FRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEY-EPS 472

Query: 176 PPPP-------VKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           PPPP       V+ Y PPP    PPP P   Y+Y SPPPP     PP +Y SPPP
Sbjct: 473 PPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 527

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 48/126 (38%), Positives = 55/126 (43%), Gaps = 15/126 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           SPPPP    SP      PPPP          +PPPP    SP   + + PPP    +  S
Sbjct: 384 SPPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPS--FRATPPPPSSKMSPS 441

Query: 176 ----PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPPVYHSPPP-P 319
               PPPP    SP    + PPPP   Y   SPPPP       V+ Y PPP    PPP P
Sbjct: 442 FRATPPPPSSKMSPSVKAYPPPPPPPEY-EPSPPPPSSEMSPSVRAYPPPPPLSPPPPSP 500

Query: 320 KKHYVY 337
              Y+Y
Sbjct: 501 PPPYIY 506

[117][TOP]
>UniRef100_UPI0000DD9D0C Os11g0657400 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD9D0C
          Length = 1399

 Score =  103 bits (258), Expect = 5e-21
 Identities = 58/116 (50%), Positives = 62/116 (53%), Gaps = 8/116 (6%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYV- 166
            K  PPPV   SPPP   SPPPP    +     KSPPPP    SPPP   SPPPP    + 
Sbjct: 1134 KPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILP 1193

Query: 167  ---YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
                KSPPPP    SPPP   SPPPP    +   PPPPVK   PP    SPPPP+K
Sbjct: 1194 PPPVKSPPPPAPVISPPPPVKSPPPPAPVIL---PPPPVKSPPPPAPVISPPPPEK 1246

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 56/116 (48%), Positives = 60/116 (51%), Gaps = 8/116 (6%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
            KSPPPP    SPPP   SPPPP    +     KSPPPP    SPPP   SPPPP    + 
Sbjct: 1166 KSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVIL- 1224

Query: 170  KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP----PPPVKHYSPPPVYHSPPPPKK 325
              PPPPVK   PP    SPPPP+K     +P    PP VK   PP     PPPP K
Sbjct: 1225 --PPPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVK 1278

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/121 (44%), Positives = 57/121 (47%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH------- 160
            +S PP V   S PP   S PPP        PPP VK   PP    SPPPP+K        
Sbjct: 1102 ESSPPSVPKASSPPTEKSLPPPA---TVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPV 1158

Query: 161  ----YVYKSPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPP 316
                   KSPPPP    SPPP   SPPPP    +     KSPPPP    SPPP   SPPP
Sbjct: 1159 ILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPP 1218

Query: 317  P 319
            P
Sbjct: 1219 P 1219

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 59/131 (45%), Positives = 64/131 (48%), Gaps = 23/131 (17%)
 Frame = +2

Query: 2    KSPP-PPVKHYSPP-PVYHSPPPPKK----------HYVYKSPPPPVKHYSPPPVYHSPP 145
            KSPP PP  H SPP P  ++P PPK           H   KSPP      SPPP   SPP
Sbjct: 748  KSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPP 807

Query: 146  PPKKHYVYKSPPPPVKHYSPP---------PVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
             P +     SPP P K  SPP         PV  S PPP+ H    S PPP K  SPPP 
Sbjct: 808  TPAEE---SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHV---SSPPPEKSSSPPPE 861

Query: 299  YH--SPPPPKK 325
             H  SPPPP+K
Sbjct: 862  AHVSSPPPPEK 872

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 54/118 (45%), Positives = 57/118 (48%), Gaps = 14/118 (11%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP---------PVYHSPPPPK 154
            KSPP      SPPP   SPP P +     SPP P K  SPP         PV  S PPP+
Sbjct: 788  KSPPSEAHPTSPPPSEKSPPTPAEE---SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPE 844

Query: 155  KHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH---YVYKSPPPPVKHYSPPPVYHSPP 313
             H    S PPP K  SPPP  H  SPPPP+K       KSPP      SPPP   SPP
Sbjct: 845  AHV---SSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPP 899

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 56/134 (41%), Positives = 61/134 (45%), Gaps = 23/134 (17%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPKKHYVYKSP 178
            KSPP P +  SPP    SP PP  H    +PP PVK  SPPP  H S PPP+K     SP
Sbjct: 804  KSPPTPAEESSPPTPEKSPSPPSGHE--GTPPSPVKSSSPPPEAHVSSPPPEKS---SSP 858

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVY------------KSPP--------PPVKHYSPP-- 292
            PP     SPPP   SPPPP+                 KSPP        PP K   PP  
Sbjct: 859  PPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPT 918

Query: 293  PVYHSPPPPKKHYV 334
            P   S PP  + YV
Sbjct: 919  PTPKSSPPSHEEYV 932

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/121 (42%), Positives = 58/121 (47%), Gaps = 13/121 (10%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYV----------YKSPPPPVKHYSPPPVYH--SPP 145
            KS PP  K    PP  H+ PP  + Y            KSPPP     SPP   H  SPP
Sbjct: 741  KSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPP 800

Query: 146  PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPK 322
            P +     KSPP P +  SPP    SP PP  H    +PP PVK  SPPP  H S PPP+
Sbjct: 801  PSE-----KSPPTPAEESSPPTPEKSPSPPSGH--EGTPPSPVKSSSPPPEAHVSSPPPE 853

Query: 323  K 325
            K
Sbjct: 854  K 854

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 55/129 (42%), Positives = 60/129 (46%), Gaps = 21/129 (16%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH--- 160
            KSP PP  H   PP  V  S PPP+ H    S PPP K  SPPP  H  SPPPP+K    
Sbjct: 820  KSPSPPSGHEGTPPSPVKSSSPPPEAHV---SSPPPEKSSSPPPEAHVSSPPPPEKSPPP 876

Query: 161  YVYKSPPPPVKHYSPPPVYHSPP--------PPKKHY------VYKSPPPPVKHYSPPPV 298
               KSPP      SPPP   SPP        PP K          KS PP  + Y PP  
Sbjct: 877  PETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSP 936

Query: 299  YHSPPPPKK 325
              S PPP++
Sbjct: 937  AKSTPPPEE 945

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 55/145 (37%), Positives = 59/145 (40%), Gaps = 37/145 (25%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYV- 166
            KSPPPP    SPPP   SPPPP    +     KSPPPP    SPPP   SPPP     + 
Sbjct: 1198 KSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAAPVILS 1257

Query: 167  ------------YKSPPPPVKHYSPP-------PVYHSPPPPKKHYV------------- 250
                           PPPPVK   PP       PV  S PPP    +             
Sbjct: 1258 PPAVKSLPPPAPVSLPPPPVKSLPPPAPVSLPPPVVKSLPPPAPVSLPPPAVKPLPPPAP 1317

Query: 251  YKSPPPPVKHYSPPPVYHSPPPPKK 325
               PPP VK   PP    S PPPK+
Sbjct: 1318 VSLPPPAVKPLPPPVPQVSLPPPKQ 1342

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 56/135 (41%), Positives = 61/135 (45%), Gaps = 26/135 (19%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVY----HSPPPPKKHYVY-KSPP-PPVKHYSPP-PVYHSPPPPKK- 157
            KSPP P    S PP      H+P PPK      KSPP PP  H SPP P  ++P PPK  
Sbjct: 715  KSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSS 774

Query: 158  ---------HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP------ 292
                     H   KSPP      SPPP   SPP P +     SPP P K  SPP      
Sbjct: 775  PPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEE---SSPPTPEKSPSPPSGHEGT 831

Query: 293  ---PVYHSPPPPKKH 328
               PV  S PPP+ H
Sbjct: 832  PPSPVKSSSPPPEAH 846

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 46/104 (44%), Positives = 48/104 (46%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPPVK   PP     PPP     V KS PPP     PPP     PPP        PPP 
Sbjct: 1273 PPPPVKSLPPPAPVSLPPP-----VVKSLPPPAPVSLPPPAVKPLPPPAP---VSLPPPA 1324

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            VK   PP    S PPPK+    +S PPP K    PP   S PPP
Sbjct: 1325 VKPLPPPVPQVSLPPPKQ----ESLPPPAKEAEAPPAKESKPPP 1364

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 49/119 (41%), Positives = 60/119 (50%), Gaps = 12/119 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSP 178
           +SP  P +  +P P   SP  P K  +   P P +K   SPP  Y +PPPP   ++ KSP
Sbjct: 466 ESPEEPPEEPTPSPTPSSPESPAK--MAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSP 523

Query: 179 ------PP---PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPK 322
                 PP   P   YSPP    S PPP+     KSPP P   +SPPPV   H+P PPK
Sbjct: 524 ERKKAPPPQAEPPTEYSPPATPESSPPPEG----KSPPTPTASHSPPPVPEGHTPSPPK 578

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 55/128 (42%), Positives = 58/128 (45%), Gaps = 22/128 (17%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVY----HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSPPPPK 154
            KSPP P    S PP      H P PPK    V KSPP P    S    P P  H+P PPK
Sbjct: 682  KSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPK 741

Query: 155  KH-YVYKSPP-PPVKHYSPP-PVYHSPPPPKK----------HYVYKSPPPPVKHYSPPP 295
                  KSPP PP  H SPP P  ++P PPK           H   KSPP      SPPP
Sbjct: 742  SSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPP 801

Query: 296  VYHSPPPP 319
               SPP P
Sbjct: 802  SEKSPPTP 809

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/114 (41%), Positives = 55/114 (48%), Gaps = 6/114 (5%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KS PP  + Y PP    S PPP++    KSPP      S PP   S PPP      KS P
Sbjct: 922  KSSPPSHEEYVPPSPAKSTPPPEE----KSPPSHTPESSSPPSEESEPPPSP--TPKSSP 975

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVKHYSPP-PVYHSPPPPKK 325
            P  + Y PP    S PPP+K     +P     PP  + Y PP PV  SPPP +K
Sbjct: 976  PSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEK 1029

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/120 (40%), Positives = 58/120 (48%), Gaps = 12/120 (10%)
 Frame = +2

Query: 8   PPPPVKHY-SPPPVYHSPPPPKKHYVYKSP------PP---PVKHYSPPPVYHSPPPPKK 157
           P P +K   SPP  Y +PPPP   ++ KSP      PP   P   YSPP    S PPP+ 
Sbjct: 494 PAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEG 553

Query: 158 HYVYKSPPPPVKHYSPPPVY--HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
               KSPP P   +SPPPV   H+P PPK      S PP  +    P    SPPP  + Y
Sbjct: 554 ----KSPPTPTASHSPPPVPEGHTPSPPK------SGPPAGESPPTPESKASPPPTPEEY 603

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 57/124 (45%), Positives = 61/124 (49%), Gaps = 17/124 (13%)
 Frame = +2

Query: 2    KSPPPPV-KHYSPPPVY---HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSPPPPK 154
            KSPP P  K  SPPP     H+P PPK      KSPP P    S    P P  H P PPK
Sbjct: 649  KSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPK 708

Query: 155  K-HYVYKSPPPPVKHYS----PPPVYHSPPPPKKH-YVYKSPP-PPVKHYSPP-PVYHSP 310
                V KSPP P    S    P P  H+P PPK      KSPP PP  H SPP P  ++P
Sbjct: 709  STPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTP 768

Query: 311  PPPK 322
             PPK
Sbjct: 769  SPPK 772

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 49/135 (36%), Positives = 58/135 (42%), Gaps = 28/135 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVY--HSPPPPKKH----------YVYKSPPPPVKHYSPPPVYHSPP 145
           KSPP P   +SPPPV   H+P PPK                SPPP  + Y+P P   +PP
Sbjct: 554 KSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPP 613

Query: 146 ----PPKKHYVYKSPPPPVKH-YSPPPVYHSPP----PPKKHYVYKSPPPPVKH------ 280
               PP       SPPPP    ++P P   +PP    PP       SPPPP         
Sbjct: 614 AEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSP 673

Query: 281 -YSPPPVYHSPPPPK 322
             S PP   SPP P+
Sbjct: 674 PKSTPPTEKSPPTPE 688

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 55/139 (39%), Positives = 61/139 (43%), Gaps = 29/139 (20%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYH--SPPPPKKHYV---YKSPPPPVKHYSPPPVYHSPP-------- 145
            S PPP K  SPPP  H  SPPPP+K       KSPP      SPPP   SPP        
Sbjct: 848  SSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSS 907

Query: 146  PPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP--------PPVKHY 283
            PP K          KS PP  + Y PP    S PPP++    KSPP        PP +  
Sbjct: 908  PPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEE----KSPPSHTPESSSPPSEES 963

Query: 284  SPPP--VYHSPPPPKKHYV 334
             PPP     S PP  + YV
Sbjct: 964  EPPPSPTPKSSPPSHEEYV 982

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 45/107 (42%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KS PPP     PPPV  S PPP        PPP VK   PP     PPP       K  P
Sbjct: 1278 KSLPPPAPVSLPPPVVKSLPPPAP---VSLPPPAVKPLPPPAPVSLPPP-----AVKPLP 1329

Query: 182  PPVKHYS-PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPV   S PPP   S PPP K    ++  PP K   PPP   +  PP
Sbjct: 1330 PPVPQVSLPPPKQESLPPPAK----EAEAPPAKESKPPPAMEAEAPP 1372

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/127 (36%), Positives = 56/127 (44%), Gaps = 21/127 (16%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKH-YSPPPVYHSPP----PPKK 157
           SPPP  + Y+P P   +PP    PP       SPPPP    ++P P   +PP    PP  
Sbjct: 595 SPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTP 654

Query: 158 HYVYKSPPPPVKH-YSPPPVYHSPP----PPKKHYVYKSPPPPVKH-------YSPPPVY 301
                SPPPP    ++P P   +PP    PP       SPPPP           S PPV 
Sbjct: 655 ESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVE 714

Query: 302 HSPPPPK 322
            SPP P+
Sbjct: 715 KSPPTPE 721

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 45/109 (41%), Positives = 50/109 (45%), Gaps = 1/109 (0%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSP 178
            KSPP      S PP   S PPP      KS PP  + Y PP P   +PPP +     KSP
Sbjct: 896  KSPPSHTPESSSPPSKESEPPPTP--TPKSSPPSHEEYVPPSPAKSTPPPEE-----KSP 948

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            P      S PP   S PPP      KS PP  + Y PP    S PPP+K
Sbjct: 949  PSHTPESSSPPSEESEPPPSP--TPKSSPPSHEEYVPPSPAKSTPPPEK 995

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 54/140 (38%), Positives = 57/140 (40%), Gaps = 34/140 (24%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKK-------------HYVYKSPPPPVKHYSPP--PVYHSP 142
            PP PVK  SPPP   S PPP               H    S PPP K  SPP  PV   P
Sbjct: 1016 PPSPVKS-SPPPAEKSQPPPSPVESVLPPVKSSPPHAPVISEPPPTKS-SPPQVPVTSEP 1073

Query: 143  PP---------------PKKHYVYKSP----PPPVKHYSPPPVYHSPPPPKKHYVYKSPP 265
            PP               P+K Y   +P    PP V   S PP   S PPP        PP
Sbjct: 1074 PPAKSSPPHEPISPPETPEKSYPPSTPEESSPPSVPKASSPPTEKSLPPPA---TVSLPP 1130

Query: 266  PPVKHYSPPPVYHSPPPPKK 325
            P VK   PP    SPPPP+K
Sbjct: 1131 PTVKPLPPPVPVSSPPPPEK 1150

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 49/115 (42%), Positives = 54/115 (46%), Gaps = 8/115 (6%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVKHYSPP-PVYHSPPPPKKHY 163
            KS PP  + Y PP    S PPP+K     +P     PP  + Y PP PV  SPPP +K  
Sbjct: 972  KSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEK-- 1029

Query: 164  VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPK 322
                PPP       PPV  SPP    H    S PPP K  SPP  PV   PPP K
Sbjct: 1030 --SQPPPSPVESVLPPVKSSPP----HAPVISEPPPTKS-SPPQVPVTSEPPPAK 1077

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 44/112 (39%), Positives = 51/112 (45%), Gaps = 5/112 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           SPPP  K    P   HSPPP P+ H    +P PP    S PP   SPP P+      SPP
Sbjct: 548 SPPPEGKSPPTPTASHSPPPVPEGH----TPSPP---KSGPPAGESPPTPESK---ASPP 597

Query: 182 PPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           P  + Y+P P   +PP    PP       SPPPP      P    S PP +K
Sbjct: 598 PTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEK 649

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 56/126 (44%), Positives = 60/126 (47%), Gaps = 19/126 (15%)
 Frame = +2

Query: 2   KSPPPPV-KHYSPPPVY---HSPPPPKK-HYVYKSPP-PPVKHYSPPPVY---HSPPPPK 154
           KSPP P  K  SPPP     H+P PP+      KSPP P  K  SPPP     H+P PPK
Sbjct: 616 KSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPK 675

Query: 155 K-HYVYKSPPPPVKHYS----PPPVYHSPPPPKK-HYVYKSPPPPVKHYS----PPPVYH 304
                 KSPP P    S    P P  H P PPK    V KSPP P    S    P P  H
Sbjct: 676 STPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGH 735

Query: 305 SPPPPK 322
           +P PPK
Sbjct: 736 TPSPPK 741

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 54/124 (43%), Positives = 60/124 (48%), Gaps = 17/124 (13%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV--YHSPPPPKK-HYVYKSPP-PPVKHYSPPPVY---HSPPPPKK- 157
           +SPP P    SPPP    ++P PPK      KSPP P  K  SPPP     H+P PP+  
Sbjct: 585 ESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPEST 644

Query: 158 HYVYKSPP-PPVKHYSPPPVY---HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSP 310
               KSPP P  K  SPPP     H+P PPK      KSPP P    S    P P  H P
Sbjct: 645 PPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMP 704

Query: 311 PPPK 322
            PPK
Sbjct: 705 SPPK 708

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 40/106 (37%), Positives = 45/106 (42%), Gaps = 1/106 (0%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-PPPVYHSPPPPKKHYVYKSPPP 184
            PPP VK   PP     PPP       K  PPPV   S PPP   S PPP K    ++  P
Sbjct: 1305 PPPAVKPLPPPAPVSLPPP-----AVKPLPPPVPQVSLPPPKQESLPPPAK----EAEAP 1355

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
            P K   PPP   +  PP        PP     Y+      SPPPP+
Sbjct: 1356 PAKESKPPPAMEAEAPPAFDTTVLLPPVMAHQYA------SPPPPQ 1395

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 45/123 (36%), Positives = 55/123 (44%), Gaps = 17/123 (13%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVY------HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           PP     Y  PP        H PPPP++    +SP  P +  +P P   SP  P K  + 
Sbjct: 438 PPEKSPAYEEPPAAPSTPTSHGPPPPEE----ESPEEPPEEPTPSPTPSSPESPAK--MA 491

Query: 170 KSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSP------PP---PVKHYSPPPV-YHSPPP 316
             P P +K   SPP  Y +PPPP   ++ KSP      PP   P   YSPP     SPPP
Sbjct: 492 PPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPP 551

Query: 317 PKK 325
             K
Sbjct: 552 EGK 554

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 45/135 (33%), Positives = 55/135 (40%), Gaps = 29/135 (21%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPP-PPKKHYVYKSPPP----PVKHYSPPPVYHSPPPPKKHYV- 166
           +P  P +    PP+   P  PP+K   Y+ PP     P  H  PPP   SP  P +    
Sbjct: 418 TPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHGPPPPEEESPEEPPEEPTP 477

Query: 167 ----------YKSPPPPVKHY----SPPPVYHSPPPPKKHYVYKSP-----PP----PVK 277
                      K  PPP        SPP  Y +PPPP   ++ KSP     PP    P  
Sbjct: 478 SPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPT 537

Query: 278 HYSPPPVYHSPPPPK 322
            YSPP    S PPP+
Sbjct: 538 EYSPPATPESSPPPE 552

[118][TOP]
>UniRef100_B9HBD6 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9HBD6_POPTR
          Length = 525

 Score =  103 bits (258), Expect = 5e-21
 Identities = 58/118 (49%), Positives = 67/118 (56%), Gaps = 13/118 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYH------SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHY 163
           SPPPPV+    PP YH      SPPPP  HY    P PPP++  SP   YH PPPP  H 
Sbjct: 388 SPPPPVEQQ--PPTYHHIPPPPSPPPPPSHYHSNHPAPPPIEKVSPGTHYHVPPPPPSHQ 445

Query: 164 VYKSPPPPVKHYS-PPPVYH--SPPPPKKHYVYKSPPPPVKHYS-PPPVYH--SPPPP 319
            Y++PPPP +    P P YH  SPPPP     Y++PPPP +    P P YH  SPPPP
Sbjct: 446 -YQAPPPPKQSAEVPAPSYHPNSPPPPPPSCQYQAPPPPKQSAGVPAPSYHTNSPPPP 502

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/118 (45%), Positives = 62/118 (52%), Gaps = 10/118 (8%)
 Frame = +2

Query: 17  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK------HYSPPPVYHSPPPPKKHYVYKSP 178
           P  H  PPP    PPPP       SPPPPV+      H+ PPP   SPPPP  HY    P
Sbjct: 375 PRTHLPPPP----PPPP-------SPPPPVEQQPPTYHHIPPP--PSPPPPPSHYHSNHP 421

Query: 179 -PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-PPPVYH--SPPPPKKHYVYK 340
            PPP++  SP   YH PPPP  H  Y++PPPP +    P P YH  SPPPP     Y+
Sbjct: 422 APPPIEKVSPGTHYHVPPPPPSHQ-YQAPPPPKQSAEVPAPSYHPNSPPPPPPSCQYQ 478

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 50/117 (42%), Positives = 61/117 (52%), Gaps = 20/117 (17%)
 Frame = +2

Query: 5   SPPPPVKHY-----SPPPV--------YHSPPPPKKHYVYKSPPPPVKHYS-PPPVYH-- 136
           SPPPP  HY     +PPP+        YH PPPP  H  Y++PPPP +    P P YH  
Sbjct: 408 SPPPPPSHYHSNHPAPPPIEKVSPGTHYHVPPPPPSHQ-YQAPPPPKQSAEVPAPSYHPN 466

Query: 137 SPPPPKKHYVYKSPPPPVKHYS-PPPVYHS---PPPPKKHYVYKSPPPPVKHYSPPP 295
           SPPPP     Y++PPPP +    P P YH+   PPPP     Y   PPP +  +P P
Sbjct: 467 SPPPPPPSCQYQAPPPPKQSAGVPAPSYHTNSPPPPPPPTNGYTHSPPPTQPTAPVP 523

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/117 (37%), Positives = 54/117 (46%), Gaps = 14/117 (11%)
 Frame = +2

Query: 11  PPPVK--------HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-PPPVYH--SPPPPKK 157
           PPP++        H  PPP  H          Y++PPPP +    P P YH  SPPPP  
Sbjct: 423 PPPIEKVSPGTHYHVPPPPPSHQ---------YQAPPPPKQSAEVPAPSYHPNSPPPPPP 473

Query: 158 HYVYKSPPPPVKHYS-PPPVYHSPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPPP 319
              Y++PPPP +    P P YH+  PP        PPPP   Y  SPPP   + P P
Sbjct: 474 SCQYQAPPPPKQSAGVPAPSYHTNSPP-------PPPPPTNGYTHSPPPTQPTAPVP 523

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 32/77 (41%), Positives = 41/77 (53%), Gaps = 7/77 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYS-PPPVYH--SPPPPKKHYVYKSPPPPVKHYS-PPPVYHS---PPPPKKH 160
           ++PPPP +    P P YH  SPPPP     Y++PPPP +    P P YH+   PPPP   
Sbjct: 447 QAPPPPKQSAEVPAPSYHPNSPPPPPPSCQYQAPPPPKQSAGVPAPSYHTNSPPPPPPPT 506

Query: 161 YVYKSPPPPVKHYSPPP 211
             Y   PPP +  +P P
Sbjct: 507 NGYTHSPPPTQPTAPVP 523

[119][TOP]
>UniRef100_B9G8N7 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9G8N7_ORYSJ
          Length = 1360

 Score =  103 bits (258), Expect = 5e-21
 Identities = 58/116 (50%), Positives = 62/116 (53%), Gaps = 8/116 (6%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYV- 166
            K  PPPV   SPPP   SPPPP    +     KSPPPP    SPPP   SPPPP    + 
Sbjct: 1134 KPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILP 1193

Query: 167  ---YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
                KSPPPP    SPPP   SPPPP    +   PPPPVK   PP    SPPPP+K
Sbjct: 1194 PPPVKSPPPPAPVISPPPPVKSPPPPAPVIL---PPPPVKSPPPPAPVISPPPPEK 1246

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/110 (49%), Positives = 57/110 (51%), Gaps = 4/110 (3%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
            KSPPPP    SPPP   SPPPP    +     KSPPPP    SPPP   SPPPP    + 
Sbjct: 1166 KSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVIL- 1224

Query: 170  KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              PPPPVK   PP    SPPPP+     KSPPP       PP   S PPP
Sbjct: 1225 --PPPPVKSPPPPAPVISPPPPE-----KSPPPAAPVILSPPAVKSLPPP 1267

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/121 (44%), Positives = 57/121 (47%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH------- 160
            +S PP V   S PP   S PPP        PPP VK   PP    SPPPP+K        
Sbjct: 1102 ESSPPSVPKASSPPTEKSLPPPA---TVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPV 1158

Query: 161  ----YVYKSPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPP 316
                   KSPPPP    SPPP   SPPPP    +     KSPPPP    SPPP   SPPP
Sbjct: 1159 ILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPP 1218

Query: 317  P 319
            P
Sbjct: 1219 P 1219

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 59/131 (45%), Positives = 64/131 (48%), Gaps = 23/131 (17%)
 Frame = +2

Query: 2    KSPP-PPVKHYSPP-PVYHSPPPPKK----------HYVYKSPPPPVKHYSPPPVYHSPP 145
            KSPP PP  H SPP P  ++P PPK           H   KSPP      SPPP   SPP
Sbjct: 748  KSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPP 807

Query: 146  PPKKHYVYKSPPPPVKHYSPP---------PVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
             P +     SPP P K  SPP         PV  S PPP+ H    S PPP K  SPPP 
Sbjct: 808  TPAEE---SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHV---SSPPPEKSSSPPPE 861

Query: 299  YH--SPPPPKK 325
             H  SPPPP+K
Sbjct: 862  AHVSSPPPPEK 872

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 54/118 (45%), Positives = 57/118 (48%), Gaps = 14/118 (11%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP---------PVYHSPPPPK 154
            KSPP      SPPP   SPP P +     SPP P K  SPP         PV  S PPP+
Sbjct: 788  KSPPSEAHPTSPPPSEKSPPTPAEE---SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPE 844

Query: 155  KHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH---YVYKSPPPPVKHYSPPPVYHSPP 313
             H    S PPP K  SPPP  H  SPPPP+K       KSPP      SPPP   SPP
Sbjct: 845  AHV---SSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPP 899

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 56/134 (41%), Positives = 61/134 (45%), Gaps = 23/134 (17%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPKKHYVYKSP 178
            KSPP P +  SPP    SP PP  H    +PP PVK  SPPP  H S PPP+K     SP
Sbjct: 804  KSPPTPAEESSPPTPEKSPSPPSGHE--GTPPSPVKSSSPPPEAHVSSPPPEKS---SSP 858

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVY------------KSPP--------PPVKHYSPP-- 292
            PP     SPPP   SPPPP+                 KSPP        PP K   PP  
Sbjct: 859  PPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPT 918

Query: 293  PVYHSPPPPKKHYV 334
            P   S PP  + YV
Sbjct: 919  PTPKSSPPSHEEYV 932

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/121 (42%), Positives = 58/121 (47%), Gaps = 13/121 (10%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYV----------YKSPPPPVKHYSPPPVYH--SPP 145
            KS PP  K    PP  H+ PP  + Y            KSPPP     SPP   H  SPP
Sbjct: 741  KSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPP 800

Query: 146  PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPK 322
            P +     KSPP P +  SPP    SP PP  H    +PP PVK  SPPP  H S PPP+
Sbjct: 801  PSE-----KSPPTPAEESSPPTPEKSPSPPSGH--EGTPPSPVKSSSPPPEAHVSSPPPE 853

Query: 323  K 325
            K
Sbjct: 854  K 854

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 55/129 (42%), Positives = 60/129 (46%), Gaps = 21/129 (16%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH--- 160
            KSP PP  H   PP  V  S PPP+ H    S PPP K  SPPP  H  SPPPP+K    
Sbjct: 820  KSPSPPSGHEGTPPSPVKSSSPPPEAHV---SSPPPEKSSSPPPEAHVSSPPPPEKSPPP 876

Query: 161  YVYKSPPPPVKHYSPPPVYHSPP--------PPKKHY------VYKSPPPPVKHYSPPPV 298
               KSPP      SPPP   SPP        PP K          KS PP  + Y PP  
Sbjct: 877  PETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSP 936

Query: 299  YHSPPPPKK 325
              S PPP++
Sbjct: 937  AKSTPPPEE 945

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 56/135 (41%), Positives = 61/135 (45%), Gaps = 26/135 (19%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVY----HSPPPPKKHYVY-KSPP-PPVKHYSPP-PVYHSPPPPKK- 157
            KSPP P    S PP      H+P PPK      KSPP PP  H SPP P  ++P PPK  
Sbjct: 715  KSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSS 774

Query: 158  ---------HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP------ 292
                     H   KSPP      SPPP   SPP P +     SPP P K  SPP      
Sbjct: 775  PPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEE---SSPPTPEKSPSPPSGHEGT 831

Query: 293  ---PVYHSPPPPKKH 328
               PV  S PPP+ H
Sbjct: 832  PPSPVKSSSPPPEAH 846

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 49/119 (41%), Positives = 60/119 (50%), Gaps = 12/119 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSP 178
           +SP  P +  +P P   SP  P K  +   P P +K   SPP  Y +PPPP   ++ KSP
Sbjct: 466 ESPEEPPEEPTPSPTPSSPESPAK--MAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSP 523

Query: 179 ------PP---PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPK 322
                 PP   P   YSPP    S PPP+     KSPP P   +SPPPV   H+P PPK
Sbjct: 524 ERKKAPPPQAEPPTEYSPPATPESSPPPEG----KSPPTPTASHSPPPVPEGHTPSPPK 578

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 55/128 (42%), Positives = 58/128 (45%), Gaps = 22/128 (17%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVY----HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSPPPPK 154
            KSPP P    S PP      H P PPK    V KSPP P    S    P P  H+P PPK
Sbjct: 682  KSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPK 741

Query: 155  KH-YVYKSPP-PPVKHYSPP-PVYHSPPPPKK----------HYVYKSPPPPVKHYSPPP 295
                  KSPP PP  H SPP P  ++P PPK           H   KSPP      SPPP
Sbjct: 742  SSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPP 801

Query: 296  VYHSPPPP 319
               SPP P
Sbjct: 802  SEKSPPTP 809

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/114 (41%), Positives = 55/114 (48%), Gaps = 6/114 (5%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KS PP  + Y PP    S PPP++    KSPP      S PP   S PPP      KS P
Sbjct: 922  KSSPPSHEEYVPPSPAKSTPPPEE----KSPPSHTPESSSPPSEESEPPPSP--TPKSSP 975

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVKHYSPP-PVYHSPPPPKK 325
            P  + Y PP    S PPP+K     +P     PP  + Y PP PV  SPPP +K
Sbjct: 976  PSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEK 1029

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/120 (40%), Positives = 58/120 (48%), Gaps = 12/120 (10%)
 Frame = +2

Query: 8   PPPPVKHY-SPPPVYHSPPPPKKHYVYKSP------PP---PVKHYSPPPVYHSPPPPKK 157
           P P +K   SPP  Y +PPPP   ++ KSP      PP   P   YSPP    S PPP+ 
Sbjct: 494 PAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEG 553

Query: 158 HYVYKSPPPPVKHYSPPPVY--HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
               KSPP P   +SPPPV   H+P PPK      S PP  +    P    SPPP  + Y
Sbjct: 554 ----KSPPTPTASHSPPPVPEGHTPSPPK------SGPPAGESPPTPESKASPPPTPEEY 603

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 57/124 (45%), Positives = 61/124 (49%), Gaps = 17/124 (13%)
 Frame = +2

Query: 2    KSPPPPV-KHYSPPPVY---HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSPPPPK 154
            KSPP P  K  SPPP     H+P PPK      KSPP P    S    P P  H P PPK
Sbjct: 649  KSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPK 708

Query: 155  K-HYVYKSPPPPVKHYS----PPPVYHSPPPPKKH-YVYKSPP-PPVKHYSPP-PVYHSP 310
                V KSPP P    S    P P  H+P PPK      KSPP PP  H SPP P  ++P
Sbjct: 709  STPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTP 768

Query: 311  PPPK 322
             PPK
Sbjct: 769  SPPK 772

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 49/135 (36%), Positives = 58/135 (42%), Gaps = 28/135 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVY--HSPPPPKKH----------YVYKSPPPPVKHYSPPPVYHSPP 145
           KSPP P   +SPPPV   H+P PPK                SPPP  + Y+P P   +PP
Sbjct: 554 KSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPP 613

Query: 146 ----PPKKHYVYKSPPPPVKH-YSPPPVYHSPP----PPKKHYVYKSPPPPVKH------ 280
               PP       SPPPP    ++P P   +PP    PP       SPPPP         
Sbjct: 614 AEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSP 673

Query: 281 -YSPPPVYHSPPPPK 322
             S PP   SPP P+
Sbjct: 674 PKSTPPTEKSPPTPE 688

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 55/139 (39%), Positives = 61/139 (43%), Gaps = 29/139 (20%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYH--SPPPPKKHYV---YKSPPPPVKHYSPPPVYHSPP-------- 145
            S PPP K  SPPP  H  SPPPP+K       KSPP      SPPP   SPP        
Sbjct: 848  SSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSS 907

Query: 146  PPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP--------PPVKHY 283
            PP K          KS PP  + Y PP    S PPP++    KSPP        PP +  
Sbjct: 908  PPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEE----KSPPSHTPESSSPPSEES 963

Query: 284  SPPP--VYHSPPPPKKHYV 334
             PPP     S PP  + YV
Sbjct: 964  EPPPSPTPKSSPPSHEEYV 982

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/127 (36%), Positives = 56/127 (44%), Gaps = 21/127 (16%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKH-YSPPPVYHSPP----PPKK 157
           SPPP  + Y+P P   +PP    PP       SPPPP    ++P P   +PP    PP  
Sbjct: 595 SPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTP 654

Query: 158 HYVYKSPPPPVKH-YSPPPVYHSPP----PPKKHYVYKSPPPPVKH-------YSPPPVY 301
                SPPPP    ++P P   +PP    PP       SPPPP           S PPV 
Sbjct: 655 ESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVE 714

Query: 302 HSPPPPK 322
            SPP P+
Sbjct: 715 KSPPTPE 721

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 45/109 (41%), Positives = 50/109 (45%), Gaps = 1/109 (0%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSP 178
            KSPP      S PP   S PPP      KS PP  + Y PP P   +PPP +     KSP
Sbjct: 896  KSPPSHTPESSSPPSKESEPPPTP--TPKSSPPSHEEYVPPSPAKSTPPPEE-----KSP 948

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            P      S PP   S PPP      KS PP  + Y PP    S PPP+K
Sbjct: 949  PSHTPESSSPPSEESEPPPSP--TPKSSPPSHEEYVPPSPAKSTPPPEK 995

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 54/140 (38%), Positives = 57/140 (40%), Gaps = 34/140 (24%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKK-------------HYVYKSPPPPVKHYSPP--PVYHSP 142
            PP PVK  SPPP   S PPP               H    S PPP K  SPP  PV   P
Sbjct: 1016 PPSPVKS-SPPPAEKSQPPPSPVESVLPPVKSSPPHAPVISEPPPTKS-SPPQVPVTSEP 1073

Query: 143  PP---------------PKKHYVYKSP----PPPVKHYSPPPVYHSPPPPKKHYVYKSPP 265
            PP               P+K Y   +P    PP V   S PP   S PPP        PP
Sbjct: 1074 PPAKSSPPHEPISPPETPEKSYPPSTPEESSPPSVPKASSPPTEKSLPPPA---TVSLPP 1130

Query: 266  PPVKHYSPPPVYHSPPPPKK 325
            P VK   PP    SPPPP+K
Sbjct: 1131 PTVKPLPPPVPVSSPPPPEK 1150

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 49/115 (42%), Positives = 54/115 (46%), Gaps = 8/115 (6%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVKHYSPP-PVYHSPPPPKKHY 163
            KS PP  + Y PP    S PPP+K     +P     PP  + Y PP PV  SPPP +K  
Sbjct: 972  KSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEK-- 1029

Query: 164  VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPK 322
                PPP       PPV  SPP    H    S PPP K  SPP  PV   PPP K
Sbjct: 1030 --SQPPPSPVESVLPPVKSSPP----HAPVISEPPPTKS-SPPQVPVTSEPPPAK 1077

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 44/112 (39%), Positives = 51/112 (45%), Gaps = 5/112 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           SPPP  K    P   HSPPP P+ H    +P PP    S PP   SPP P+      SPP
Sbjct: 548 SPPPEGKSPPTPTASHSPPPVPEGH----TPSPP---KSGPPAGESPPTPESK---ASPP 597

Query: 182 PPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           P  + Y+P P   +PP    PP       SPPPP      P    S PP +K
Sbjct: 598 PTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEK 649

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 56/126 (44%), Positives = 60/126 (47%), Gaps = 19/126 (15%)
 Frame = +2

Query: 2   KSPPPPV-KHYSPPPVY---HSPPPPKK-HYVYKSPP-PPVKHYSPPPVY---HSPPPPK 154
           KSPP P  K  SPPP     H+P PP+      KSPP P  K  SPPP     H+P PPK
Sbjct: 616 KSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPK 675

Query: 155 K-HYVYKSPPPPVKHYS----PPPVYHSPPPPKK-HYVYKSPPPPVKHYS----PPPVYH 304
                 KSPP P    S    P P  H P PPK    V KSPP P    S    P P  H
Sbjct: 676 STPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGH 735

Query: 305 SPPPPK 322
           +P PPK
Sbjct: 736 TPSPPK 741

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 54/124 (43%), Positives = 60/124 (48%), Gaps = 17/124 (13%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV--YHSPPPPKK-HYVYKSPP-PPVKHYSPPPVY---HSPPPPKK- 157
           +SPP P    SPPP    ++P PPK      KSPP P  K  SPPP     H+P PP+  
Sbjct: 585 ESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPEST 644

Query: 158 HYVYKSPP-PPVKHYSPPPVY---HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSP 310
               KSPP P  K  SPPP     H+P PPK      KSPP P    S    P P  H P
Sbjct: 645 PPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMP 704

Query: 311 PPPK 322
            PPK
Sbjct: 705 SPPK 708

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 45/123 (36%), Positives = 55/123 (44%), Gaps = 17/123 (13%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVY------HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           PP     Y  PP        H PPPP++    +SP  P +  +P P   SP  P K  + 
Sbjct: 438 PPEKSPAYEEPPAAPSTPTSHGPPPPEE----ESPEEPPEEPTPSPTPSSPESPAK--MA 491

Query: 170 KSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSP------PP---PVKHYSPPPV-YHSPPP 316
             P P +K   SPP  Y +PPPP   ++ KSP      PP   P   YSPP     SPPP
Sbjct: 492 PPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPP 551

Query: 317 PKK 325
             K
Sbjct: 552 EGK 554

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 45/135 (33%), Positives = 55/135 (40%), Gaps = 29/135 (21%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPP-PPKKHYVYKSPPP----PVKHYSPPPVYHSPPPPKKHYV- 166
           +P  P +    PP+   P  PP+K   Y+ PP     P  H  PPP   SP  P +    
Sbjct: 418 TPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHGPPPPEEESPEEPPEEPTP 477

Query: 167 ----------YKSPPPPVKHY----SPPPVYHSPPPPKKHYVYKSP-----PP----PVK 277
                      K  PPP        SPP  Y +PPPP   ++ KSP     PP    P  
Sbjct: 478 SPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPT 537

Query: 278 HYSPPPVYHSPPPPK 322
            YSPP    S PPP+
Sbjct: 538 EYSPPATPESSPPPE 552

[120][TOP]
>UniRef100_Q40146 Extensin (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q40146_SOLLC
          Length = 80

 Score =  103 bits (257), Expect = 6e-21
 Identities = 56/94 (59%), Positives = 57/94 (60%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPPVK Y P PVY SPPPP    VYKSPP PVK Y P P  + P P      YKSPP
Sbjct: 3   KSPPPPVKPYHPTPVYKSPPPPTP--VYKSPPSPVKPYHPSPTPYHPTP-----AYKSPP 55

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
           PP       PVY SPPP   HYV  SPPPP  HY
Sbjct: 56  PPT------PVYKSPPP--THYVSSSPPPPY-HY 80

 Score =  100 bits (249), Expect = 5e-20
 Identities = 52/87 (59%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +2

Query: 80  VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 259
           VYKSPPPPVK Y P PVY SPPPP    VYKSPP PVK Y P P  + P P      YKS
Sbjct: 1   VYKSPPPPVKPYHPTPVYKSPPPPTP--VYKSPPSPVKPYHPSPTPYHPTP-----AYKS 53

Query: 260 PPPPVKHY-SPPPVYH--SPPPPKKHY 331
           PPPP   Y SPPP ++  S PPP  HY
Sbjct: 54  PPPPTPVYKSPPPTHYVSSSPPPPYHY 80

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 41/74 (55%), Positives = 41/74 (55%), Gaps = 17/74 (22%)
 Frame = +2

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK---------------HYSPP-- 292
           VYKSPPPPVK Y P PVY SPPPP    VYKSPP PVK                  PP  
Sbjct: 1   VYKSPPPPVKPYHPTPVYKSPPPPTP--VYKSPPSPVKPYHPSPTPYHPTPAYKSPPPPT 58

Query: 293 PVYHSPPPPKKHYV 334
           PVY SPPP   HYV
Sbjct: 59  PVYKSPPP--THYV 70

[121][TOP]
>UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019841A9
          Length = 525

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/109 (51%), Positives = 60/109 (55%), Gaps = 6/109 (5%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP   YSPPPV+  PPP        SPPPP     PPPVY  PPPP    VY  PPPP 
Sbjct: 421 PPPTPVYSPPPVFSPPPPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPP---VYSPPPPPP 477

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPV----YHSPPPP 319
               PPPV  SPPPP    +Y+SPPPP   Y    PP+    Y SPPPP
Sbjct: 478 PPPPPPPVX-SPPPP---IIYESPPPPTPVYEGPLPPIFGVSYASPPPP 522

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 55/117 (47%), Positives = 58/117 (49%), Gaps = 8/117 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           +PPPP      PPV+ SPPP   +    SPPP      PPPV  SPPPP       SPPP
Sbjct: 409 TPPPP-----SPPVFPSPPPTPVY----SPPPVFS--PPPPVLSSPPPP-------SPPP 450

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--------YHSPPPPKKHY 331
           P     PPPVY  PPPP    VY  PPPP     PPPV        Y SPPPP   Y
Sbjct: 451 PSPSPPPPPVYSPPPPPP---VYSPPPPPPPPPPPPPVXSPPPPIIYESPPPPTPVY 504

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/89 (52%), Positives = 49/89 (55%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPPVY  PPPP    VY  PPPP     PPPV  SPPPP    +Y+SPPP
Sbjct: 447 SPPPPSPSPPPPPVYSPPPPPP---VYSPPPPPPPPPPPPPV-XSPPPP---IIYESPPP 499

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPP 271
           P       PVY  P PP     Y SPPPP
Sbjct: 500 PT------PVYEGPLPPIFGVSYASPPPP 522

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/93 (52%), Positives = 52/93 (55%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 220
           P   +PPPP        PP PV  YSPPPV+ SPPPP    V  SPPPP    SPPP   
Sbjct: 405 PSLPTPPPPSPPVFPSPPPTPV--YSPPPVF-SPPPP----VLSSPPPP----SPPPPSP 453

Query: 221 SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP  +    SPPPP      PPVY SPPPP
Sbjct: 454 SPPPPPVY----SPPPP------PPVY-SPPPP 475

[122][TOP]
>UniRef100_UPI0001985257 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001985257
          Length = 448

 Score =  102 bits (254), Expect = 1e-20
 Identities = 48/103 (46%), Positives = 59/103 (57%)
 Frame = +2

Query: 20  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 199
           + +Y+ PP   SPPPP  H   + PPPP  H +PPP  H+ PPP  H     PPPP  H 
Sbjct: 6   INYYNFPPF--SPPPPPPH---RRPPPPPPHINPPPPPHTRPPPPPH---TRPPPPPPHI 57

Query: 200 SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           +PPP  H+ PPP  H   + PPPP  H +PPP  H+ PPP  H
Sbjct: 58  NPPPPPHTRPPPPPH---RRPPPPPPHINPPPPPHTRPPPPPH 97

 Score =  102 bits (254), Expect = 1e-20
 Identities = 48/103 (46%), Positives = 57/103 (55%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           + PPPP  H +PPP  H+ PPP  H     PPPP  H +PPP  H+ PPP  H   + PP
Sbjct: 23  RRPPPPPPHINPPPPPHTRPPPPPH---TRPPPPPPHINPPPPPHTRPPPPPH---RRPP 76

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 310
           PP  H +PPP  H+ PPP  H    + PPP  H  PPP   SP
Sbjct: 77  PPPPHINPPPPPHTRPPPPPH----TRPPPPPHVLPPPPSPSP 115

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 51/109 (46%), Positives = 57/109 (52%), Gaps = 1/109 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  H  PPP     PPP     + +PPPP     PPP +  PPPP  H    +PPP
Sbjct: 15  SPPPPPPHRRPPP-----PPP-----HINPPPPPHTRPPPPPHTRPPPPPPHI---NPPP 61

Query: 185 PVKHYSPPPVYH-SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           P  H  PPP  H  PPPP  H    +PPPP  H  PPP  H+ PPP  H
Sbjct: 62  P-PHTRPPPPPHRRPPPPPPHI---NPPPP-PHTRPPPPPHTRPPPPPH 105

[123][TOP]
>UniRef100_Q5W1I2 Putative extensin (Fragment) n=1 Tax=Nicotiana glauca
           RepID=Q5W1I2_NICGL
          Length = 85

 Score =  102 bits (254), Expect = 1e-20
 Identities = 57/92 (61%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-YSPP--PVYHSPPPPKKHYVYKSPP 181
           PPP+K Y P P  + P P     VYKSPPPP K  Y PP  PVY SPPPP    VYKSPP
Sbjct: 1   PPPMKPYHPSPTPYHPAP-----VYKSPPPPPKKPYYPPHTPVYKSPPPPTP--VYKSPP 53

Query: 182 PPVKHYSPP--PVYHSPPPPKKHYVYKSPPPP 271
           PP K Y PP  PVY SPPPP    VYKSPPPP
Sbjct: 54  PPKKPYYPPHTPVYKSPPPPTP--VYKSPPPP 83

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 50/84 (59%), Positives = 52/84 (61%), Gaps = 5/84 (5%)
 Frame = +2

Query: 95  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-YSPP--PVYHSPPPPKKHYVYKSPP 265
           PPP+K Y P P  + P P     VYKSPPPP K  Y PP  PVY SPPPP    VYKSPP
Sbjct: 1   PPPMKPYHPSPTPYHPAP-----VYKSPPPPPKKPYYPPHTPVYKSPPPPTP--VYKSPP 53

Query: 266 PPVKHYSPP--PVYHSPPPPKKHY 331
           PP K Y PP  PVY SPPPP   Y
Sbjct: 54  PPKKPYYPPHTPVYKSPPPPTPVY 77

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 44/64 (68%), Positives = 44/64 (68%), Gaps = 4/64 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYKS 175
           PPPP K Y PP  PVY SPPPP    VYKSPPPP K Y PP  PVY SPPPP    VYKS
Sbjct: 24  PPPPKKPYYPPHTPVYKSPPPPTP--VYKSPPPPKKPYYPPHTPVYKSPPPPTP--VYKS 79

Query: 176 PPPP 187
           PPPP
Sbjct: 80  PPPP 83

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 2/36 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPP 103
           KSPPPP K Y PP  PVY SPPPP    VYKSPPPP
Sbjct: 50  KSPPPPKKPYYPPHTPVYKSPPPPTP--VYKSPPPP 83

[124][TOP]
>UniRef100_C5Y7E8 Putative uncharacterized protein Sb05g025945 (Fragment) n=1
           Tax=Sorghum bicolor RepID=C5Y7E8_SORBI
          Length = 360

 Score =  101 bits (251), Expect = 3e-20
 Identities = 59/110 (53%), Positives = 60/110 (54%), Gaps = 2/110 (1%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K  PPP    SPPP   SPPPP       SPPPPVK   PP    SPPPP      KSPP
Sbjct: 184 KPLPPPAPVSSPPPPVKSPPPPAP---VSSPPPPVKSPPPPAPLSSPPPP-----VKSPP 235

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKK 325
           PP    SPPP   SPPPP       SPPPPVK   PPP  V  SPPPP+K
Sbjct: 236 PPAPVSSPPPPVKSPPPPAP---VSSPPPPVKSPPPPPAPVS-SPPPPEK 281

 Score =  100 bits (248), Expect = 7e-20
 Identities = 56/111 (50%), Positives = 57/111 (51%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKK---HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 172
           K+ PPP    SPPP    PP PK         SPPPPVK   PP    SPPPP      K
Sbjct: 162 KTLPPPAPVSSPPPEVKPPPAPKPLPPPAPVSSPPPPVKSPPPPAPVSSPPPP-----VK 216

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           SPPPP    SPPP   SPPPP       SPPPPVK   PP    SPPPP K
Sbjct: 217 SPPPPAPLSSPPPPVKSPPPPAP---VSSPPPPVKSPPPPAPVSSPPPPVK 264

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 58/119 (48%), Positives = 61/119 (51%), Gaps = 12/119 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPVK   PP    SPPPP      KSPPPP    SPPP   SPPPP       SPPP
Sbjct: 210 SPPPPVKSPPPPAPLSSPPPP-----VKSPPPPAPVSSPPPPVKSPPPPAP---VSSPPP 261

Query: 185 PVKHYSPPPV-YHSPPPPKKHYVYKSP-----------PPPVKHYSPPPVYHSPPPPKK 325
           PVK   PPP    SPPPP+K     +P           PPP    SPPP   +P PPKK
Sbjct: 262 PVKSPPPPPAPVSSPPPPEKSPPPPAPVSSPPPKPPSLPPPAPVSSPPPAV-TPAPPKK 319

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 52/106 (49%), Positives = 52/106 (49%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPP  K   PP    SPPP  K      PPP  K   PP    SPPPP      KSPPPP
Sbjct: 157 PPPAPKTLPPPAPVSSPPPEVK------PPPAPKPLPPPAPVSSPPPP-----VKSPPPP 205

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
               SPPP   SPPPP       SPPPPVK   PP    SPPPP K
Sbjct: 206 APVSSPPPPVKSPPPPAP---LSSPPPPVKSPPPPAPVSSPPPPVK 248

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/108 (50%), Positives = 55/108 (50%), Gaps = 3/108 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP    SPPP   SPPPP       SPPPPVK   PP    SPPPP      KSPP
Sbjct: 216 KSPPPPAPLSSPPPPVKSPPPPAP---VSSPPPPVKSPPPPAPVSSPPPP-----VKSPP 267

Query: 182 PP---VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           PP   V   SPPP   SPPPP       SPPP      PP    SPPP
Sbjct: 268 PPPAPVS--SPPPPEKSPPPPAP---VSSPPPKPPSLPPPAPVSSPPP 310

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/109 (47%), Positives = 52/109 (47%), Gaps = 1/109 (0%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP- 178
           K  PPP    SPPPV  S PPP        PPP  K   PP    SPPP  K      P 
Sbjct: 130 KPSPPPAPVSSPPPVVKSSPPPAP---VSLPPPAPKTLPPPAPVSSPPPEVKPPPAPKPL 186

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           PPP    SPPP   SPPPP       SPPPPVK   PP    SPPPP K
Sbjct: 187 PPPAPVSSPPPPVKSPPPPAP---VSSPPPPVKSPPPPAPLSSPPPPVK 232

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 54/108 (50%), Positives = 56/108 (51%), Gaps = 2/108 (1%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKS 175
           KSPPPP    SPPP   SPPPP       SPPPPVK   PPP  V  SPPPP+     KS
Sbjct: 232 KSPPPPAPVSSPPPPVKSPPPPAP---VSSPPPPVKSPPPPPAPVS-SPPPPE-----KS 282

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPPP    SPPP   S PPP       SPPP V    P     +P PP
Sbjct: 283 PPPPAPVSSPPPKPPSLPPPAP---VSSPPPAVTPAPPKKEESTPAPP 327

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 53/111 (47%), Positives = 54/111 (48%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KS PPP    SPPP     PPP       SPPP VK  SPPP   S PPP      K+ P
Sbjct: 114 KSTPPPAPVSSPPPAPKPSPPPAP---VSSPPPVVKS-SPPPAPVSLPPPAP----KTLP 165

Query: 182 PPVKHYSPPPVYHSPPPPK---KHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           PP    SPPP    PP PK         SPPPPVK   PP    SPPPP K
Sbjct: 166 PPAPVSSPPPEVKPPPAPKPLPPPAPVSSPPPPVKSPPPPAPVSSPPPPVK 216

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 53/124 (42%), Positives = 57/124 (45%), Gaps = 18/124 (14%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPVK   PP    SPPPP K      PPPP    SPPP   SPPPP       SPPP
Sbjct: 242 SPPPPVKSPPPPAPVSSPPPPVK----SPPPPPAPVSSPPPPEKSPPPPAP---VSSPPP 294

Query: 185 PVKHYSPPPVYHSPP------PPKKHYVYKSPPPPVKHYSP--------PPV----YHSP 310
                 PP    SPP      PPKK     +P PP +   P        PP+    Y SP
Sbjct: 295 KPPSLPPPAPVSSPPPAVTPAPPKKE--ESTPAPPAESLPPPSFNDIILPPIMANKYASP 352

Query: 311 PPPK 322
           PPP+
Sbjct: 353 PPPQ 356

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/106 (47%), Positives = 53/106 (50%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5   SPPPPVK-HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           SPPP  +   SPPPV  S PPP+     K  PPP    SPPPV  S PPP       S P
Sbjct: 73  SPPPEDEEESSPPPVVKSSPPPE---TPKLSPPPAPVSSPPPVVKSTPPPAP----VSSP 125

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP    SPPP   S PPP    V KS PPP     PPP   + PPP
Sbjct: 126 PPAPKPSPPPAPVSSPPP----VVKSSPPPAPVSLPPPAPKTLPPP 167

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 51/116 (43%), Positives = 53/116 (45%), Gaps = 10/116 (8%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPP----KKHYVYKSPPPPVKHYSPPPVYHSPPPP-----K 154
           KS PPP    SPPP     PPP        V K  PPP    SPPP   S PPP      
Sbjct: 7   KSSPPPAPVSSPPPTPKPSPPPAPVKSPPQVEKKTPPPAPVSSPPPAVKSSPPPLTPKSS 66

Query: 155 KHYVYKSPPP-PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                 SPPP   +  SPPPV  S PPP+     K  PPP    SPPPV  S PPP
Sbjct: 67  GPPAQVSPPPEDEEESSPPPVVKSSPPPE---TPKLSPPPAPVSSPPPVVKSTPPP 119

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/108 (47%), Positives = 52/108 (48%), Gaps = 1/108 (0%)
 Frame = +2

Query: 2   KSPPPPVKH-YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           KS PPP     SPPP   S PPP    V KS PPP    SPPP     PPP       S 
Sbjct: 89  KSSPPPETPKLSPPPAPVSSPPP----VVKSTPPPAPVSSPPPAPKPSPPPAP----VSS 140

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           PPPV   SPPP   S PPP      K+ PPP    SPPP    PP PK
Sbjct: 141 PPPVVKSSPPPAPVSLPPPAP----KTLPPPAPVSSPPPEVKPPPAPK 184

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 45/104 (43%), Positives = 49/104 (47%), Gaps = 7/104 (6%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-SPP 208
           SPPPV  SPPP        SPPP  K   PP    SPP  +K    K+PPP      SPP
Sbjct: 2   SPPPVKSSPPPAP----VSSPPPTPKPSPPPAPVKSPPQVEK----KTPPPAP--VSSPP 51

Query: 209 PVYHSPPPP-----KKHYVYKSPPP-PVKHYSPPPVYHSPPPPK 322
           P   S PPP            SPPP   +  SPPPV  S PPP+
Sbjct: 52  PAVKSSPPPLTPKSSGPPAQVSPPPEDEEESSPPPVVKSSPPPE 95

[125][TOP]
>UniRef100_A9SB04 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SB04_PHYPA
          Length = 328

 Score =  101 bits (251), Expect = 3e-20
 Identities = 65/131 (49%), Positives = 68/131 (51%), Gaps = 21/131 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKS-PPPPVKHYSPPPVYHSPPPPKKHYVYKS- 175
           KSPPPP      PP   SPPPP    +YKS PPPPV     PPVY SPPPP     YKS 
Sbjct: 179 KSPPPP------PPSTSSPPPP----LYKSSPPPPVLKSPLPPVYKSPPPP----AYKSS 224

Query: 176 PPPPVKHYSPP---------PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-------- 304
           PPPP+   SPP         PVY SPPPP   YV  SPPPPV    PPP Y         
Sbjct: 225 PPPPLNKSSPPYVKSSPPLSPVYKSPPPP---YVKSSPPPPVYKSPPPPSYEKKSPPTPV 281

Query: 305 --SPPPPKKHY 331
             S PPP K +
Sbjct: 282 PKSSPPPLKDF 292

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 57/101 (56%), Positives = 59/101 (58%), Gaps = 9/101 (8%)
 Frame = +2

Query: 44  VYHSPPPPKKHY------VYK-SPPPPVKHYSPPPVYHSPPPPKKHYVYK-SPPPPVKHY 199
           V  SPPPP          +YK SPPPPV     PPVY SPPPP     YK SPPPP+   
Sbjct: 177 VNKSPPPPPPSTSSPPPPLYKSSPPPPVLKSPLPPVYKSPPPP----AYKSSPPPPLNKS 232

Query: 200 SPPPVYHSPPPPKKHYVYKSPPPP-VKHYSPPPVYHSPPPP 319
           SPP V  SPP      VYKSPPPP VK   PPPVY SPPPP
Sbjct: 233 SPPYVKSSPPLSP---VYKSPPPPYVKSSPPPPVYKSPPPP 270

[126][TOP]
>UniRef100_A9PGH1 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PGH1_POPTR
          Length = 346

 Score =  100 bits (248), Expect = 7e-20
 Identities = 46/114 (40%), Positives = 54/114 (47%), Gaps = 12/114 (10%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 193
           PP     PPP +H PPPP  HY Y+ PP        PP +H PPPP  HY  + P PP  
Sbjct: 28  PPPDTTPPPPSFHQPPPPSSHY-YQEPP-------QPPSFHQPPPPSSHYYQEPPQPPSF 79

Query: 194 HYSPP------------PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           H  PP            P +H PPPP  HY  + P PP  ++       SPPPP
Sbjct: 80  HQPPPPSSHYYQESPQTPSFHQPPPPSSHYYQEPPQPPRPYFQEATYAPSPPPP 133

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 39/85 (45%), Positives = 43/85 (50%), Gaps = 7/85 (8%)
 Frame = +2

Query: 98  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPP 268
           PP     PPP +H PPPP  HY  + P PP  H  PPP    Y  PP P     +  PPP
Sbjct: 28  PPPDTTPPPPSFHQPPPPSSHYYQEPPQPPSFHQPPPPSSHYYQEPPQPPS---FHQPPP 84

Query: 269 PVKHY---SP-PPVYHSPPPPKKHY 331
           P  HY   SP  P +H PPPP  HY
Sbjct: 85  PSSHYYQESPQTPSFHQPPPPSSHY 109

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 38/105 (36%), Positives = 46/105 (43%), Gaps = 12/105 (11%)
 Frame = +2

Query: 8   PPPPVKHY----SPPPVYHSPPPPKKHYVYKSP--------PPPVKHYSPPPVYHSPPPP 151
           PPPP  HY      PP +H PPPP  HY  +SP        PPP  HY     Y  PP P
Sbjct: 62  PPPPSSHYYQEPPQPPSFHQPPPPSSHYYQESPQTPSFHQPPPPSSHY-----YQEPPQP 116

Query: 152 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS 286
            + Y  ++   P    SPPP +      +  + Y  PP  V H S
Sbjct: 117 PRPYFQEATYAP----SPPPPFQETQVIRTSHHYPPPPTQVNHVS 157

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 37/102 (36%), Positives = 46/102 (45%), Gaps = 4/102 (3%)
 Frame = +2

Query: 38  PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 217
           PP +HS      H+  ++     +  + PP   +PPPP  H     PPPP  HY     Y
Sbjct: 4   PPGHHS----NTHHHRRNDDEEERRENYPPPDTTPPPPSFH----QPPPPSSHY-----Y 50

Query: 218 HSPPPPKKHYVYKSPPPPVKHY----SPPPVYHSPPPPKKHY 331
             PP P     +  PPPP  HY      PP +H PPPP  HY
Sbjct: 51  QEPPQPPS---FHQPPPPSSHYYQEPPQPPSFHQPPPPSSHY 89

[127][TOP]
>UniRef100_Q94ES2 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES2_PEA
          Length = 88

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 52/91 (57%), Positives = 53/91 (58%), Gaps = 10/91 (10%)
 Frame = +2

Query: 62  PPKKHYVYKSPPPPVKHY--SPPPVYHSPPPP----KKHYVYKSPPPPVKHYSPP----P 211
           P KK Y Y SPPPP  H    P PVYHSPPPP    KK Y Y SPPPP  H  PP    P
Sbjct: 1   PHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTP 60

Query: 212 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           VYHSPPPP     Y  PPP   + SPPP YH
Sbjct: 61  VYHSPPPP----AYSPPPPAYYYKSPPPPYH 87

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/68 (61%), Positives = 42/68 (61%), Gaps = 10/68 (14%)
 Frame = +2

Query: 146 PPKKHYVYKSPPPPVKHY--SPPPVYHSPPPP----KKHYVYKSPPPPVKHYSPP----P 295
           P KK Y Y SPPPP  H    P PVYHSPPPP    KK Y Y SPPPP  H  PP    P
Sbjct: 1   PHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTP 60

Query: 296 VYHSPPPP 319
           VYHSPPPP
Sbjct: 61  VYHSPPPP 68

[128][TOP]
>UniRef100_A3KD22 Leucine-rich repeat/extensin 1 n=1 Tax=Nicotiana tabacum
           RepID=A3KD22_TOBAC
          Length = 723

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 58/129 (44%), Positives = 63/129 (48%), Gaps = 23/129 (17%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKK----HYVYKSPPPPVKHYSPPPVYH----SPPPPKK 157
           +SPPPP  H   P   H+PPPP      +Y + SPPPP   Y  PP Y      PPPP  
Sbjct: 465 RSPPPPT-HKISPVTRHAPPPPPPPSPVYYHHPSPPPPQPVYYAPPTYKPQSPPPPPPPV 523

Query: 158 HY------VYKSPPPPVKHYSPPP-VYHSPPPPKKH-----YVYKSPPPPV---KHYSPP 292
           HY          PPPP  HY PPP    SPPPP  H     Y  +SPPPPV       PP
Sbjct: 524 HYEPPTYTPQSPPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYTPQSPPPPVYVTPSSPPP 583

Query: 293 PVYHSPPPP 319
           PVY  P PP
Sbjct: 584 PVYEHPKPP 592

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/134 (40%), Positives = 61/134 (45%), Gaps = 28/134 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH--------------YSPP----- 124
           +SPPPP  HY PP      PPP  +    SPPPPV                Y+PP     
Sbjct: 551 QSPPPPPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTPTPSPPAGYTPPQEPSH 610

Query: 125 ------PVYHSPPPPKK--HYVYKSPPPPVKHYSPPPVY-HSPPPPKKHYVYKSPPPPVK 277
                 P   +PPPP    H+  K  PPP   Y+P P Y  SPPPP   Y Y SPPPP  
Sbjct: 611 PAPPTPPCNETPPPPPSTPHWQPKPSPPPT--YNPSPSYTQSPPPPPPTYTYSSPPPPSS 668

Query: 278 HYSPPPVYHSPPPP 319
              PP  Y+S PPP
Sbjct: 669 SPPPPTYYYSSPPP 682

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 56/131 (42%), Positives = 65/131 (49%), Gaps = 21/131 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYV------YKSPPPPVKHYSPPPVYHSPPPPKK-- 157
           +SPPPP    +PPP   SPPPP   Y       ++SPPPP  H   P   H+PPPP    
Sbjct: 436 RSPPPPQS--TPPP---SPPPPPPVYSSSPSHQHRSPPPPT-HKISPVTRHAPPPPPPPS 489

Query: 158 --HYVYKSPPPPVKHYSPPPVYHS----PPPPKKHYVYKS-------PPPPVKHYSPPPV 298
             +Y + SPPPP   Y  PP Y      PPPP  HY   +       PPPPV +  PP  
Sbjct: 490 PVYYHHPSPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPPYT 549

Query: 299 YHSPPPPKKHY 331
             SPPPP  HY
Sbjct: 550 PQSPPPPPVHY 560

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/121 (43%), Positives = 61/121 (50%), Gaps = 14/121 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHS----PPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPPPKK 157
           SPPPP   Y  PP Y      PPPP  HY       +SPPPP      PPV++ PPP   
Sbjct: 497 SPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPP------PPVHYEPPP--- 547

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPP----PPK 322
            Y  +SPPPP  HY PP      PPP  +    SPPPPV +H  PP    SPP    PP+
Sbjct: 548 -YTPQSPPPPPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTPTPSPPAGYTPPQ 606

Query: 323 K 325
           +
Sbjct: 607 E 607

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/115 (46%), Positives = 59/115 (51%), Gaps = 5/115 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPP--PVYHSPPPPKK--HYVYKSPPPPVKHYSPPPVY-HSPPPPKKHYVY 169
           +PP    H +PP  P   +PPPP    H+  K  PPP   Y+P P Y  SPPPP   Y Y
Sbjct: 603 TPPQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPPT--YNPSPSYTQSPPPPPPTYTY 660

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
            SPPPP           SPPPP   Y Y SPPPP    SPPP   SPPPP   +V
Sbjct: 661 SSPPPPSS---------SPPPPT--YYYSSPPPPPP--SPPPPSPSPPPPSYEHV 702

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/109 (47%), Positives = 56/109 (51%), Gaps = 5/109 (4%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPP---PKKHYVYKSPPPP--VKHYSPPPVYHSPPPPKKHYVYK 172
           PPP   H+ P P   SPPP   P   Y    PPPP    + SPPP   SPPPP   Y Y 
Sbjct: 624 PPPSTPHWQPKP---SPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSSSPPPPT--YYYS 678

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP    SPPP   SPPPP   +V   P PP+   S    Y SPPPP
Sbjct: 679 SPPPPPP--SPPPPSPSPPPPSYEHV---PLPPIVGVS----YASPPPP 718

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 53/140 (37%), Positives = 59/140 (42%), Gaps = 30/140 (21%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPP-----PPKKHYV-YKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           K  P P      PPV + PP     PP K  V  +SPPPP    S      SPPPP+   
Sbjct: 386 KPRPKPTPKPKRPPVQNKPPAPKPSPPTKPIVPIESPPPPSSKSSGSHFKRSPPPPQSTP 445

Query: 164 VYKSPPPPVK--------HYSPPP--------VYHSPPPPKK----HYVYKSPPPPVKHY 283
               PPPP          H SPPP          H+PPPP      +Y + SPPPP   Y
Sbjct: 446 PPSPPPPPPVYSSSPSHQHRSPPPPTHKISPVTRHAPPPPPPPSPVYYHHPSPPPPQPVY 505

Query: 284 SPPPVYH----SPPPPKKHY 331
             PP Y      PPPP  HY
Sbjct: 506 YAPPTYKPQSPPPPPPPVHY 525

[129][TOP]
>UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4IYP5_MAIZE
          Length = 441

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 57/126 (45%), Positives = 64/126 (50%), Gaps = 18/126 (14%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVY---HSPPPPKKHYVYKSPPPPVKHYSPPP------VYHSPPPPKK 157
           SPPPP+    PPP     HSPPPP        PPPP+ H  PPP      VYH PPPP+ 
Sbjct: 319 SPPPPLSSPPPPPPLPQPHSPPPPLSS---PPPPPPLPHSPPPPSPAPAPVYHPPPPPQC 375

Query: 158 HYVYKSPPP----PVKHYSPPPVYHSPP-PPKKHYVYKSPPPPVKHYSPPPV----YHSP 310
                 PPP    P   + PPP Y+  P PP     Y SPPPP +H+  PPV    Y SP
Sbjct: 376 PPCPVLPPPLPCTPTHPWPPPPPYYPGPFPPTDPVRYASPPPPQQHHPWPPVYPVQYGSP 435

Query: 311 PPPKKH 328
           PPP  H
Sbjct: 436 PPPPLH 441

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 55/115 (47%), Positives = 61/115 (53%), Gaps = 9/115 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP+   SPPP   SPPPP        PPPP  H  PPP+   PPPP     + SPPP
Sbjct: 268 SPPPPLM--SPPPP--SPPPPSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPH-SPPP 322

Query: 185 PVKHYSPPPVY---HSPPPPKKHYVYKSPPPPVKHYSPP------PVYHSPPPPK 322
           P+    PPP     HSPPPP        PPPP+ H  PP      PVYH PPPP+
Sbjct: 323 PLSSPPPPPPLPQPHSPPPPLSS---PPPPPPLPHSPPPPSPAPAPVYHPPPPPQ 374

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 57/143 (39%), Positives = 67/143 (46%), Gaps = 35/143 (24%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV---KHYSPPPVYHSPPPPKKHYVYKSP 178
           PPPP+    PPP  HSPPPP       SPPPP    + +SPPP   SPPPP       SP
Sbjct: 287 PPPPL--LPPPPQPHSPPPP-----LSSPPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSP 339

Query: 179 PPPVKHYSPPP-VYHSPPPPK--KHYVYKSPPP----------------PVKHYSPPPVY 301
           PPP+    PPP + HSPPPP      VY  PPP                P   + PPP Y
Sbjct: 340 PPPLSSPPPPPPLPHSPPPPSPAPAPVYHPPPPPQCPPCPVLPPPLPCTPTHPWPPPPPY 399

Query: 302 H-------------SPPPPKKHY 331
           +             SPPPP++H+
Sbjct: 400 YPGPFPPTDPVRYASPPPPQQHH 422

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 54/107 (50%), Positives = 57/107 (53%), Gaps = 3/107 (2%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           P PP +  SPPP   SPPPP       SPPPP    SPPP   SPPPP       SPPPP
Sbjct: 246 PMPPPRLPSPPP---SPPPP-------SPPPP----SPPPPLMSPPPP-------SPPPP 284

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY---HSPPPP 319
               SPPP    PPPP+ H    SPPPP+    PPP     HSPPPP
Sbjct: 285 ----SPPPPPLLPPPPQPH----SPPPPLSSPPPPPPLPQPHSPPPP 323

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/107 (48%), Positives = 54/107 (50%), Gaps = 3/107 (2%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPP +    P P   SPPPP       SPPPP    SPPP   SPPPP        PPPP
Sbjct: 248 PPPRLPSPPPSPPPPSPPPPSPPPPLMSPPPP----SPPPP--SPPPPP-----LLPPPP 296

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY---HSPPPP 319
             H SPPP   SPPPP       SPPPP+    PPP     HSPPPP
Sbjct: 297 QPH-SPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPP 342

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/113 (41%), Positives = 54/113 (47%), Gaps = 4/113 (3%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV----YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           ++P      Y+ PPV    +H  P       +  P PP +  SPPP   SPPPP      
Sbjct: 219 RTPQQCAAFYARPPVNCAAFHCKP-------FVPPMPPPRLPSPPP---SPPPP------ 262

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
            SPPPP    SPPP   SPPPP       SPPPP    SPPP    PPPP+ H
Sbjct: 263 -SPPPP----SPPPPLMSPPPP-------SPPPP----SPPPPPLLPPPPQPH 299

[130][TOP]
>UniRef100_B4PI80 GE20611 n=1 Tax=Drosophila yakuba RepID=B4PI80_DROYA
          Length = 401

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 64/163 (39%), Positives = 68/163 (41%), Gaps = 53/163 (32%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV---------YHSPPPPKKHYVYKSPPPPVKHYSPPP-----VY-HS 139
           +PPPP   Y PPP           + PPP KK  VY  PPPP   Y PPP     VY   
Sbjct: 213 APPPPKVEYLPPPTKKVVIAPPPVYVPPPTKKVVVYTPPPPPPPVYVPPPTKKVVVYTPP 272

Query: 140 PPPPKKHYVY------------------------KSPPPPVKHYSPPPV---------YH 220
           PPPP K  VY                         +PPPP   Y PPP           +
Sbjct: 273 PPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPPPKVEYLPPPTKKVVIAPPPVY 332

Query: 221 SPPPPKKHYVYKSPPPPVKHYSPPP-----VYHSPPPPKKHYV 334
            PPP KK  VY  PPPP   Y PPP     VY  PPPP K YV
Sbjct: 333 VPPPTKKVVVYTPPPPPPPVYVPPPTKKVVVYTPPPPPPKVYV 375

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 63/163 (38%), Positives = 68/163 (41%), Gaps = 52/163 (31%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPV---------YHSPPPPKKHYVYKSPPPP----VKHYSPPPVYHSPP 145
           +PPPP   Y PPP           + PPP KK  VY  PPPP    V  Y+PPP    PP
Sbjct: 124 APPPPKVEYLPPPTKKVVIAPPPVYVPPPTKKVVVYTPPPPPPPKKVVVYTPPP----PP 179

Query: 146 PPKKHYVY------------------------KSPPPPVKHYSPPPV---------YHSP 226
           PP K  VY                         +PPPP   Y PPP           + P
Sbjct: 180 PPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPPPKVEYLPPPTKKVVIAPPPVYVP 239

Query: 227 PPPKKHYVYKSPPPPVKHYSPPP-----VY-HSPPPPKKHYVY 337
           PP KK  VY  PPPP   Y PPP     VY   PPPP K  VY
Sbjct: 240 PPTKKVVVYTPPPPPPPVYVPPPTKKVVVYTPPPPPPPKKVVY 282

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 63/134 (47%), Positives = 68/134 (50%), Gaps = 23/134 (17%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPV-------YH------ 136
           +PPPP     PPPVY  PPP KK  VY  PPPP      Y+PPP        YH      
Sbjct: 249 TPPPP-----PPPVY-VPPPTKKVVVYTPPPPPPPKKVVYTPPPTGILKDDGYHYGQPSV 302

Query: 137 -----SPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 295
                +PPPPK  Y+    PPP K    +PPPVY  PPP KK  VY  PPPP      PP
Sbjct: 303 KFEVSAPPPPKVEYL----PPPTKKVVIAPPPVY-VPPPTKKVVVYTPPPPP------PP 351

Query: 296 VYHSPPPPKKHYVY 337
           VY  PPP KK  VY
Sbjct: 352 VY-VPPPTKKVVVY 364

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 60/127 (47%), Positives = 65/127 (51%), Gaps = 18/127 (14%)
 Frame = +2

Query: 11  PPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-----VYHSPPPPKKHYVY 169
           PPP K    +PPPVY  PPP KK  VY  PPPP   Y PPP     VY  PPPP    V 
Sbjct: 223 PPPTKKVVIAPPPVY-VPPPTKKVVVYTPPPPPPPVYVPPPTKKVVVYTPPPPPPPKKVV 281

Query: 170 KSPPPPV------KHYSPPPV---YHSPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPP 316
            +PPP         HY  P V     +PPPPK  Y+    PPP K    +PPPVY  PPP
Sbjct: 282 YTPPPTGILKDDGYHYGQPSVKFEVSAPPPPKVEYL----PPPTKKVVIAPPPVY-VPPP 336

Query: 317 PKKHYVY 337
            KK  VY
Sbjct: 337 TKKVVVY 343

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 61/145 (42%), Positives = 68/145 (46%), Gaps = 36/145 (24%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPV-------YH-----------SPPPPKKHYVYKSPPPPVKHY--SP 121
           PPPP K   Y+PPP        YH           +PPPPK  Y+    PPP K    +P
Sbjct: 178 PPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPPPKVEYL----PPPTKKVVIAP 233

Query: 122 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-----VYHSPPPPKKHYVYKSPPP------ 268
           PPVY  PPP KK  VY  PPPP   Y PPP     VY  PPPP    V  +PPP      
Sbjct: 234 PPVY-VPPPTKKVVVYTPPPPPPPVYVPPPTKKVVVYTPPPPPPPKKVVYTPPPTGILKD 292

Query: 269 PVKHYSPPPV---YHSPPPPKKHYV 334
              HY  P V     +PPPPK  Y+
Sbjct: 293 DGYHYGQPSVKFEVSAPPPPKVEYL 317

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 56/127 (44%), Positives = 61/127 (48%), Gaps = 22/127 (17%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPV-------YH-----------SPPPPKKHYVYKSPPPPVKHY--SP 121
           PPPP K   Y+PPP        YH           +PPPPK  Y+    PPP K    +P
Sbjct: 273 PPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPPPKVEYL----PPPTKKVVIAP 328

Query: 122 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 301
           PPVY  PPP KK  VY  PPPP   Y PPP        KK  VY  PPPP K Y  P V 
Sbjct: 329 PPVY-VPPPTKKVVVYTPPPPPPPVYVPPPT-------KKVVVYTPPPPPPKVYVTPKVE 380

Query: 302 HSPPPPK 322
           + PP  K
Sbjct: 381 YLPPVQK 387

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 58/141 (41%), Positives = 66/141 (46%), Gaps = 32/141 (22%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV-------YH-----------SPPPPKKHYVYKSPPPPVKHY--SPPP 127
           P PP   Y+P P        YH           +PPPPK  Y+    PPP K    +PPP
Sbjct: 91  PTPPRPVYTPQPAGVLKDDGYHYAQPSVKFEVAAPPPPKVEYL----PPPTKKVVIAPPP 146

Query: 128 VYHSPPPPKKHYVYKSPPPP----VKHYSPPPVYHSPPPPKKHYVYKSPPPPV-----KH 280
           VY  PPP KK  VY  PPPP    V  Y+PPP    PPPP K  VY  PP  +      H
Sbjct: 147 VY-VPPPTKKVVVYTPPPPPPPKKVVVYTPPP----PPPPPKKVVYTPPPTGILKDDGYH 201

Query: 281 YSPPPV---YHSPPPPKKHYV 334
           Y  P V     +PPPPK  Y+
Sbjct: 202 YGQPSVKFEVSAPPPPKVEYL 222

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/93 (49%), Positives = 52/93 (55%), Gaps = 2/93 (2%)
 Frame = +2

Query: 11  PPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           PPP K    +PPPVY  PPP KK  VY  PPPP      PPVY  PPP KK  VY  PPP
Sbjct: 318 PPPTKKVVIAPPPVY-VPPPTKKVVVYTPPPPP------PPVY-VPPPTKKVVVYTPPPP 369

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
           P K Y  P V +  PP +K Y Y + P P  ++
Sbjct: 370 PPKVYVTPKVEYL-PPVQKGYSYPNDPQPAFNF 401

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 52/149 (34%), Positives = 57/149 (38%), Gaps = 53/149 (35%)
 Frame = +2

Query: 50  HSPPPPKKHYVYKSPPPP-------VKHYSPPPV-------------------------- 130
           HS    +  Y Y  P  P       V H S PPV                          
Sbjct: 48  HSNNLQEDGYHYAPPRAPVVIDVPYVPHESAPPVVVYEAPKPRPTPPRPVYTPQPAGVLK 107

Query: 131 ---YH-----------SPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSP 262
              YH           +PPPPK  Y+    PPP K    +PPPVY  PPP KK  VY  P
Sbjct: 108 DDGYHYAQPSVKFEVAAPPPPKVEYL----PPPTKKVVIAPPPVY-VPPPTKKVVVYTPP 162

Query: 263 PPP----VKHYSPPPVYHSPPPPKKHYVY 337
           PPP    V  Y+PPP    PPPP K  VY
Sbjct: 163 PPPPPKKVVVYTPPP----PPPPPKKVVY 187

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 47/116 (40%), Positives = 53/116 (45%), Gaps = 12/116 (10%)
 Frame = +2

Query: 26  HYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK-- 193
           HY+PP  PV    P     YV     PPV  Y  P    +PP P    VY   P  V   
Sbjct: 58  HYAPPRAPVVIDVP-----YVPHESAPPVVVYEAPKPRPTPPRP----VYTPQPAGVLKD 108

Query: 194 ---HYSPPPVYH---SPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPPPKKHYVY 337
              HY+ P V     +PPPPK  Y+    PPP K    +PPPVY  PPP KK  VY
Sbjct: 109 DGYHYAQPSVKFEVAAPPPPKVEYL----PPPTKKVVIAPPPVY-VPPPTKKVVVY 159

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 31/65 (47%), Positives = 37/65 (56%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           +PPPP     PPPVY  PPP KK  VY  PPPP K Y  P V +  PP +K Y Y + P 
Sbjct: 344 TPPPP-----PPPVY-VPPPTKKVVVYTPPPPPPKVYVTPKVEYL-PPVQKGYSYPNDPQ 396

Query: 185 PVKHY 199
           P  ++
Sbjct: 397 PAFNF 401

[131][TOP]
>UniRef100_Q4PSF3 Proline-rich extensin-like family protein n=1 Tax=Arabidopsis
           thaliana RepID=Q4PSF3_ARATH
          Length = 249

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 63/112 (56%), Positives = 66/112 (58%), Gaps = 7/112 (6%)
 Frame = +2

Query: 5   SPPPPVK-HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKS 175
           SPPPPV     PPPV  SPPPP    V  SPPPP  + SPPP  V  SPPPP    V  S
Sbjct: 53  SPPPPVNLSPPPPPVNLSPPPPP---VNLSPPPPPVNLSPPPPPVLLSPPPPP---VNLS 106

Query: 176 PPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPP 319
           PPPP  + SPPP  V  SPPPP    V  SPPPP  + S  PPPV  SPPPP
Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPP---VLLSPPPPPVNLSPPPPPVLLSPPPP 155

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 63/111 (56%), Positives = 65/111 (58%), Gaps = 7/111 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSP 178
           PPPPV   SPPP V  SPPPP    V  SPPPP  + SPPP  V  SPPPP    V  SP
Sbjct: 45  PPPPVNISSPPPPVNLSPPPPP---VNLSPPPPPVNLSPPPPPVNLSPPPPP---VLLSP 98

Query: 179 PPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPP 319
           PPP  + SPPP  V  SPPPP    V  SPPPP    S  PPPV  SPPPP
Sbjct: 99  PPPPVNLSPPPPPVNLSPPPPP---VLLSPPPPPVLLSPPPPPVNLSPPPP 146

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 59/111 (53%), Positives = 62/111 (55%), Gaps = 6/111 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYK 172
           SPPPP  + SPPP  V  SPPPP    V  SPPPP  + SPPP  V  SPPPP    V  
Sbjct: 70  SPPPPPVNLSPPPPPVNLSPPPPP---VLLSPPPPPVNLSPPPPPVNLSPPPPP---VLL 123

Query: 173 SPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP    SPPP  V  SPPPP    +   PPPPV    PPP    PPPP
Sbjct: 124 SPPPPPVLLSPPPPPVNLSPPPPP--VLLSPPPPPVLFSPPPPTVTRPPPP 172

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 63/113 (55%), Positives = 64/113 (56%), Gaps = 8/113 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYK 172
           SPPPP  + SPPP  V  SPPPP    V  SPPPP    SPPP  V  SPPPP    V  
Sbjct: 61  SPPPPPVNLSPPPPPVNLSPPPPP---VNLSPPPPPVLLSPPPPPVNLSPPPPP---VNL 114

Query: 173 SPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPP 319
           SPPPP    SPPP  V  SPPPP    V  SPPPP    S  PPPV  SPPPP
Sbjct: 115 SPPPPPVLLSPPPPPVLLSPPPPP---VNLSPPPPPVLLSPPPPPVLFSPPPP 164

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 62/133 (46%), Positives = 68/133 (51%), Gaps = 21/133 (15%)
 Frame = +2

Query: 5   SPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYK 172
           SPPPP  + S  PPPV  SPPPP    V  SPPPP    S  PPPV  SPPPP    V  
Sbjct: 97  SPPPPPVNLSPPPPPVNLSPPPPP---VLLSPPPPPVLLSPPPPPVNLSPPPPP---VLL 150

Query: 173 SPPPPVKHYSPPP-----------VYHSPPPPKKH---YVYKSPPPPVKHYS---PPPVY 301
           SPPPP   +SPPP           +  SPPPP+     Y  K+PPPP   Y    PPP  
Sbjct: 151 SPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPP-- 208

Query: 302 HSPPPPKKHYVYK 340
             PPPP+    YK
Sbjct: 209 --PPPPQAARSYK 219

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 59/125 (47%), Positives = 68/125 (54%), Gaps = 14/125 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKH---Y 163
           SPPPP  + SPPP  V  SPPPP    V  SPPPP     PPP  +  SPPPP+     Y
Sbjct: 133 SPPPPPVNLSPPPPPVLLSPPPPP---VLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAY 189

Query: 164 VYKSPPPPVKHYS---PPPVYHSPPPPKKHYVYK-SPPPPVKHYSPPPVY---HSPPPPK 322
             K+PPPP   Y    PPP    PPPP+    YK SPPPP     PP  Y   +SPPPP 
Sbjct: 190 YKKTPPPPPYKYGRVYPPP----PPPPQAARSYKRSPPPP-----PPSKYGRVYSPPPPG 240

Query: 323 KHYVY 337
           K +++
Sbjct: 241 KSWLW 245

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 61/123 (49%), Positives = 63/123 (51%), Gaps = 12/123 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYK 172
           SPPPP    SPPP  V  SPPPP    V  SPPPP    S  PPPV  SPPPP    V  
Sbjct: 88  SPPPPPVLLSPPPPPVNLSPPPPP---VNLSPPPPPVLLSPPPPPVLLSPPPPP---VNL 141

Query: 173 SPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP------VYHSPPPPKKH 328
           SPPPP    S  PPPV  SPPPP    V + PPPP    SPPP       Y+   PP   
Sbjct: 142 SPPPPPVLLSPPPPPVLFSPPPPT---VTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPP 198

Query: 329 YVY 337
           Y Y
Sbjct: 199 YKY 201

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 54/99 (54%), Positives = 57/99 (57%), Gaps = 5/99 (5%)
 Frame = +2

Query: 38  PPVYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP- 211
           P V  SPPPP  +    SPPPPV     PPPV  SPPPP    V  SPPPP  + SPPP 
Sbjct: 38  PLVDLSPPPPPVNI--SSPPPPVNLSPPPPPVNLSPPPPP---VNLSPPPPPVNLSPPPP 92

Query: 212 -VYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPP 319
            V  SPPPP    V  SPPPP  + S  PPPV  SPPPP
Sbjct: 93  PVLLSPPPPP---VNLSPPPPPVNLSPPPPPVLLSPPPP 128

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 50/94 (53%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +2

Query: 53  SPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHS 223
           S P P        PPPPV   SPPP V  SPPPP    V  SPPPP  + SPPP  V  S
Sbjct: 32  SAPEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPP---VNLSPPPPPVNLSPPPPPVNLS 88

Query: 224 PPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPP 319
           PPPP    V  SPPPP  + S  PPPV  SPPPP
Sbjct: 89  PPPPP---VLLSPPPPPVNLSPPPPPVNLSPPPP 119

[132][TOP]
>UniRef100_A9SW33 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SW33_PHYPA
          Length = 284

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 59/108 (54%), Positives = 60/108 (55%), Gaps = 4/108 (3%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP--KKHYVYKSPP 181
           PPPP       PVY SPP      VY+SPP     YSP PVY SPP P      VYKSPP
Sbjct: 136 PPPPES-----PVYESPPYASPSPVYESPP-----YSPSPVYKSPPSPTYSPSPVYKSPP 185

Query: 182 PPVKHYSPPPVYHSPPPP--KKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P   YSP PVY SPP P      VYKSPP P   YSP PVY SPP P
Sbjct: 186 SPT--YSPSPVYKSPPSPTYSPSPVYKSPPSPT--YSPSPVYKSPPSP 229

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 52/95 (54%), Positives = 55/95 (57%), Gaps = 2/95 (2%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 220
           P   S PPP +  VY+SPP    + SP PVY SPP      VYKSPP P   YSP PVY 
Sbjct: 130 PTLPSCPPPPESPVYESPP----YASPSPVYESPPYSPSP-VYKSPPSPT--YSPSPVYK 182

Query: 221 SPPPP--KKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPP P      VYKSPP P   YSP PVY SPP P
Sbjct: 183 SPPSPTYSPSPVYKSPPSPT--YSPSPVYKSPPSP 215

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/74 (58%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPP--KKHYVYKSPPPPVKHYSPPPVYHSPPPP--KKHYVY 169
           KSPP P   YSP PVY SPP P      VYKSPP P   YSP PVY SPP P      VY
Sbjct: 168 KSPPSPT--YSPSPVYKSPPSPTYSPSPVYKSPPSPT--YSPSPVYKSPPSPTYSPSPVY 223

Query: 170 KSPPPPVKHYSPPP 211
           KSPP P   YSP P
Sbjct: 224 KSPPSP--SYSPSP 235

[133][TOP]
>UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B501E
          Length = 406

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 51/112 (45%), Positives = 56/112 (50%), Gaps = 5/112 (4%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP  +  PPP    PPPP   Y Y  PPPP     PPP  +SPPPP  +     PPPP
Sbjct: 261 PPPPPAYGPPPPP--PPPPPPAAYAYGPPPPPPP--PPPPPAYSPPPPPAYGPPPPPPPP 316

Query: 188 VKHYSPPPVY---HSPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPPPKKH 328
                PPP Y     PPPP     Y  PPPP  +    PPP Y  PPPP K+
Sbjct: 317 AYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKY 368

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/109 (48%), Positives = 53/109 (48%), Gaps = 5/109 (4%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVY-----KSPPPPVKHYSPPPVYHSPPPPKKHYVYK 172
           PPPP     PPP Y  PPPP     Y       PPPP   YSPPP    PPPP     Y 
Sbjct: 208 PPPPPPPPPPPPAYGPPPPP----AYGPPPPPPPPPPPPAYSPPP---PPPPPPPPAAYG 260

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPPP   Y PPP    PPPP   Y Y  PPPP     PPP Y  PPPP
Sbjct: 261 PPPPPA--YGPPPP-PPPPPPPAAYAY-GPPPPPPPPPPPPAYSPPPPP 305

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 52/122 (42%), Positives = 56/122 (45%), Gaps = 14/122 (11%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP   YSPPP    PPPP     Y  PPPP     PPP    PPPP   Y Y  PPPP
Sbjct: 237 PPPPPPAYSPPP---PPPPPPPPAAYGPPPPPAYGPPPPP---PPPPPPAAYAYGPPPPP 290

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY--------------HSPPPPKK 325
                PPP  +SPPPP  +     PPPP     PPP Y              ++PPPP  
Sbjct: 291 PP--PPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPP 348

Query: 326 HY 331
            Y
Sbjct: 349 AY 350

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 47/103 (45%), Positives = 51/103 (49%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           P P  +  PPPVY  PPPP     Y  PPPP  +  PPP  ++PPPP        PPPP 
Sbjct: 76  PAPPAYAPPPPVYAPPPPPP---AYAPPPPPPAYAPPPPPAYAPPPPPP----PPPPPPS 128

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               PPP Y  PPPP        PPPP     PPP Y  PPPP
Sbjct: 129 YGPPPPPAYGPPPPPP-----PPPPPPAYGPPPPPAYGPPPPP 166

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 50/110 (45%), Positives = 52/110 (47%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP     PPP Y  PPPP        PPPP     PPP Y  PPPP        PPPP
Sbjct: 193 PPPPAYGPPPPPAYGPPPPPPP-----PPPPPAYGPPPPPAYGPPPPPP-------PPPP 240

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
              YSPPP    PPPP  +     PPPP  +  PPP    PPPP   Y Y
Sbjct: 241 PPAYSPPPPPPPPPPPAAY----GPPPPPAYGPPPP--PPPPPPPAAYAY 284

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/105 (47%), Positives = 55/105 (52%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           +PPPPV    PPP  ++PPPP   Y   +PPPP  +  PPP    PPPP     Y  PPP
Sbjct: 82  APPPPVYAPPPPPPAYAPPPPPPAY---APPPPPAYAPPPPPPPPPPPPS----YGPPPP 134

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P   Y PPP    PPPP     Y  PPPP   Y PPP    PPPP
Sbjct: 135 PA--YGPPP---PPPPPPPPPAYGPPPPPA--YGPPPPPPPPPPP 172

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 48/104 (46%), Positives = 48/104 (46%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP     PPP Y  PPPP        PPPP     PPP Y  PPPP        PPPP
Sbjct: 101 PPPPAYAPPPPPAYAPPPPPP-----PPPPPPSYGPPPPPAYGPPPPPP-----PPPPPP 150

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PPP Y  PPPP        PPPP     PPP Y  PPPP
Sbjct: 151 AYGPPPPPAYGPPPPPP-----PPPPPPAYGPPPPPAYGPPPPP 189

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 48/104 (46%), Positives = 48/104 (46%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP     PPP Y  PPPP        PPPP     PPP Y  PPPP        PPPP
Sbjct: 162 PPPPPPPPPPPPAYGPPPPPAY-----GPPPPPPPPPPPPAYGPPPPPAY-----GPPPP 211

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PPP Y  PPPP        PPPP     PPP Y  PPPP
Sbjct: 212 PPPPPPPPAYGPPPPPA-----YGPPPPPPPPPPPPAYSPPPPP 250

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 47/104 (45%), Positives = 49/104 (47%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP     PPP Y  PPPP        PPPP     PPP Y  PPPP        PPPP
Sbjct: 185 PPPPPPPPPPPPAYGPPPPPA-----YGPPPPPPPPPPPPAYGPPPPPA-----YGPPPP 234

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PPP Y  PPPP        PPPP  +  PPP  + PPPP
Sbjct: 235 PPPPPPPPAYSPPPPP------PPPPPPAAYGPPPPPAYGPPPP 272

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 49/109 (44%), Positives = 50/109 (45%), Gaps = 5/109 (4%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS-----PPPPKKHYVYK 172
           PPPP     PPP Y  PPPP        PPPP     PPP Y       PPPP   Y   
Sbjct: 124 PPPPSYGPPPPPAYGPPPPPPP-----PPPPPAYGPPPPPAYGPPPPPPPPPPPPAY--- 175

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPPP  +  PPP    PPPP     Y  PPPP   Y PPP    PPPP
Sbjct: 176 GPPPPPAYGPPPP----PPPPPPPPAYGPPPPPA--YGPPPPPPPPPPP 218

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/107 (45%), Positives = 54/107 (50%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  +  PPP    PPPP     Y  PPPP   Y PP    +PPPP        PPP
Sbjct: 300 SPPPPPAYGPPPP----PPPP----AYAPPPPPA--YGPP----APPPP-------PPPP 338

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPP 319
           P     PPP  ++PPPP   Y   +PPPP   YSP P  VY  P PP
Sbjct: 339 PAYAPPPPPPAYAPPPPPPAY---APPPPPPKYSPAPIVVYGPPAPP 382

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/104 (40%), Positives = 49/104 (47%), Gaps = 7/104 (6%)
 Frame = +2

Query: 29  YSPPPVYHSPPPPKKH-------YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           Y+  P    PPPP  +        V   P PP   Y+PPP  ++PPPP   Y    PPPP
Sbjct: 48  YAVVPAPQPPPPPPAYDDCDEIVLVPGKPAPPA--YAPPPPVYAPPPPPPAYA-PPPPPP 104

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PPP Y  PPPP        PPPP  +  PPP  + PPPP
Sbjct: 105 AYAPPPPPAYAPPPPP------PPPPPPPSYGPPPPPAYGPPPP 142

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 49/115 (42%), Positives = 54/115 (46%), Gaps = 11/115 (9%)
 Frame = +2

Query: 8   PPPPVKHYS-----------PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 154
           PPPP   Y            P P  ++PPPP    VY +PPPP   Y+P      PPPP 
Sbjct: 56  PPPPPPAYDDCDEIVLVPGKPAPPAYAPPPP----VY-APPPPPPAYAP-----PPPPP- 104

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               Y  PPPP   Y+PPP    PPPP     Y  PPPP   Y PPP    PPPP
Sbjct: 105 ---AYAPPPPPA--YAPPPPPPPPPPPPS---YGPPPPPA--YGPPPPPPPPPPP 149

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 44/119 (36%), Positives = 50/119 (42%), Gaps = 13/119 (10%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-------------KHYSPPPVYHSPPP 148
           PPPP  +  PPP  + PPPP     Y  PPPP                Y+PPP    PPP
Sbjct: 293 PPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPP----PPP 348

Query: 149 PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
                 Y  PP       PPP Y  PPPP K+      P P+  Y PP     PP PK+
Sbjct: 349 -----AYAPPP-------PPPAYAPPPPPPKY-----SPAPIVVYGPPAPPPPPPAPKR 390

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 41/107 (38%), Positives = 46/107 (42%), Gaps = 11/107 (10%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYS-----------PPPVYHSPPPPKKHYVYKSPPPP 187
           PVY   P P+       PPPP   Y            P P  ++PPPP    VY  PPPP
Sbjct: 46  PVYAVVPAPQ-------PPPPPPAYDDCDEIVLVPGKPAPPAYAPPPP----VYAPPPPP 94

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
                  P Y  PPPP     Y  PPPP   Y+PPP    PPPP  +
Sbjct: 95  -------PAYAPPPPPP---AYAPPPPPA--YAPPPPPPPPPPPPSY 129

[134][TOP]
>UniRef100_Q43586 PAP8 product (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q43586_TOBAC
          Length = 99

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 58/113 (51%), Positives = 61/113 (53%), Gaps = 13/113 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY-----------VYKSPPPPVKHYSPPPVYHSPPPP 151
           S PPP     P PVY SPPPPKK Y           VYKSPPPP+K Y P P  + P P 
Sbjct: 4   SRPPP-----PAPVYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPLKPYHPSPTPYHPAP- 57

Query: 152 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP--PVKHYSPPPVYH 304
               VY SPPPP       PVY SPPPP    VYKSP P  P  + SPPP YH
Sbjct: 58  ----VYMSPPPPT------PVYKSPPPPTP--VYKSPAPHHPYLYASPPPPYH 98

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/103 (52%), Positives = 58/103 (56%), Gaps = 11/103 (10%)
 Frame = +2

Query: 56  PPPPKKHYVYKSPPPPVK-H------YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 214
           PPPP    VYKSPPPP K +      Y P PVY SPPPP K Y + SP P    Y P PV
Sbjct: 6   PPPPAP--VYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPLKPY-HPSPTP----YHPAPV 58

Query: 215 YHSPPPPKKHYVYKSPPPPVKHYSPP----PVYHSPPPPKKHY 331
           Y SPPPP    VYKSPPPP   Y  P    P  ++ PPP  HY
Sbjct: 59  YMSPPPPTP--VYKSPPPPTPVYKSPAPHHPYLYASPPPPYHY 99

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/75 (53%), Positives = 43/75 (57%), Gaps = 2/75 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP+K Y P P  + P P     VY SPPPP       PVY SPPPP    VYKSP 
Sbjct: 37  KSPPPPLKPYHPSPTPYHPAP-----VYMSPPPPT------PVYKSPPPPTP--VYKSPA 83

Query: 182 P--PVKHYSPPPVYH 220
           P  P  + SPPP YH
Sbjct: 84  PHHPYLYASPPPPYH 98

[135][TOP]
>UniRef100_A3KD20 Leucine-rich repeat/extensin n=1 Tax=Nicotiana plumbaginifolia
           RepID=A3KD20_NICPL
          Length = 725

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 63/144 (43%), Positives = 65/144 (45%), Gaps = 35/144 (24%)
 Frame = +2

Query: 5   SPPPPV-------KHYSPPPVYH---------SPPPPKKHYVY-----KSPPPPVKHYSP 121
           SPPPPV       KH SPPP  H         SPPPP    VY      SPPPP  +Y+P
Sbjct: 448 SPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPPSPVYYHHPSPSPPPPPVYYAP 507

Query: 122 P---PVYHSPPPPKKHY------VYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPP 268
           P   P    PPPP  HY          PPPP  HY PP       PPPP  HY    PP 
Sbjct: 508 PTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPPPPVHY---EPPT 564

Query: 269 PVKHYSPPPVY---HSPPPPKKHY 331
              H  PPPVY    SPPPP   Y
Sbjct: 565 YTPHSPPPPVYVTPSSPPPPTPVY 588

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 52/127 (40%), Positives = 59/127 (46%), Gaps = 23/127 (18%)
 Frame = +2

Query: 8   PPPPVKHYSPP---------PVY---HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 151
           PPPP  HY PP         PVY    SPPPP   Y + +P PP  +  P    H  PP 
Sbjct: 553 PPPPPVHYEPPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPPAGYTPPQEPSHPAPPT 612

Query: 152 KKHYVYKSPPPPVKHY----SPPPVYH-------SPPPPKKHYVYKSPPPPVKHYSPPPV 298
                  +PPP   H+    SPPP Y+       SPPPP   Y Y SPPPP     PP  
Sbjct: 613 PPCNEPPTPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSPSPPPPTY 672

Query: 299 YHSPPPP 319
           Y+S PPP
Sbjct: 673 YYSSPPP 679

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 56/121 (46%), Positives = 60/121 (49%), Gaps = 16/121 (13%)
 Frame = +2

Query: 5   SPPPPVKHY----SPPPVYH-------SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 151
           +PPP   H+    SPPP Y+       SPPPP   Y Y SPPPP           SP PP
Sbjct: 620 TPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPP-----------SPSPP 668

Query: 152 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-VKHYSPPPV----YHSPPP 316
              Y Y SPPPP    SPPP   SPPPP       SPPPP  +H   PPV    Y SPPP
Sbjct: 669 PPTYYYSSPPPP----SPPPPSPSPPPPSP-----SPPPPSYEHVPLPPVVGVSYASPPP 719

Query: 317 P 319
           P
Sbjct: 720 P 720

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 58/141 (41%), Positives = 65/141 (46%), Gaps = 31/141 (21%)
 Frame = +2

Query: 2   KSPPPPVK-----HY--SPPPVYHSPPPPKKHYVY--------KSPPPPVKHYSPPPVYH 136
           +SPPPP       H+  SPPP   +PPP     VY        +SPPPP    SP   + 
Sbjct: 420 ESPPPPSSKSSGSHFKRSPPPPQSTPPPSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHA 479

Query: 137 SPPPPKKHYVY-----KSPPPPVKHYSPP---PVYHSPPPPKKHY------VYKSPPPPV 274
           SPPPP    VY      SPPPP  +Y+PP   P    PPPP  HY          PPPP 
Sbjct: 480 SPPPPPPSPVYYHHPSPSPPPPPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPP 539

Query: 275 KHYSPPPV--YHSPPPPKKHY 331
            HY PP       PPPP  HY
Sbjct: 540 VHYEPPTYTPQSPPPPPPVHY 560

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/110 (46%), Positives = 57/110 (51%), Gaps = 1/110 (0%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY-HSPPPPKKHYVYKSPPP 184
           P PP    + PP   +PPP   H+  K  PPP   Y+P P Y  SPPPP   Y Y SPPP
Sbjct: 608 PAPPTPPCNEPP---TPPPSTPHWQPKPSPPPT--YNPSPSYTQSPPPPPPTYTYSSPPP 662

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
           P     PP  Y+S PPP       SPPPP    SPPP   SPPPP   +V
Sbjct: 663 PSPSPPPPTYYYSSPPP------PSPPPPSP--SPPPPSPSPPPPSYEHV 704

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/121 (43%), Positives = 60/121 (49%), Gaps = 16/121 (13%)
 Frame = +2

Query: 5   SPPPPVKHYSPP---PVYHSPPPPKKHY------VYKSPPPPVKHYSPPPV--YHSPPPP 151
           SPPPP  +Y+PP   P    PPPP  HY          PPPP  HY PP       PPPP
Sbjct: 497 SPPPPPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPPP 556

Query: 152 KKHYVYKSPPPPVKHYSPPPVY---HSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPP 316
             HY    PP    H  PPPVY    SPPPP   Y + +P PP   Y+PP  P + +PP 
Sbjct: 557 PVHY---EPPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPPA-GYTPPQEPSHPAPPT 612

Query: 317 P 319
           P
Sbjct: 613 P 613

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 56/140 (40%), Positives = 61/140 (43%), Gaps = 30/140 (21%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYK------SPPPPVKHYSPPPVYHSPPPPKKHY 163
           K  P P      PPV + PP PK     +      SPPPP    S      SPPPP+   
Sbjct: 386 KPRPKPTPKPKRPPVQNKPPAPKPSTPSRPVAPIESPPPPSSKSSGSHFKRSPPPPQSTP 445

Query: 164 VYKSPPPPV-------KHYSPPPVYH---------SPPPPKKHYVY-----KSPPPPVKH 280
              SPPPPV       KH SPPP  H         SPPPP    VY      SPPPP  +
Sbjct: 446 P-PSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPPSPVYYHHPSPSPPPPPVY 504

Query: 281 YSPP---PVYHSPPPPKKHY 331
           Y+PP   P    PPPP  HY
Sbjct: 505 YAPPTYKPQSPPPPPPPVHY 524

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/97 (50%), Positives = 50/97 (51%), Gaps = 3/97 (3%)
 Frame = +2

Query: 2   KSPPPPVKHY---SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 172
           +SPPPP   Y   SPPP   SPPPP   Y Y SPPPP    SPPP   SPPPP       
Sbjct: 646 QSPPPPPPTYTYSSPPPPSPSPPPPT--YYYSSPPPP----SPPPPSPSPPPP------- 692

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
           SP PP     PP   H P PP     Y SPPPPV  Y
Sbjct: 693 SPSPP-----PPSYEHVPLPPVVGVSYASPPPPVIPY 724

[136][TOP]
>UniRef100_Q8RWX5 Putative uncharacterized protein At3g19020 (Fragment) n=1
           Tax=Arabidopsis thaliana RepID=Q8RWX5_ARATH
          Length = 712

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 60/106 (56%), Positives = 63/106 (59%), Gaps = 6/106 (5%)
 Frame = +2

Query: 8   PPPP----VKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           PP P     K  SP  PPV+  PPPP  H    SPPPPV  +SPPP  HSPPPP    VY
Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVH----SPPPPV--FSPPPPMHSPPPP----VY 675

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 307
            SPPPPV H  PPP  HSPPPP       SPPPPV  +SPPP  HS
Sbjct: 676 -SPPPPV-HSPPPPPVHSPPPP-----VHSPPPPV--HSPPPPVHS 712

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 48/77 (62%), Positives = 50/77 (64%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP   +SPPP   SPPPP       SPPPPV  YSPPP  HSPPPP  H    SPPP
Sbjct: 646 SPPPPPPVHSPPPPVFSPPPP-----MHSPPPPV--YSPPPPVHSPPPPPVH----SPPP 694

Query: 185 PVKHYSPPPVYHSPPPP 235
           PV  +SPPP  HSPPPP
Sbjct: 695 PV--HSPPPPVHSPPPP 709

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/108 (46%), Positives = 56/108 (51%), Gaps = 7/108 (6%)
 Frame = +2

Query: 17  PVKHYSPPPVYHSPPPPKKHYVYKSPP-PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 193
           P+K   P P    P P  +     SP  PPV    PPP  HSPPPP       SPPPP+ 
Sbjct: 618 PIKKCRPQP----PSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPP-----VFSPPPPM- 667

Query: 194 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY------HSPPPP 319
            +SPPP  +SPPPP       SPPPP  H  PPPV+      HSPPPP
Sbjct: 668 -HSPPPPVYSPPPP-----VHSPPPPPVHSPPPPVHSPPPPVHSPPPP 709

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 55/113 (48%), Positives = 61/113 (53%), Gaps = 7/113 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP----VKHYSP--PPVYHSPPPPKKHY 163
           K   PP++   P   Y + P  K       PP P     K  SP  PPV+  PPPP  H 
Sbjct: 599 KMGSPPLESPVPNDPYDASPIKKCR---PQPPSPSTEETKTTSPQSPPVHSPPPPPPVH- 654

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-PPPVYHSPPPP 319
              SPPPPV  +SPPP  HSPPPP    VY SPPPPV  +S PPP  HSPPPP
Sbjct: 655 ---SPPPPV--FSPPPPMHSPPPP----VY-SPPPPV--HSPPPPPVHSPPPP 695

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 53/133 (39%), Positives = 60/133 (45%), Gaps = 26/133 (19%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP---PVYHSP------------ 142
           P PP +    P     P PPK+    K+  P  K  SPP   PV + P            
Sbjct: 568 PQPPKQETPKPEESPKPQPPKQEQPPKTEAP--KMGSPPLESPVPNDPYDASPIKKCRPQ 625

Query: 143 PP-----------PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 289
           PP           P+   V+  PPPP  H  PPPV+ SPPPP       SPPPPV  YSP
Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVF-SPPPPMH-----SPPPPV--YSP 677

Query: 290 PPVYHSPPPPKKH 328
           PP  HSPPPP  H
Sbjct: 678 PPPVHSPPPPPVH 690

[137][TOP]
>UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA
          Length = 464

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 53/104 (50%), Positives = 54/104 (51%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP    SPPP   SPPPP    V  SPPPP    SPPP    PPPP+      SPPPP
Sbjct: 273 PPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPP----PPPPRPS---PSPPPP 325

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               SPPP    PP P       SPPPP    SPPP   SPPPP
Sbjct: 326 RSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPP 369

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 52/109 (47%), Positives = 54/109 (49%), Gaps = 3/109 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           SPPPPV    PPP   V  SPPPP+       PPPP    SPPP   SP PP       S
Sbjct: 281 SPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPS 340

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           PPPP    SPPP   SP PP    V   PPPP     PPP    PPPP+
Sbjct: 341 PPPPRPSPSPPPPRSSPSPPPP-VVSPPPPPPRASPPPPPASSPPPPPR 388

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/108 (49%), Positives = 55/108 (50%), Gaps = 2/108 (1%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVY--HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           PPPP    SPPP     SPPPP       SPPPP    SPPP   SPPPP       SPP
Sbjct: 292 PPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPP--SPPPP-------SPP 342

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           PP    SPPP   SP PP    V   PPPP +   PPP   SPPPP +
Sbjct: 343 PPRPSPSPPPPRSSPSPPPP--VVSPPPPPPRASPPPPPASSPPPPPR 388

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 55/116 (47%), Positives = 58/116 (50%), Gaps = 10/116 (8%)
 Frame = +2

Query: 2   KSPPP-------PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPP 151
           +SPPP       PV   SPP    SPPPP +  V  SPPPPV    PPP   V  SPPPP
Sbjct: 247 RSPPPRRITSPSPVLTASPPLPKTSPPPPPR--VPPSPPPPVASPPPPPPPRVSPSPPPP 304

Query: 152 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           +       PPPP    SPPP   SP PP       SPPPP    SPPP   SP PP
Sbjct: 305 QPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPP 360

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 53/105 (50%), Positives = 55/105 (52%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP    SPPP   SP PP    V   PPP
Sbjct: 321 SPPPPRSSPSPPPP--SPPPP-------SPPPPRPSPSPPPPRSSPSPPPP--VVSPPPP 369

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P +   PPP   SPPPP +      PPPP    SPPP   SPPPP
Sbjct: 370 PPRASPPPPPASSPPPPPR------PPPP----SPPP---SPPPP 401

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/107 (45%), Positives = 52/107 (48%), Gaps = 3/107 (2%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP    SPPP   SP PP       SPPPP    SPPP   SP PP    V   PPPP
Sbjct: 313 PPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPP--VVSPPPPP 370

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPP 319
            +   PPP   SPPPP +      PPPP    SPPP      +PP P
Sbjct: 371 PRASPPPPPASSPPPPPR------PPPPSPPPSPPPPATAAANPPSP 411

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 52/109 (47%), Positives = 57/109 (52%), Gaps = 4/109 (3%)
 Frame = +2

Query: 5   SPPPPVK-HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           SPPPP +   SPPP   SPPP +      + P PV   SPP    SPPPP +  V  SPP
Sbjct: 231 SPPPPARVSSSPPPATRSPPPRRI-----TSPSPVLTASPPLPKTSPPPPPR--VPPSPP 283

Query: 182 PPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV    PPP   V  SPPPP+       PPPP    SPPP   SP PP
Sbjct: 284 PPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPP 332

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/115 (42%), Positives = 53/115 (46%), Gaps = 8/115 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHYVY 169
           SPPPP    SPPP   SPPPP       SPPPP     PPP    PP     PP      
Sbjct: 349 SPPPPRSSPSPPPPVVSPPPPPPR---ASPPPPPASSPPPPPRPPPPSPPPSPPPPATAA 405

Query: 170 KSPPPPVKHYS---PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            +PP P    S    PP+   PPPP      +   PP  +Y PPP   SPPPPKK
Sbjct: 406 ANPPSPAPSRSRAGGPPLGTRPPPPPP----EDDAPPPDYYFPPPQDMSPPPPKK 456

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 52/115 (45%), Positives = 55/115 (47%), Gaps = 9/115 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP---------VYHSPPPPKK 157
           SPPPP      P V  SPPPP +     S PPP    SPPP         +  SPP PK 
Sbjct: 221 SPPPP------PRVSTSPPPPAR---VSSSPPPATR-SPPPRRITSPSPVLTASPPLPKT 270

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
                 PPPP    SPPP   SPPPP    V  SPPPP    SPPP    PPPP+
Sbjct: 271 ----SPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPP----PPPPR 317

[138][TOP]
>UniRef100_Q39005 Cell wall protein n=1 Tax=Arabidopsis thaliana RepID=Q39005_ARATH
          Length = 305

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 55/120 (45%), Positives = 65/120 (54%), Gaps = 13/120 (10%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP----PPPKKHYV-YKS 175
           PPPVK Y PP   H PPP KK+   +  PPP+K Y PP  Y  P    PPP+++    K 
Sbjct: 147 PPPVKKYPPPE--HYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKK 204

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVY---KSPPPPVKHYSPPPVYHSP-----PPPKKHY 331
            PPP+K Y PP  Y   PPP K Y +   K PPPP K Y  PP+   P     PPP +HY
Sbjct: 205 YPPPIKKYPPPEEY---PPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHY 261

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 53/112 (47%), Positives = 62/112 (55%), Gaps = 5/112 (4%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP+K Y PP  Y  PPP KK+   +  PPP+K Y PPP+   PPP       +  PPP+
Sbjct: 173 PPPIKKYPPPEKY--PPPIKKYPPPEQYPPPIKKY-PPPIKKYPPP-------EEYPPPI 222

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-----SPPPVYHSPPPPKKHY 331
           K Y  PPV + PPPP K Y    P PP+K Y      PPP  H P PPKK Y
Sbjct: 223 KTYPHPPVKY-PPPPYKTY----PHPPIKTYPPPKECPPPPEHYPWPPKKKY 269

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/124 (45%), Positives = 68/124 (54%), Gaps = 17/124 (13%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPP----PPKKHY---VYKSPPP-----PVKHYSPPPVYHSPPPPK 154
           PPP+K Y PPP  +SPP    PP + Y   V K PPP     P+K Y P   Y  PPP K
Sbjct: 121 PPPIKKY-PPPEQYSPPFKKYPPPEQYPPPVKKYPPPEHYPPPIKKYPPQEQY--PPPIK 177

Query: 155 KHYVYKSPPPPVKHYS-----PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           K+   +  PPP+K Y      PPP+   PPP KK+   +  PPP+K Y  PPV + PPPP
Sbjct: 178 KYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKY-PPPP 236

Query: 320 KKHY 331
            K Y
Sbjct: 237 YKTY 240

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/115 (46%), Positives = 66/115 (57%), Gaps = 9/115 (7%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS-----PPPPKKHYVYKS 175
           PPPV++  PPP+   PPPP +H   K PPP +K Y  PPV +      PPP KK+   + 
Sbjct: 63  PPPVQY--PPPIKKYPPPPYEHPPVKYPPP-IKTYPHPPVKYPPPEQYPPPIKKYPPPEQ 119

Query: 176 PPPPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
            PPP+K Y PPP  +SPP    PP + Y     PPPVK Y PP   H PPP KK+
Sbjct: 120 YPPPIKKY-PPPEQYSPPFKKYPPPEQY-----PPPVKKYPPPE--HYPPPIKKY 166

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 53/111 (47%), Positives = 63/111 (56%), Gaps = 5/111 (4%)
 Frame = +2

Query: 11  PPPVKHYSPP-----PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           PPP+K Y PP     P+   PPP KK+   +  PPP+K Y  PPV + PPPP K Y    
Sbjct: 186 PPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKY-PPPPYKTY---- 240

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           P PP+K Y PPP     PPP +HY    P PP K Y PPPV +  PP KK+
Sbjct: 241 PHPPIKTY-PPPKEC--PPPPEHY----PWPPKKKY-PPPVEYPSPPYKKY 283

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/114 (42%), Positives = 58/114 (50%), Gaps = 7/114 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP---PPPKKHYVYKSP 178
           P  P     PPP+   PPP +        PPP+K Y PPP  H P   PPP K Y    P
Sbjct: 47  PKFPYSPPKPPPIEKYPPPVQY-------PPPIKKYPPPPYEHPPVKYPPPIKTY----P 95

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP----PPPKKH 328
            PPVK Y PP  Y  PPP KK+   +  PPP+K Y PP  Y  P    PPP+++
Sbjct: 96  HPPVK-YPPPEQY--PPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQY 146

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 53/119 (44%), Positives = 61/119 (51%), Gaps = 6/119 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K  PPP+K Y PP  Y   PPP K Y    P PPVK Y PPP    P PP K Y     P
Sbjct: 203 KKYPPPIKKYPPPEEY---PPPIKTY----PHPPVK-YPPPPYKTYPHPPIKTY-----P 249

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP------PVYHSPPPPKKHYVYK 340
           PP +   PPP  H P PPKK Y     PPPV++ SPP       ++ +  P K  +VYK
Sbjct: 250 PPKE--CPPPPEHYPWPPKKKY-----PPPVEYPSPPYKKYLRLIHSNSKPNKDVFVYK 301

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 42/114 (36%), Positives = 51/114 (44%), Gaps = 15/114 (13%)
 Frame = +2

Query: 32  SPPPVYHSPPPPK--KHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS 202
           S P  +H  PP K    + Y  P PPP++ Y PP  Y               PPP+K Y 
Sbjct: 32  SVPNWFHHWPPFKWGPKFPYSPPKPPPIEKYPPPVQY---------------PPPIKKYP 76

Query: 203 PPPVYHSPP------------PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PPP Y  PP            PP K+   +  PPP+K Y PP  Y  PPP KK+
Sbjct: 77  PPP-YEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQY--PPPIKKY 127

[139][TOP]
>UniRef100_Q84JV0 Putative cell wall protein n=1 Tax=Arabidopsis thaliana
           RepID=Q84JV0_ARATH
          Length = 288

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 54/120 (45%), Positives = 65/120 (54%), Gaps = 13/120 (10%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP----PPPKKHYV-YKS 175
           PPP+K Y PP   H PPP KK+   +  PPP+K Y PP  Y  P    PPP+++    K 
Sbjct: 147 PPPIKKYPPPE--HYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKK 204

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVY---KSPPPPVKHYSPPPVYHSP-----PPPKKHY 331
            PPP+K Y PP  Y   PPP K Y +   K PPPP K Y  PP+   P     PPP +HY
Sbjct: 205 YPPPIKKYPPPEEY---PPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHY 261

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 53/112 (47%), Positives = 62/112 (55%), Gaps = 5/112 (4%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP+K Y PP  Y  PPP KK+   +  PPP+K Y PPP+   PPP       +  PPP+
Sbjct: 173 PPPIKKYPPPEKY--PPPIKKYPPPEQYPPPIKKY-PPPIKKYPPP-------EEYPPPI 222

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-----SPPPVYHSPPPPKKHY 331
           K Y  PPV + PPPP K Y    P PP+K Y      PPP  H P PPKK Y
Sbjct: 223 KTYPHPPVKY-PPPPYKTY----PHPPIKTYPPPKECPPPPEHYPWPPKKKY 269

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/124 (44%), Positives = 68/124 (54%), Gaps = 17/124 (13%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPP----PPKKHY---VYKSPPP-----PVKHYSPPPVYHSPPPPK 154
           PPP+K Y PPP  +SPP    PP + Y   + K PPP     P+K Y P   Y  PPP K
Sbjct: 121 PPPIKKY-PPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQY--PPPIK 177

Query: 155 KHYVYKSPPPPVKHYS-----PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           K+   +  PPP+K Y      PPP+   PPP KK+   +  PPP+K Y  PPV + PPPP
Sbjct: 178 KYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKY-PPPP 236

Query: 320 KKHY 331
            K Y
Sbjct: 237 YKTY 240

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/115 (46%), Positives = 66/115 (57%), Gaps = 9/115 (7%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS-----PPPPKKHYVYKS 175
           PPPV++  PPP+   PPPP +H   K PPP +K Y  PPV +      PPP KK+   + 
Sbjct: 63  PPPVQY--PPPIKKYPPPPYEHPPVKYPPP-IKTYPHPPVKYPPPEQYPPPIKKYPPPEQ 119

Query: 176 PPPPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
            PPP+K Y PPP  +SPP    PP + Y     PPP+K Y PP   H PPP KK+
Sbjct: 120 YPPPIKKY-PPPEQYSPPFKKYPPPEQY-----PPPIKKYPPPE--HYPPPIKKY 166

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 53/111 (47%), Positives = 63/111 (56%), Gaps = 5/111 (4%)
 Frame = +2

Query: 11  PPPVKHYSPP-----PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           PPP+K Y PP     P+   PPP KK+   +  PPP+K Y  PPV + PPPP K Y    
Sbjct: 186 PPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKY-PPPPYKTY---- 240

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           P PP+K Y PPP     PPP +HY    P PP K Y PPPV +  PP KK+
Sbjct: 241 PHPPIKTY-PPPKEC--PPPPEHY----PWPPKKKY-PPPVEYPSPPYKKY 283

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/114 (42%), Positives = 58/114 (50%), Gaps = 7/114 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP---PPPKKHYVYKSP 178
           P  P     PPP+   PPP +        PPP+K Y PPP  H P   PPP K Y    P
Sbjct: 47  PKFPYSPPKPPPIEKYPPPVQY-------PPPIKKYPPPPYEHPPVKYPPPIKTY----P 95

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP----PPPKKH 328
            PPVK Y PP  Y  PPP KK+   +  PPP+K Y PP  Y  P    PPP+++
Sbjct: 96  HPPVK-YPPPEQY--PPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQY 146

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 50/106 (47%), Positives = 55/106 (51%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K  PPP+K Y PP  Y   PPP K Y    P PPVK Y PPP    P PP K Y     P
Sbjct: 203 KKYPPPIKKYPPPEEY---PPPIKTY----PHPPVK-YPPPPYKTYPHPPIKTY-----P 249

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP +   PPP  H P PPKK Y     PPPV++ SPP   + P  P
Sbjct: 250 PPKE--CPPPPEHYPWPPKKKY-----PPPVEYPSPPYKKYPPADP 288

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 42/114 (36%), Positives = 51/114 (44%), Gaps = 15/114 (13%)
 Frame = +2

Query: 32  SPPPVYHSPPPPK--KHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS 202
           S P  +H  PP K    + Y  P PPP++ Y PP  Y               PPP+K Y 
Sbjct: 32  SVPNWFHHWPPFKWGPKFPYSPPKPPPIEKYPPPVQY---------------PPPIKKYP 76

Query: 203 PPPVYHSPP------------PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PPP Y  PP            PP K+   +  PPP+K Y PP  Y  PPP KK+
Sbjct: 77  PPP-YEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQY--PPPIKKY 127

[140][TOP]
>UniRef100_C0HF38 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0HF38_MAIZE
          Length = 580

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 53/117 (45%), Positives = 57/117 (48%), Gaps = 10/117 (8%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHS--PPPPKKHYVYKSPPPPVKHYSPPPVY---HSPPPPKKHYVYK 172
           PPPP + Y PPP  H   PPPP + Y    PPPP  H  PPP     H PPPP +H +  
Sbjct: 82  PPPPPRGYGPPPPQHQHVPPPPPRGYG-PPPPPPHGHVPPPPPPRHGHGPPPPGQHVL-- 138

Query: 173 SPPPPVKHYSPPPVYHSPP-----PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
            P  P  H  PPP  H PP     PP        PPPP  H  PPP  H PPPP  H
Sbjct: 139 PPLLPHGHGPPPPGQHMPPPHGHGPPPPGQRVPPPPPPHGHGPPPPGQHLPPPPPPH 195

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/112 (45%), Positives = 57/112 (50%), Gaps = 5/112 (4%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVY---HSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHYVYK 172
           PPPP + Y PPP     H PPPP   + +  PPPP +H  PP  P  H PPPP +H    
Sbjct: 100 PPPPPRGYGPPPPPPHGHVPPPPPPRHGH-GPPPPGQHVLPPLLPHGHGPPPPGQHM--- 155

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
             PPP  H  PPP    PPPP  H     PPPP +H  PPP  H   PP  H
Sbjct: 156 --PPPHGHGPPPPGQRVPPPPPPHG--HGPPPPGQHLPPPPPPHGHGPPPPH 203

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 50/113 (44%), Positives = 55/113 (48%), Gaps = 9/113 (7%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVY---HSPPPPKKHYVYK------SPPPPVKHYSPPPVYHSPPPPKKH 160
           PPPP  H  PPP     H PPPP +H +         PPPP +H  PPP  H PPPP + 
Sbjct: 111 PPPPHGHVPPPPPPRHGHGPPPPGQHVLPPLLPHGHGPPPPGQHM-PPPHGHGPPPPGQR 169

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PPPP  H  PPP  H PP          PPPP  H  PPP   +PPPP
Sbjct: 170 V--PPPPPPHGHGPPPPGQHLPP----------PPPPHGHGPPPPHQQAPPPP 210

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/109 (44%), Positives = 55/109 (50%), Gaps = 4/109 (3%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS--PPPPKKHYVYKSPPPP 187
           PP  H S PP    P PP +      PPPP + Y PPP  H   PPPP + Y    PPPP
Sbjct: 60  PPHHHQSVPP----PGPPPQWSAQGHPPPPPRGYGPPPPQHQHVPPPPPRGY---GPPPP 112

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKH 328
                 PP  H PPPP   + +  PPPP +H  PP  P  H PPPP +H
Sbjct: 113 ------PPHGHVPPPPPPRHGH-GPPPPGQHVLPPLLPHGHGPPPPGQH 154

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/125 (39%), Positives = 56/125 (44%), Gaps = 21/125 (16%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPP----------PPKKHYVYKSPPPPVKHYSPPPVYHS--PPPP 151
           P P     + P   H PP          PP +      PPPP + Y PPP  H   PPPP
Sbjct: 44  PSPTAPAAAAPNHVHHPPHHHQSVPPPGPPPQWSAQGHPPPPPRGYGPPPPQHQHVPPPP 103

Query: 152 KKHYVYKSPPPPVKHYSPPPV---YHSPPPPKKHYV------YKSPPPPVKHYSPPPVYH 304
            + Y    PPPP  H  PPP     H PPPP +H +         PPPP +H  PPP  H
Sbjct: 104 PRGY-GPPPPPPHGHVPPPPPPRHGHGPPPPGQHVLPPLLPHGHGPPPPGQH-MPPPHGH 161

Query: 305 SPPPP 319
            PPPP
Sbjct: 162 GPPPP 166

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 42/91 (46%), Positives = 45/91 (49%), Gaps = 2/91 (2%)
 Frame = +2

Query: 8   PPPPVKHYSPP--PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           PPPP +H  PP  P  H PPPP +H      PPP  H  PPP    PPPP  H     PP
Sbjct: 130 PPPPGQHVLPPLLPHGHGPPPPGQHM-----PPPHGHGPPPPGQRVPPPPPPHG--HGPP 182

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
           PP +H  PPP  H   PP  H     PP PV
Sbjct: 183 PPGQHLPPPPPPHGHGPPPPHQQAPPPPDPV 213

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 35/92 (38%), Positives = 43/92 (46%), Gaps = 6/92 (6%)
 Frame = +2

Query: 77  YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY----HSPPPPKKH 244
           Y Y+  P      +P  V+H   PP  H   +S PPP     PPP +    H PPPP+  
Sbjct: 40  YAYRPSPTAPAAAAPNHVHH---PPHHH---QSVPPP----GPPPQWSAQGHPPPPPRG- 88

Query: 245 YVYKSPPPPVKHYSPPPV--YHSPPPPKKHYV 334
             Y  PPP  +H  PPP   Y  PPPP   +V
Sbjct: 89  --YGPPPPQHQHVPPPPPRGYGPPPPPPHGHV 118

[141][TOP]
>UniRef100_Q9FUR6 ENOD2 (Fragment) n=1 Tax=Cladrastis kentukea RepID=Q9FUR6_CLALU
          Length = 244

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 64/140 (45%), Positives = 68/140 (48%), Gaps = 27/140 (19%)
 Frame = +2

Query: 2   KSPPP---PVKHYSPPPVYHSPPPPKKHYVYKSPPP-------PVKHYSPPPVYHSPPPP 151
           + PPP   P  H  PPPVY  PP  K   VY+ PP        P  H  PPPVY  PP  
Sbjct: 72  EKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHE 131

Query: 152 KKHYVYKSP---PPPV----KHYSPPPVY---HSPPPPKKHYVYKSP----PPPV---KH 280
           K   VY  P   PPPV     H  PPPVY   H  PPP    VY+ P    PPPV    H
Sbjct: 132 KPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPP----VYQPPPHEKPPPVYPPPH 187

Query: 281 YSPPPVYHSPPPPKKHYVYK 340
             PPPVY  PPP +K  VYK
Sbjct: 188 EKPPPVY-QPPPHEKPPVYK 206

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/114 (46%), Positives = 59/114 (51%), Gaps = 4/114 (3%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSP--PPPKKHYVYKSPPP--PVKHYSPPPVYHSPPPPKKHYVYKSP 178
           PPP +   PPPVY  P  PPP  H  ++ PPP  P  H  PPPVY  PP  K   VY+ P
Sbjct: 24  PPPTE--KPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYQPP 81

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
           P    H  PPPVY  PP  K   VY+ PP    H  PP VY  PP  K   VY+
Sbjct: 82  P----HVKPPPVYQPPPHVKPPPVYQPPP----HEKPPSVY-PPPHEKPPPVYQ 126

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 56/123 (45%), Positives = 58/123 (47%), Gaps = 17/123 (13%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP---PPPV----KHYSPPPVYHSPPPPKKH 160
           + PPP  K    PP  H PP  K   VY  P   PPPV     H  PPPVY  PP  K  
Sbjct: 28  EKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYQPPPHVKPP 87

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP---PPPV----KHYSPPPVY---HSP 310
            VY+ PP    H  PPPVY  PP  K   VY  P   PPPV     H  PPPVY   H  
Sbjct: 88  PVYQPPP----HVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEK 143

Query: 311 PPP 319
           PPP
Sbjct: 144 PPP 146

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 54/116 (46%), Positives = 57/116 (49%), Gaps = 12/116 (10%)
 Frame = +2

Query: 2   KSPPP--PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           + PPP  P  H  PPPVY  PP  K   VY   PPP  H  PPPVY  PP  K   VY  
Sbjct: 131 EKPPPVYPPPHEKPPPVYQPPPHEKPPPVY---PPP--HEKPPPVYQPPPHEKPPPVYPP 185

Query: 176 P---PPPVKHYSP---PPVY----HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
           P   PPPV    P   PPVY    + PPP +K  VYK P      Y PPP  H PP
Sbjct: 186 PHEKPPPVYQPPPHEKPPVYKPPGYEPPPVEKPPVYKPPVEKPPSYKPPPYGHYPP 241

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 62/135 (45%), Positives = 64/135 (47%), Gaps = 28/135 (20%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP---P 181
           PPP  H  PPPVY  PP  K   VY   PPP  H  PPPVY  PP  K   VY  P   P
Sbjct: 115 PPP--HEKPPPVYQPPPHEKPPPVY---PPP--HEKPPPVYQPPPHEKPPPVYPPPHEKP 167

Query: 182 PPV----KHYSPPPVY---HSPPPP-------KKHYVYKSP---PPPVKHYSPPPVYHSP 310
           PPV     H  PPPVY   H  PPP       +K  VYK P   PPPV+    PPVY  P
Sbjct: 168 PPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPVYKPPGYEPPPVE---KPPVYKPP 224

Query: 311 --------PPPKKHY 331
                   PPP  HY
Sbjct: 225 VEKPPSYKPPPYGHY 239

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 51/105 (48%), Positives = 53/105 (50%), Gaps = 5/105 (4%)
 Frame = +2

Query: 38  PPVYHSPPPPKKHYVYKSP--PPPVKH---YSPPPVYHSPPPPKKHYVYKSPPPPVKHYS 202
           PP Y  PP  K   VYK P  PPPV H     PPPVY  PPP +K      PPP   H  
Sbjct: 19  PPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVY--PPPHEKPPPVYQPPP---HEK 73

Query: 203 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           PPPVY  PP  K   VY+ PP    H  PPPVY  PP  K   VY
Sbjct: 74  PPPVYQPPPHVKPPPVYQPPP----HVKPPPVYQPPPHEKPPSVY 114

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 63/142 (44%), Positives = 65/142 (45%), Gaps = 31/142 (21%)
 Frame = +2

Query: 8   PPP---PVKHYSPPPVYHSPPPPKKHYVYKSP---PPPV----KHYSPPPVY---HSPPP 148
           PPP   P  H  PPPVY  PP  K   VY  P   PPPV     H  PPPVY   H  PP
Sbjct: 86  PPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPP 145

Query: 149 PKKHYVYKSPP----PPV---KHYSPPPVYHSPPPPKKHYVYKSP---PPPVKHYSP--- 289
           P    VY+ PP    PPV    H  PPPVY  PP  K   VY  P   PPPV    P   
Sbjct: 146 P----VYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEK 201

Query: 290 -----PPVYHSPPPPKKHYVYK 340
                PP Y   PP +K  VYK
Sbjct: 202 PPVYKPPGYEP-PPVEKPPVYK 222

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 45/113 (39%), Positives = 53/113 (46%), Gaps = 4/113 (3%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP--PPPKKHYVYKSPPP- 184
           P + +Y PP   + PP  +K   Y+ PPP  K   PPPVY  P  PPP  H  ++ PPP 
Sbjct: 1   PVLANYKPPT--YEPPATEKPPTYE-PPPTEK---PPPVYKPPIYPPPVHHPPHEKPPPV 54

Query: 185 -PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 340
            P  H  PPPVY  PP                H  PPPVY  PP  K   VY+
Sbjct: 55  YPPPHEKPPPVYQPPP----------------HEKPPPVYQPPPHVKPPPVYQ 91

[142][TOP]
>UniRef100_Q5N8V9 Os01g0899700 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5N8V9_ORYSJ
          Length = 412

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 52/122 (42%), Positives = 60/122 (49%), Gaps = 13/122 (10%)
 Frame = +2

Query: 5   SPPP-----PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           SPPP     P  + +PP  Y+ PPPP   Y Y SP PP   Y PPP Y + PPP+    Y
Sbjct: 237 SPPPYQYTPPNSYQAPPTSYNHPPPP---YGYNSPIPPTNKYLPPPYYFNSPPPQ----Y 289

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP--------PPVKHYSPPPVYHSPPPPKK 325
           +  PP   + SPP  +  PPPP     YKSPP        PP  HYSPPP      PP  
Sbjct: 290 QHSPPANSYVSPPLAHQYPPPP-----YKSPPIPPYYFNSPPANHYSPPPYNFGSSPPTY 344

Query: 326 HY 331
            Y
Sbjct: 345 QY 346

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/137 (40%), Positives = 64/137 (46%), Gaps = 29/137 (21%)
 Frame = +2

Query: 8   PPPPVKHYSPP-PVYHSPPP----PKKHYVYKSPP------PPVKHYSPPPVYHSPPPPK 154
           P PP  + SPP P   SPPP    P   + Y SPP      PP   Y+PP  Y +PP   
Sbjct: 197 PSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSYHSPPPYQYTPPNSYQAPPTSY 256

Query: 155 KH----YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP------PPVKHYSPPPVYH 304
            H    Y Y SP PP   Y PPP Y + PPP+  +   SPP      PP+ H  PPP Y 
Sbjct: 257 NHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQH---SPPANSYVSPPLAHQYPPPPYK 313

Query: 305 SPP--------PPKKHY 331
           SPP        PP  HY
Sbjct: 314 SPPIPPYYFNSPPANHY 330

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 45/116 (38%), Positives = 57/116 (49%), Gaps = 16/116 (13%)
 Frame = +2

Query: 23  KHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPPVYHSPPPPKKHY------VY 169
           K +  PP++    PP   Y Y SPP     PP+ +   PP ++  PPP   Y       Y
Sbjct: 176 KPHIQPPIFPYNSPPPSPYQYPSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSY 235

Query: 170 KSPP-----PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
            SPP     PP  + +PP  Y+ PPPP   Y Y SP PP   Y PPP Y + PPP+
Sbjct: 236 HSPPPYQYTPPNSYQAPPTSYNHPPPP---YGYNSPIPPTNKYLPPPYYFNSPPPQ 288

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 54/148 (36%), Positives = 61/148 (41%), Gaps = 50/148 (33%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP------PPVKHYSPPPVYHSPP------- 145
           SP PP   Y PPP Y + PPP+  +   SPP      PP+ H  PPP Y SPP       
Sbjct: 267 SPIPPTNKYLPPPYYFNSPPPQYQH---SPPANSYVSPPLAHQYPPPPYKSPPIPPYYFN 323

Query: 146 -PPKKHYVYKSPPP-------PVKHYSPPP----------------------------VY 217
            PP  HY   SPPP       P   YSPP                             V+
Sbjct: 324 SPPANHY---SPPPYNFGSSPPTYQYSPPLLPKTPKYLPPKVPLEMSPPAHATSPQPLVH 380

Query: 218 HSPPPPKKHYVYKSPPPPVKHY-SPPPV 298
           +SPPPP +H    S  P V  Y SPPPV
Sbjct: 381 YSPPPPLQHAGISSTTPSVNSYQSPPPV 408

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/109 (40%), Positives = 53/109 (48%), Gaps = 1/109 (0%)
 Frame = +2

Query: 11  PPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PP   + SPPP  Y  P PP   + YKSPP P   +SPPP    PPP  ++     P PP
Sbjct: 181 PPIFPYNSPPPSPYQYPSPP---FNYKSPPLP-NQFSPPPFNKFPPPSHQY-----PSPP 231

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
              Y  PP Y   PP      Y++PP    H  PP  Y+SP PP   Y+
Sbjct: 232 QSSYHSPPPYQYTPPNS----YQAPPTSYNHPPPPYGYNSPIPPTNKYL 276

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 39/99 (39%), Positives = 41/99 (41%), Gaps = 28/99 (28%)
 Frame = +2

Query: 2   KSPP--------PPVKHYSPPPVYHSPPPPKKHYVYKSPP------------------PP 103
           KSPP        PP  HYSPPP      PP   Y   SPP                  PP
Sbjct: 313 KSPPIPPYYFNSPPANHYSPPPYNFGSSPPTYQY---SPPLLPKTPKYLPPKVPLEMSPP 369

Query: 104 VKHYSPPPVYH-SPPPPKKHYVYKSPPPPVKHY-SPPPV 214
               SP P+ H SPPPP +H    S  P V  Y SPPPV
Sbjct: 370 AHATSPQPLVHYSPPPPLQHAGISSTTPSVNSYQSPPPV 408

[143][TOP]
>UniRef100_Q40793 Tyrosine-rich hydroxyproline-rich glycoprotein (Fragment) n=1
           Tax=Petroselinum crispum RepID=Q40793_PETCR
          Length = 259

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 52/94 (55%), Positives = 55/94 (58%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 226
           YHSPPPP      KSPPPP  + SPPP   SPPPP   Y Y SPPPPVK         SP
Sbjct: 1   YHSPPPP-----VKSPPPPYYYSSPPPPVKSPPPP---YYYTSPPPPVK---------SP 43

Query: 227 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PPP   Y Y SPPPP+K  SPPP Y+  P P  H
Sbjct: 44  PPP---YYYTSPPPPMK--SPPPPYYPHPHPHPH 72

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 46/80 (57%), Positives = 49/80 (61%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPVK   PP  Y SPPPP      KSPPPP  + SPPP   SPPPP   Y Y SPPP
Sbjct: 3   SPPPPVKSPPPPYYYSSPPPP-----VKSPPPPYYYTSPPPPVKSPPPP---YYYTSPPP 54

Query: 185 PVKHYSPPPVYHSPPPPKKH 244
           P+K  SPPP Y+  P P  H
Sbjct: 55  PMK--SPPPPYYPHPHPHPH 72

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 31/71 (43%), Positives = 36/71 (50%), Gaps = 5/71 (7%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKH 196
           S  P  ++P  P K   YK  P P    +PP  Y SPPPP K      Y YKSPPPP K 
Sbjct: 189 SAKPFAYAPKTPYKK-CYKPVPTPAAPLTPPYYYQSPPPPSKSPAPTPYYYKSPPPPTKS 247

Query: 197 YSPPPVYHSPP 229
            +P P Y+  P
Sbjct: 248 PAPTPYYYKSP 258

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 31/71 (43%), Positives = 36/71 (50%), Gaps = 5/71 (7%)
 Frame = +2

Query: 116 SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH-----YVYKSPPPPVKH 280
           S  P  ++P  P K   YK  P P    +PP  Y SPPPP K      Y YKSPPPP K 
Sbjct: 189 SAKPFAYAPKTPYKK-CYKPVPTPAAPLTPPYYYQSPPPPSKSPAPTPYYYKSPPPPTKS 247

Query: 281 YSPPPVYHSPP 313
            +P P Y+  P
Sbjct: 248 PAPTPYYYKSP 258

[144][TOP]
>UniRef100_B3XYC5 Chitin-binding lectin n=1 Tax=Solanum lycopersicum var. cerasiforme
           RepID=B3XYC5_SOLLC
          Length = 365

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 55/105 (52%), Positives = 55/105 (52%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP    SPPP   SPPPP       SPPP
Sbjct: 97  SPPPP----SPPPPSPSPPPPSPPPPSPSPPPPTP--SPPPPAPSPPPPSPPPPSPSPPP 150

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP   SPPPP       SP PP    SPPP   SPPPP
Sbjct: 151 P----SPPPPSPSPPPPTPSPPPPSPSPPPPTPSPPPPAPSPPPP 191

[145][TOP]
>UniRef100_A2WXZ6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2WXZ6_ORYSI
          Length = 412

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 52/122 (42%), Positives = 60/122 (49%), Gaps = 13/122 (10%)
 Frame = +2

Query: 5   SPPP-----PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           SPPP     P  + +PP  Y+ PPPP   Y Y SP PP   Y PPP Y + PPP+    Y
Sbjct: 237 SPPPYQYTPPNSYQAPPTSYNHPPPP---YGYNSPIPPTNKYLPPPYYFNSPPPQ----Y 289

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP--------PPVKHYSPPPVYHSPPPPKK 325
           +  PP   + SPP  +  PPPP     YKSPP        PP  HYSPPP      PP  
Sbjct: 290 QHSPPANSYVSPPLAHQYPPPP-----YKSPPIPPYYFNSPPANHYSPPPYNFGSSPPTY 344

Query: 326 HY 331
            Y
Sbjct: 345 QY 346

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/137 (40%), Positives = 64/137 (46%), Gaps = 29/137 (21%)
 Frame = +2

Query: 8   PPPPVKHYSPP-PVYHSPPP----PKKHYVYKSPP------PPVKHYSPPPVYHSPPPPK 154
           P PP  + SPP P   SPPP    P   + Y SPP      PP   Y+PP  Y +PP   
Sbjct: 197 PSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSYHSPPPYQYTPPNSYQAPPTSY 256

Query: 155 KH----YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP------PPVKHYSPPPVYH 304
            H    Y Y SP PP   Y PPP Y + PPP+  +   SPP      PP+ H  PPP Y 
Sbjct: 257 NHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQH---SPPANSYVSPPLAHQYPPPPYK 313

Query: 305 SPP--------PPKKHY 331
           SPP        PP  HY
Sbjct: 314 SPPIPPYYFNSPPANHY 330

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 45/116 (38%), Positives = 57/116 (49%), Gaps = 16/116 (13%)
 Frame = +2

Query: 23  KHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPPVYHSPPPPKKHY------VY 169
           K +  PP++    PP   Y Y SPP     PP+ +   PP ++  PPP   Y       Y
Sbjct: 176 KPHIQPPIFPYNSPPPSPYQYPSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSY 235

Query: 170 KSPP-----PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
            SPP     PP  + +PP  Y+ PPPP   Y Y SP PP   Y PPP Y + PPP+
Sbjct: 236 HSPPPYQYTPPNSYQAPPTSYNHPPPP---YGYNSPIPPTNKYLPPPYYFNSPPPQ 288

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 54/148 (36%), Positives = 61/148 (41%), Gaps = 50/148 (33%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP------PPVKHYSPPPVYHSPP------- 145
           SP PP   Y PPP Y + PPP+  +   SPP      PP+ H  PPP Y SPP       
Sbjct: 267 SPIPPTNKYLPPPYYFNSPPPQYQH---SPPANSYVSPPLAHQYPPPPYKSPPIPPYYFN 323

Query: 146 -PPKKHYVYKSPPP-------PVKHYSPPP----------------------------VY 217
            PP  HY   SPPP       P   YSPP                             V+
Sbjct: 324 SPPANHY---SPPPYNFGSSPPTYQYSPPLLPKTPKYLPPKVPLEMSPPAHATSPQPLVH 380

Query: 218 HSPPPPKKHYVYKSPPPPVKHY-SPPPV 298
           +SPPPP +H    S  P V  Y SPPPV
Sbjct: 381 YSPPPPLQHAGISSTTPSVNSYQSPPPV 408

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/109 (40%), Positives = 53/109 (48%), Gaps = 1/109 (0%)
 Frame = +2

Query: 11  PPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PP   + SPPP  Y  P PP   + YKSPP P   +SPPP    PPP  ++     P PP
Sbjct: 181 PPIFPYNSPPPSPYQYPSPP---FNYKSPPLP-NQFSPPPFNKFPPPSHQY-----PSPP 231

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
              Y  PP Y   PP      Y++PP    H  PP  Y+SP PP   Y+
Sbjct: 232 QSSYHSPPPYQYTPPNS----YQAPPTSYNHPPPPYGYNSPIPPTNKYL 276

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 39/99 (39%), Positives = 41/99 (41%), Gaps = 28/99 (28%)
 Frame = +2

Query: 2   KSPP--------PPVKHYSPPPVYHSPPPPKKHYVYKSPP------------------PP 103
           KSPP        PP  HYSPPP      PP   Y   SPP                  PP
Sbjct: 313 KSPPIPPYYFNSPPANHYSPPPYNFGSSPPTYQY---SPPLLPKTPKYLPPKVPLEMSPP 369

Query: 104 VKHYSPPPVYH-SPPPPKKHYVYKSPPPPVKHY-SPPPV 214
               SP P+ H SPPPP +H    S  P V  Y SPPPV
Sbjct: 370 AHATSPQPLVHYSPPPPLQHAGISSTTPSVNSYQSPPPV 408

[146][TOP]
>UniRef100_Q5ZB68 Os01g0594300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5ZB68_ORYSJ
          Length = 551

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 54/105 (51%), Positives = 58/105 (55%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP   Y Y SPPPP    SP   Y SPPPP  ++  ++PPP
Sbjct: 433 SPPPP----SPPPP--SPPPPSPVY-YSSPPPPYYEVSPEDRYLSPPPPPAYH--EAPPP 483

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SP   Y SPPPP   Y    PPPP    SP   Y SPPPP
Sbjct: 484 PYYEVSPEDRYLSPPPPPA-YQETPPPPPQYEVSPEDRYLSPPPP 527

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 54/105 (51%), Positives = 58/105 (55%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP P   SPPPP       SPPPP    SPPP   SPPPP   Y Y SPPP
Sbjct: 409 SPPPP----SPSPPPPSPPPPSPPPPSPSPPPP----SPPPP--SPPPPSPVY-YSSPPP 457

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SP   Y SPPPP  +  +++PPPP    SP   Y SPPPP
Sbjct: 458 PYYEVSPEDRYLSPPPPPAY--HEAPPPPYYEVSPEDRYLSPPPP 500

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 57/109 (52%), Positives = 59/109 (54%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP    SPPP   SPPPP       SPPP
Sbjct: 399 SPPPP----SPPPP--SPPPPSP-----SPPPP----SPPPP--SPPPPSP-----SPPP 436

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           P    SPPP   SPPPP   Y Y SPPPP    SP   Y SPPPP  ++
Sbjct: 437 P----SPPPP--SPPPPSPVY-YSSPPPPYYEVSPEDRYLSPPPPPAYH 478

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/119 (44%), Positives = 61/119 (51%), Gaps = 14/119 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP---VYHSPPPPKKHYV-----YKSPPP-PVKHYSPPPVYHSPPPPKK 157
           SPPPP    SPPP   VY+S PPP  + V     Y SPPP P  H +PPP Y+   P  +
Sbjct: 438 SPPPP----SPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDR 493

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPP-----PKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              Y SPPPP  +   PP    PPP     P+  Y+   PP PVK   P   Y SPPPP
Sbjct: 494 ---YLSPPPPPAYQETPP----PPPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPP 545

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 45/102 (44%), Positives = 55/102 (53%), Gaps = 7/102 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP   Y SPPPP  ++  ++PPPP    SP   Y SPPPP  +   ++PPP
Sbjct: 454 SPPPPYYEVSPEDRYLSPPPPPAYH--EAPPPPYYEVSPEDRYLSPPPPPAYQ--ETPPP 509

Query: 185 PVKH-YSPPPVYHSPPPPK------KHYVYKSPPPPVKHYSP 289
           P ++  SP   Y SPPPP         Y Y SPPPP   + P
Sbjct: 510 PPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 551

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/64 (53%), Positives = 34/64 (53%)
 Frame = +2

Query: 128 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 307
           V  SPPPP       SPPPP    SPPP   SPPPP       SPPPP    SPPP   S
Sbjct: 396 VLPSPPPP-------SPPPP----SPPPPSPSPPPP-------SPPPP----SPPPPSPS 433

Query: 308 PPPP 319
           PPPP
Sbjct: 434 PPPP 437

[147][TOP]
>UniRef100_B9ILJ5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9ILJ5_POPTR
          Length = 509

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 52/105 (49%), Positives = 58/105 (55%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPP PV    PPP  +SPPPP       SPPPP+ HY PPP    PPPP    VY   PP
Sbjct: 415 SPPMPVPSPPPPPPVYSPPPPPPS---SSPPPPI-HYKPPPSPSPPPPPA---VYYHSPP 467

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P+    PP +Y SPPPP    VY+ P PP+   S    Y SPPPP
Sbjct: 468 PLSPPPPPVIYGSPPPPTP--VYEGPLPPITGVS----YASPPPP 506

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 46/97 (47%), Positives = 49/97 (50%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 220
           P    PPPP       SPPPP   YSPP     PPPP       SPPPP+ HY PPP   
Sbjct: 406 PSLPPPPPPSPPMPVPSPPPPPPVYSPP-----PPPPS-----SSPPPPI-HYKPPPSPS 454

Query: 221 SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
            PPPP    VY   PPP+    PP +Y SPPPP   Y
Sbjct: 455 PPPPPA---VYYHSPPPLSPPPPPVIYGSPPPPTPVY 488

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 34/71 (47%), Positives = 36/71 (50%)
 Frame = +2

Query: 125 PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 304
           P    PPPP       SPPPP      PPVY  PPPP       SPPPP+ HY PPP   
Sbjct: 406 PSLPPPPPPSPPMPVPSPPPP------PPVYSPPPPPPS----SSPPPPI-HYKPPPS-P 453

Query: 305 SPPPPKKHYVY 337
           SPPPP   Y +
Sbjct: 454 SPPPPPAVYYH 464

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 29/65 (44%), Positives = 32/65 (49%), Gaps = 8/65 (12%)
 Frame = +2

Query: 161 YVYKSPPPP--------VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           +V   PPPP             PPPVY  PPPP       SPPPP+ HY PPP    PPP
Sbjct: 404 FVPSLPPPPPPSPPMPVPSPPPPPPVYSPPPPPPS----SSPPPPI-HYKPPPSPSPPPP 458

Query: 317 PKKHY 331
           P  +Y
Sbjct: 459 PAVYY 463

[148][TOP]
>UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9EXV1_ORYSJ
          Length = 532

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 54/105 (51%), Positives = 58/105 (55%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP   Y Y SPPPP    SP   Y SPPPP  ++  ++PPP
Sbjct: 414 SPPPP----SPPPP--SPPPPSPVY-YSSPPPPYYEVSPEDRYLSPPPPPAYH--EAPPP 464

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SP   Y SPPPP   Y    PPPP    SP   Y SPPPP
Sbjct: 465 PYYEVSPEDRYLSPPPPPA-YQETPPPPPQYEVSPEDRYLSPPPP 508

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 54/105 (51%), Positives = 58/105 (55%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP P   SPPPP       SPPPP    SPPP   SPPPP   Y Y SPPP
Sbjct: 390 SPPPP----SPSPPPPSPPPPSPPPPSPSPPPP----SPPPP--SPPPPSPVY-YSSPPP 438

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SP   Y SPPPP  ++  ++PPPP    SP   Y SPPPP
Sbjct: 439 PYYEVSPEDRYLSPPPPPAYH--EAPPPPYYEVSPEDRYLSPPPP 481

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 56/110 (50%), Positives = 58/110 (52%), Gaps = 1/110 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP    SPPP   SPPPP       SPPP
Sbjct: 368 SPPPP----SPPPPSPSPPPP-------SPPPP----SPPPPSPSPPPPSPPP--PSPPP 410

Query: 185 PVKHYSPP-PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           P     PP P   SPPPP   Y Y SPPPP    SP   Y SPPPP  ++
Sbjct: 411 PSPSPPPPSPPPPSPPPPSPVY-YSSPPPPYYEVSPEDRYLSPPPPPAYH 459

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/119 (44%), Positives = 61/119 (51%), Gaps = 14/119 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP---VYHSPPPPKKHYV-----YKSPPP-PVKHYSPPPVYHSPPPPKK 157
           SPPPP    SPPP   VY+S PPP  + V     Y SPPP P  H +PPP Y+   P  +
Sbjct: 419 SPPPP----SPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDR 474

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPP-----PKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              Y SPPPP  +   PP    PPP     P+  Y+   PP PVK   P   Y SPPPP
Sbjct: 475 ---YLSPPPPPAYQETPP----PPPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPP 526

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 45/102 (44%), Positives = 55/102 (53%), Gaps = 7/102 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP   Y SPPPP  ++  ++PPPP    SP   Y SPPPP  +   ++PPP
Sbjct: 435 SPPPPYYEVSPEDRYLSPPPPPAYH--EAPPPPYYEVSPEDRYLSPPPPPAYQ--ETPPP 490

Query: 185 PVKH-YSPPPVYHSPPPPK------KHYVYKSPPPPVKHYSP 289
           P ++  SP   Y SPPPP         Y Y SPPPP   + P
Sbjct: 491 PPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 532

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 48/92 (52%), Positives = 48/92 (52%)
 Frame = +2

Query: 44  VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 223
           V  SPPPP       SPPPP    SPPP   SPPPP       SPPPP    SPPP   S
Sbjct: 358 VLPSPPPPPP-----SPPPP----SPPPPSPSPPPP-------SPPPP----SPPPPSPS 397

Query: 224 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPPP       SPPPP    SPPP   SPPPP
Sbjct: 398 PPPP-------SPPPP----SPPPPSPSPPPP 418

[149][TOP]
>UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa
           RepID=Q8L3T8_ORYSJ
          Length = 570

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 54/105 (51%), Positives = 58/105 (55%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP   Y Y SPPPP    SP   Y SPPPP  ++  ++PPP
Sbjct: 452 SPPPP----SPPPP--SPPPPSPVY-YSSPPPPYYEVSPEDRYLSPPPPPAYH--EAPPP 502

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SP   Y SPPPP   Y    PPPP    SP   Y SPPPP
Sbjct: 503 PYYEVSPEDRYLSPPPPPA-YQETPPPPPQYEVSPEDRYLSPPPP 546

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 54/105 (51%), Positives = 58/105 (55%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP P   SPPPP       SPPPP    SPPP   SPPPP   Y Y SPPP
Sbjct: 428 SPPPP----SPSPPPPSPPPPSPPPPSPSPPPP----SPPPP--SPPPPSPVY-YSSPPP 476

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SP   Y SPPPP  ++  ++PPPP    SP   Y SPPPP
Sbjct: 477 PYYEVSPEDRYLSPPPPPAYH--EAPPPPYYEVSPEDRYLSPPPP 519

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 56/110 (50%), Positives = 58/110 (52%), Gaps = 1/110 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP    SPPP   SPPPP       SPPP
Sbjct: 406 SPPPP----SPPPPSPSPPPP-------SPPPP----SPPPPSPSPPPPSPPP--PSPPP 448

Query: 185 PVKHYSPP-PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           P     PP P   SPPPP   Y Y SPPPP    SP   Y SPPPP  ++
Sbjct: 449 PSPSPPPPSPPPPSPPPPSPVY-YSSPPPPYYEVSPEDRYLSPPPPPAYH 497

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/119 (44%), Positives = 61/119 (51%), Gaps = 14/119 (11%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP---VYHSPPPPKKHYV-----YKSPPP-PVKHYSPPPVYHSPPPPKK 157
           SPPPP    SPPP   VY+S PPP  + V     Y SPPP P  H +PPP Y+   P  +
Sbjct: 457 SPPPP----SPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDR 512

Query: 158 HYVYKSPPPPVKHYSPPPVYHSPPP-----PKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              Y SPPPP  +   PP    PPP     P+  Y+   PP PVK   P   Y SPPPP
Sbjct: 513 ---YLSPPPPPAYQETPP----PPPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPP 564

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 45/102 (44%), Positives = 55/102 (53%), Gaps = 7/102 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP   Y SPPPP  ++  ++PPPP    SP   Y SPPPP  +   ++PPP
Sbjct: 473 SPPPPYYEVSPEDRYLSPPPPPAYH--EAPPPPYYEVSPEDRYLSPPPPPAYQ--ETPPP 528

Query: 185 PVKH-YSPPPVYHSPPPPK------KHYVYKSPPPPVKHYSP 289
           P ++  SP   Y SPPPP         Y Y SPPPP   + P
Sbjct: 529 PPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 570

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 48/92 (52%), Positives = 48/92 (52%)
 Frame = +2

Query: 44  VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 223
           V  SPPPP       SPPPP    SPPP   SPPPP       SPPPP    SPPP   S
Sbjct: 396 VLPSPPPPPP-----SPPPP----SPPPPSPSPPPP-------SPPPP----SPPPPSPS 435

Query: 224 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPPP       SPPPP    SPPP   SPPPP
Sbjct: 436 PPPP-------SPPPP----SPPPPSPSPPPP 456

[150][TOP]
>UniRef100_Q09084 Extensin (Class II) n=1 Tax=Solanum lycopersicum RepID=Q09084_SOLLC
          Length = 322

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 52/113 (46%), Positives = 59/113 (52%), Gaps = 3/113 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY---K 172
           +SPPPP     PPP  +   P  +H   +SPPPP  H   P  +HSPPPP   Y +    
Sbjct: 47  RSPPPPKSTPLPPPAPYKKSPTYQH---RSPPPPT-HKISPVTHHSPPPPSPVYDHPSPS 102

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           SPPPPV +  PPPVYH PPP    Y  KSPPPP       P   SP PP   Y
Sbjct: 103 SPPPPVYYSPPPPVYHEPPPT---YKPKSPPPPPTPSYEHPKTPSPLPPTPSY 152

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/135 (38%), Positives = 56/135 (41%), Gaps = 25/135 (18%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS-- 175
           K+P PP   Y  P     P P  +H    SPPPP   Y  P     PPPP   Y +    
Sbjct: 165 KTPSPPTPSYEHPKTPSPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPPPTPSYEHPKTP 224

Query: 176 --------------PPPPVKHY----SPPPVYHSPPPPKKH-----YVYKSPPPPVKHYS 286
                         PPPP  H+    SPP  Y SPPPP        Y Y SPPPP     
Sbjct: 225 SHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPPSPSPPPPTYYYSSPPPP-SPSP 283

Query: 287 PPPVYHSPPPPKKHY 331
           PPP Y SPPPP   Y
Sbjct: 284 PPPTYSSPPPPPPFY 298

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 48/111 (43%), Positives = 56/111 (50%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K  P P     PPP + S     K    +SPPPP     PPP  +   P  +H   +SPP
Sbjct: 23  KPKPKPKPRGPPPPTWKSSGSHNK----RSPPPPKSTPLPPPAPYKKSPTYQH---RSPP 75

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVY---KSPPPPVKHYSPPPVYHSPPPPKK 325
           PP  H   P  +HSPPPP   Y +    SPPPPV +  PPPVYH PPP  K
Sbjct: 76  PPT-HKISPVTHHSPPPPSPVYDHPSPSSPPPPVYYSPPPPVYHEPPPTYK 125

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 54/136 (39%), Positives = 61/136 (44%), Gaps = 26/136 (19%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY-----------VYKSPPPPVKHYSPPPVY---HS 139
           +SPPPP  H   P  +HSPPPP   Y           VY SPPPPV ++ PPP Y     
Sbjct: 72  RSPPPPT-HKISPVTHHSPPPPSPVYDHPSPSSPPPPVYYSPPPPV-YHEPPPTYKPKSP 129

Query: 140 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY------SPP--- 292
           PPPP   Y +   P P+    P P Y  P  P  H   K+P PP   Y      SPP   
Sbjct: 130 PPPPTPSYEHPKTPSPL---PPTPSYEHPKTPPSHEHPKTPSPPTPSYEHPKTPSPPTPS 186

Query: 293 ---PVYHSPPPPKKHY 331
              P   SPPPP   Y
Sbjct: 187 YEHPKTPSPPPPTPSY 202

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/160 (32%), Positives = 57/160 (35%), Gaps = 55/160 (34%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP-----------------------------------PKKHY 79
           SPPPPV +  PPPVYH PPP                                   P  H 
Sbjct: 103 SPPPPVYYSPPPPVYHEPPPTYKPKSPPPPPTPSYEHPKTPSPLPPTPSYEHPKTPPSHE 162

Query: 80  VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 259
             K+P PP   Y  P     P P  +H    SPPPP   Y  P     PPPP   Y +  
Sbjct: 163 HPKTPSPPTPSYEHPKTPSPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPPPTPSYEHPK 222

Query: 260 ----------------PPPPVKHY----SPPPVYHSPPPP 319
                           PPPP  H+    SPP  Y SPPPP
Sbjct: 223 TPSHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPP 262

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 51/115 (44%), Positives = 56/115 (48%), Gaps = 11/115 (9%)
 Frame = +2

Query: 8   PPPPVKHYS----------PPPVYHSPPPPKKHYVYK-SPPPPVKHYSPPPVYHSPPPPK 154
           PPPP   Y           P P  + PPPP  +  ++  P PP  + SPPP   SPPPP 
Sbjct: 211 PPPPTPSYEHPKTPSHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPPSPSPPPPT 270

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
             Y Y SPPPP     PPP Y SPPPP   Y    P PPV   S    Y SPPPP
Sbjct: 271 --YYYSSPPPP-SPSPPPPTYSSPPPPPPFY-ENIPLPPVIGVS----YASPPPP 317

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 44/112 (39%), Positives = 50/112 (44%), Gaps = 3/112 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVY---HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           SPPPPV ++ PPP Y     PPPP   Y +   P P+    P P Y  P  P  H   K+
Sbjct: 111 SPPPPV-YHEPPPTYKPKSPPPPPTPSYEHPKTPSPL---PPTPSYEHPKTPPSHEHPKT 166

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           P PP   Y  P     P P  +H    SPPPP   Y  P     PPPP   Y
Sbjct: 167 PSPPTPSYEHPKTPSPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPPPTPSY 218

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/98 (50%), Positives = 52/98 (53%), Gaps = 6/98 (6%)
 Frame = +2

Query: 8   PPPPVKHY----SPPPVYHSPPPPKKHYVYKSPPPPVKHYS-PPPVYHSPPPPKKHYVYK 172
           PPPP  H+    SPP  Y SPPPP       SPPPP  +YS PPP   SPPPP     Y 
Sbjct: 239 PPPPNSHWEPKPSPPYTYSSPPPPSP-----SPPPPTYYYSSPPPPSPSPPPP----TYS 289

Query: 173 SPPPPVKHYSPPPVYHS-PPPPKKHYVYKSPPPPVKHY 283
           SPPPP      PP Y + P PP     Y SPPPPV  Y
Sbjct: 290 SPPPP------PPFYENIPLPPVIGVSYASPPPPVIPY 321

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 2/67 (2%)
 Frame = +2

Query: 5   SPPPPVKHY-SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS-PPPPKKHYVYKSP 178
           SPPPP  +Y SPPP   SPPPP     Y SPPP      PPP Y + P PP     Y SP
Sbjct: 265 SPPPPTYYYSSPPPPSPSPPPP----TYSSPPP------PPPFYENIPLPPVIGVSYASP 314

Query: 179 PPPVKHY 199
           PPPV  Y
Sbjct: 315 PPPVIPY 321

[151][TOP]
>UniRef100_B4MN04 GK17614 n=1 Tax=Drosophila willistoni RepID=B4MN04_DROWI
          Length = 257

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 59/147 (40%), Positives = 64/147 (43%), Gaps = 38/147 (25%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP----VKHYSPP------PVYHSPPPPKKH 160
           PPP KH  PPP    PPPP K  +Y  PPPP    V  Y PP      P    PPPP K 
Sbjct: 87  PPPTKHVPPPP---PPPPPTKKVIYTPPPPPPPKPVPEYLPPKKVVYTPPPPPPPPPTKK 143

Query: 161 YVYKSPPPP----VKHYSPP------PVYHSPPPPKKHYVYKSPPP-PVKHYSPPP---- 295
            +Y  PPPP    V  Y PP      P    PPPP K  +Y  PPP PV  Y PP     
Sbjct: 144 VIYTPPPPPPPKPVPEYLPPKKVVYTPPPPPPPPPTKKVIYTPPPPKPVPEYLPPKKVVY 203

Query: 296 -------------VYHSPPPPKKHYVY 337
                        V ++PPPP    VY
Sbjct: 204 TPPPPPPPPPTKKVIYTPPPPPPPVVY 230

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/129 (41%), Positives = 58/129 (44%), Gaps = 23/129 (17%)
 Frame = +2

Query: 8   PPPPVKHYSPP------PVYHSPPPPKKHYVYKSPPPP----VKHYSPP------PVYHS 139
           PP PV  Y PP      P    PPPP K  +Y  PPPP    V  Y PP      P    
Sbjct: 115 PPKPVPEYLPPKKVVYTPPPPPPPPPTKKVIYTPPPPPPPKPVPEYLPPKKVVYTPPPPP 174

Query: 140 PPPPKKHYVYKSPPP-PVKHYSPP------PVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
           PPPP K  +Y  PPP PV  Y PP      P    PPPP K  +Y  PPPP      PPV
Sbjct: 175 PPPPTKKVIYTPPPPKPVPEYLPPKKVVYTPPPPPPPPPTKKVIYTPPPPP------PPV 228

Query: 299 YHSPPPPKK 325
            + P P  K
Sbjct: 229 VYHPEPSNK 237

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 56/121 (46%), Positives = 61/121 (50%), Gaps = 17/121 (14%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPVYHSPPPPK--------KHYVYKSPPPPVKHYSPPP----VYHSPP 145
           PPPP K   Y+PPP    PPPPK        K  VY  PPPP     PPP    +Y  PP
Sbjct: 99  PPPPTKKVIYTPPP----PPPPKPVPEYLPPKKVVYTPPPPP----PPPPTKKVIYTPPP 150

Query: 146 PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPPP--VYHSPPP 316
           PP    V +  PP    Y+PPP    PPPP K  +Y  PPP PV  Y PP   VY  PPP
Sbjct: 151 PPPPKPVPEYLPPKKVVYTPPP--PPPPPPTKKVIYTPPPPKPVPEYLPPKKVVYTPPPP 208

Query: 317 P 319
           P
Sbjct: 209 P 209

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 60/141 (42%), Positives = 65/141 (46%), Gaps = 34/141 (24%)
 Frame = +2

Query: 2   KSPPPPVKH-------YSPPPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPK 154
           K+PPPP          Y PPP  H PPPP        PPPP K   Y+PPP    PPPPK
Sbjct: 69  KTPPPPPPQPTKPNIEYLPPPTKHVPPPPP-------PPPPTKKVIYTPPP----PPPPK 117

Query: 155 --------KHYVYKSPPPPVKH------YSPPPVYHSPPPPK--------KHYVYKSPPP 268
                   K  VY  PPPP         Y+PPP    PPPPK        K  VY  PPP
Sbjct: 118 PVPEYLPPKKVVYTPPPPPPPPPTKKVIYTPPP----PPPPKPVPEYLPPKKVVYTPPPP 173

Query: 269 PVKHYSPPP---VYHSPPPPK 322
           P     PPP   V ++PPPPK
Sbjct: 174 P----PPPPTKKVIYTPPPPK 190

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/132 (39%), Positives = 58/132 (43%), Gaps = 28/132 (21%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK-------HYSPPPVYH-----SPPPP 151
           PPPP         +++ P  K   V K+PPPP          Y PPP  H      PPPP
Sbjct: 43  PPPPAGILKDDGYHYAEPTVKFETVVKTPPPPPPQPTKPNIEYLPPPTKHVPPPPPPPPP 102

Query: 152 KKHYVYKSPPP----PVKHYSPP------PVYHSPPPPKKHYVYKSPPP----PVKHYSP 289
            K  +Y  PPP    PV  Y PP      P    PPPP K  +Y  PPP    PV  Y P
Sbjct: 103 TKKVIYTPPPPPPPKPVPEYLPPKKVVYTPPPPPPPPPTKKVIYTPPPPPPPKPVPEYLP 162

Query: 290 PP--VYHSPPPP 319
           P   VY  PPPP
Sbjct: 163 PKKVVYTPPPPP 174

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 41/108 (37%), Positives = 48/108 (44%), Gaps = 18/108 (16%)
 Frame = +2

Query: 50  HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK-------HYSPP 208
           ++PPPP        PPPP         +++ P  K   V K+PPPP          Y PP
Sbjct: 37  YTPPPP--------PPPPAGILKDDGYHYAEPTVKFETVVKTPPPPPPQPTKPNIEYLPP 88

Query: 209 PVYH-----SPPPPKKHYVYKSPPP----PVKHYSPPP--VYHSPPPP 319
           P  H      PPPP K  +Y  PPP    PV  Y PP   VY  PPPP
Sbjct: 89  PTKHVPPPPPPPPPTKKVIYTPPPPPPPKPVPEYLPPKKVVYTPPPPP 136

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 42/100 (42%), Positives = 48/100 (48%), Gaps = 8/100 (8%)
 Frame = +2

Query: 8   PPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           PPPP     PPP   V ++PPPPK    Y  PP  V +  PPP    PPPP K  +Y  P
Sbjct: 172 PPPP-----PPPTKKVIYTPPPPKPVPEY-LPPKKVVYTPPPP---PPPPPTKKVIYTPP 222

Query: 179 PPPVKHYSPPPVYHSPPPPK-----KHYVYKSPPPPVKHY 283
           PPP     PP VYH  P  K     + Y Y + P P   Y
Sbjct: 223 PPP-----PPVVYHPEPSNKIVVAHQGYSYPNDPQPSFEY 257

[152][TOP]
>UniRef100_O13849 Carboxypeptidase Y n=1 Tax=Schizosaccharomyces pombe
           RepID=CBPY_SCHPO
          Length = 1002

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 54/140 (38%), Positives = 71/140 (50%), Gaps = 32/140 (22%)
 Frame = +2

Query: 8   PPPPV-----KHYSPPPVYHSP----PPPKKHYV--YKSPPPPV-----KHYSPPPVYHS 139
           PPPP+     +H  PPP++H P    PPP  H+      PPPP+     +H  PPP++H 
Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE 267

Query: 140 P----PPPKKHY---VYKSPPP----PVKHYSPPPVYHS-----PPPPKKHYVYKSPPPP 271
           P    PPP  H+    +  PPP    P +H  PPP++H      PPPP  H   +  PPP
Sbjct: 268 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 327

Query: 272 VKHYSPPPVYHSPPPPKKHY 331
             H+ P    H PPPP KH+
Sbjct: 328 PMHHEPGE--HMPPPPFKHH 345

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/129 (37%), Positives = 63/129 (48%), Gaps = 32/129 (24%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYS------PPPVYHSP----PPPKKHY---VYKSPP 181
           P  H PPPP  H   +  PPP  H+       PPP++H P    PPP  H+    +  PP
Sbjct: 203 PGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 262

Query: 182 P----PVKHYSPPPVYHSP----PPPKKHY---VYKSPPP----PVKHYSPPPVYHSP-- 310
           P    P +H  PPP++H P    PPP  H+    +  PPP    P +H  PPP++H P  
Sbjct: 263 PMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGE 322

Query: 311 --PPPKKHY 331
             PPP  H+
Sbjct: 323 HMPPPPMHH 331

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/124 (35%), Positives = 58/124 (46%), Gaps = 16/124 (12%)
 Frame = +2

Query: 8   PPPPV-----KHYSPPPVYHSP-----PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 157
           PPPP+     +H  PPP++H P     PPP  H   +  PPP  H+ P    H PPPP  
Sbjct: 273 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGE--HMPPPPMH 330

Query: 158 HYVYK-SPPPPVKHYS----PPPVYHSPPPPKKHYVYKSPPPPVKHYSP-PPVYHSPPPP 319
           H   +  PPPP KH+       P +H  P  K+H  +K P     H  P    +H  P  
Sbjct: 331 HEPGEHMPPPPFKHHELEEHEGPEHHRGPEDKEH--HKGPKDKEHHKGPKDKEHHKGPKD 388

Query: 320 KKHY 331
           K+H+
Sbjct: 389 KEHH 392

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/121 (35%), Positives = 58/121 (47%), Gaps = 32/121 (26%)
 Frame = +2

Query: 65  PKKHYVYKSPPPPVKHYS------PPPVYHSP----PPPKKHY---VYKSPPP----PVK 193
           P  H   +  PPP  H+       PPP++H P    PPP  H+    +  PPP    P +
Sbjct: 198 PAHHEPGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGE 257

Query: 194 HYSPPPVYHSP----PPPKKHY---VYKSPPP----PVKHYSPPPVYHSP----PPPKKH 328
           H  PPP++H P    PPP  H+    +  PPP    P +H  PPP++H P    PPP  H
Sbjct: 258 HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMH 317

Query: 329 Y 331
           +
Sbjct: 318 H 318

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 44/131 (33%), Positives = 57/131 (43%), Gaps = 21/131 (16%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS-P 178
           KS P P        V+     PK H           H+ P    H PPPP  H   +  P
Sbjct: 168 KSHPKP----EDDSVFFDDERPKHHEFDDEDREFPAHHEPGE--HMPPPPMHHKPGEHMP 221

Query: 179 PPPV-----KHYSPPPVYHSP----PPPKKHY---VYKSPPP----PVKHYSPPPVYHSP 310
           PPP+     +H  PPP++H P    PPP  H+    +  PPP    P +H  PPP++H P
Sbjct: 222 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 281

Query: 311 ----PPPKKHY 331
               PPP  H+
Sbjct: 282 GEHMPPPPMHH 292

[153][TOP]
>UniRef100_A8MQW1 Uncharacterized protein At1g44191.1 n=1 Tax=Arabidopsis thaliana
           RepID=A8MQW1_ARATH
          Length = 359

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 59/109 (54%), Positives = 60/109 (55%), Gaps = 2/109 (1%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           KSPPPP K  SPPP+   SPPPPK      SPPP  K   PPP   SPPP  K    KSP
Sbjct: 115 KSPPPP-KPSSPPPIPKKSPPPPKP----SSPPPTPKKSPPPPKPSSPPPSPK----KSP 165

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPK 322
           PPP    SPP     PP PK     KSPP P K  SPPP    SPPPPK
Sbjct: 166 PPPKPSPSPPKPSTPPPTPK-----KSPPSPPKPSSPPPSPKKSPPPPK 209

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 56/114 (49%), Positives = 56/114 (49%), Gaps = 7/114 (6%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP     PP    SPPPPK         KSPPPP    SPP     PP PKK    
Sbjct: 131 KSPPPPKPSSPPPTPKKSPPPPKPSSPPPSPKKSPPPPKPSPSPPKPSTPPPTPKK---- 186

Query: 170 KSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSP--PPPVKHYSPPPVYHSPPPPK 322
            SPP P K  SPPP    SPPPPK       P  PPP    SPPP   S PPPK
Sbjct: 187 -SPPSPPKPSSPPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPPPPKPSQPPPK 239

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/107 (48%), Positives = 55/107 (51%), Gaps = 1/107 (0%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPP 184
           PP P+     PP     PPP+     KSPPPP K  SPPP+   SPPPPK      SPPP
Sbjct: 91  PPSPLSPKKSPPSPKPSPPPRT--PKKSPPPP-KPSSPPPIPKKSPPPPKP----SSPPP 143

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
             K   PPP   SPPP  K    KSPPPP    SPP     PP PKK
Sbjct: 144 TPKKSPPPPKPSSPPPSPK----KSPPPPKPSPSPPKPSTPPPTPKK 186

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 50/110 (45%), Positives = 52/110 (47%), Gaps = 3/110 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSP 178
           KSPPPP    SPP     PP PKK     SPP P K  SPPP    SPPPPK       P
Sbjct: 163 KSPPPPKPSPSPPKPSTPPPTPKK-----SPPSPPKPSSPPPSPKKSPPPPKPSPSPPKP 217

Query: 179 --PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
             PPP    SPPP   S PPPK     + P PP    S  P    P PP+
Sbjct: 218 STPPPTPKKSPPPPKPSQPPPKPSPPRRKPSPPTPKPSTTPPSPKPSPPR 267

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 49/106 (46%), Positives = 49/106 (46%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPP P    SP P   S  PP      KSPP P     P     SPPPPK      SPPP
Sbjct: 75  SPPHPP---SPKPPTPSSRPPSPLSPKKSPPSPKPSPPPRTPKKSPPPPKP----SSPPP 127

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
             K   PPP   SPPP  K    KSPPPP     PP    SPPPPK
Sbjct: 128 IPKKSPPPPKPSSPPPTPK----KSPPPPKPSSPPPSPKKSPPPPK 169

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/106 (44%), Positives = 50/106 (47%), Gaps = 3/106 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSP--PPPVKHYSPPPVYHSPPPPKKHYVYK 172
           KSPP P K  SPPP    SPPPPK       P  PPP    SPPP   S PPPK     +
Sbjct: 186 KSPPSPPKPSSPPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPPPPKPSQPPPKPSPPRR 245

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 310
            P PP    S  P    P PP+     KSPPPP    +P P Y  P
Sbjct: 246 KPSPPTPKPSTTPPSPKPSPPRP-TPKKSPPPPT---TPSPSYQDP 287

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/107 (43%), Positives = 51/107 (47%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5   SPPPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           +PPP  K    SPP     PP PK     KSPPPP    SPP     PP PK     KSP
Sbjct: 179 TPPPTPKKSPPSPPKPSSPPPSPK-----KSPPPPKPSPSPPKPSTPPPTPK-----KSP 228

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPP K   PPP    P PP++     SPP P    +PP    SPP P
Sbjct: 229 PPP-KPSQPPP---KPSPPRRK---PSPPTPKPSTTPPSPKPSPPRP 268

[154][TOP]
>UniRef100_UPI0000DA36F5 PREDICTED: similar to AAT1-alpha n=1 Tax=Rattus norvegicus
            RepID=UPI0000DA36F5
          Length = 1012

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 50/103 (48%), Positives = 50/103 (48%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPPV    PPPV   PPP     V   PPPPV    PPPV   PPP     V   PPPP
Sbjct: 841  PPPPVSVEPPPPVSDEPPPS----VSDEPPPPVSDEPPPPVSDEPPPS----VSDEPPPP 892

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
            V    PP V   PPP     V   PPPPV    PPPV   PPP
Sbjct: 893  VSDEPPPSVSDEPPPS----VSDEPPPPVSDEPPPPVSDEPPP 931

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 50/104 (48%), Positives = 50/104 (48%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPP V    PPPV   PPPP    V   PPP V    PPPV   PPPP    V   PPP 
Sbjct: 833  PPPSVSDEPPPPVSVEPPPP----VSDEPPPSVSDEPPPPVSDEPPPP----VSDEPPPS 884

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            V    PPPV   PPP     V   PPP V    PPPV   PPPP
Sbjct: 885  VSDEPPPPVSDEPPPS----VSDEPPPSVSDEPPPPVSDEPPPP 924

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 48/104 (46%), Positives = 48/104 (46%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPP V    PP V   PPPP    V   PPPPV    PP V   PPPP    V   PPP 
Sbjct: 897  PPPSVSDEPPPSVSDEPPPP----VSDEPPPPVSDEPPPSVSDEPPPP----VSDEPPPS 948

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            V    P PV   PPP     V   PPP V    PPPV   PPPP
Sbjct: 949  VSDEPPLPVSDEPPPS----VSDEPPPSVSDEPPPPVSDEPPPP 988

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 47/102 (46%), Positives = 47/102 (46%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPP V    PPPV   PPPP    V   PPP V    PPPV   PPP     V   PP P
Sbjct: 905  PPPSVSDEPPPPVSDEPPPP----VSDEPPPSVSDEPPPPVSDEPPPS----VSDEPPLP 956

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
            V    PP V   PPP     V   PPPPV    PPPV   PP
Sbjct: 957  VSDEPPPSVSDEPPPS----VSDEPPPPVSDEPPPPVSDEPP 994

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/105 (41%), Positives = 46/105 (43%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            S  P +     P +  S  PP    V   PPP V    PP V   PPPP    V   PPP
Sbjct: 798  SDAPTLSVSDMPALTVSDAPPIS--VSDEPPPSVSDKPPPSVSDEPPPP----VSVEPPP 851

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PV    PP V   PPPP    V   PPPPV    PP V   PPPP
Sbjct: 852  PVSDEPPPSVSDEPPPP----VSDEPPPPVSDEPPPSVSDEPPPP 892

[155][TOP]
>UniRef100_B9RQU4 Putative uncharacterized protein n=1 Tax=Ricinus communis
           RepID=B9RQU4_RICCO
          Length = 154

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 59/131 (45%), Positives = 65/131 (49%), Gaps = 25/131 (19%)
 Frame = +2

Query: 2   KSPPPPV--KHYSPPPVYH----SPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKK 157
           +SPPPP   K+ SP P +H    +P  P   Y YKSPPPP      PPVY   SPPPP  
Sbjct: 32  RSPPPPFHYKYESPSPPHHKCKHTPLAPLPFYTYKSPPPPPS----PPVYEHKSPPPPPF 87

Query: 158 HYVYKSPPPPVKHYSPPPVY-HSPPPPKKHY----------------VYKSPPPPVKHYS 286
            Y Y SPP       PPPVY + PPPP KH+                 YKSPPPP K   
Sbjct: 88  VYKYWSPP-------PPPVYRYEPPPPPKHHHHHHHHKHKWSPYPYVTYKSPPPPPKQEY 140

Query: 287 PPPVYHSPPPP 319
           P   Y SP PP
Sbjct: 141 PVYHYISPAPP 151

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/98 (51%), Positives = 55/98 (56%), Gaps = 3/98 (3%)
 Frame = +2

Query: 47  YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-- 220
           Y SPPPP  HY Y+SP PP  H+      H+P  P   Y YKSPPPP      PPVY   
Sbjct: 31  YRSPPPPF-HYKYESPSPP--HHK---CKHTPLAPLPFYTYKSPPPPPS----PPVYEHK 80

Query: 221 SPPPPKKHYVYKSPPPPVKHYSPPPVY-HSPPPPKKHY 331
           SPPPP   Y Y SPPPP       PVY + PPPP KH+
Sbjct: 81  SPPPPPFVYKYWSPPPP-------PVYRYEPPPPPKHH 111

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 34/70 (48%), Positives = 38/70 (54%)
 Frame = +2

Query: 131 YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 310
           Y SPPPP  HY Y+SP PP  H+      H+P  P   Y YKSPPPP      PPVY   
Sbjct: 31  YRSPPPPF-HYKYESPSPP--HHK---CKHTPLAPLPFYTYKSPPPPPS----PPVYEHK 80

Query: 311 PPPKKHYVYK 340
            PP   +VYK
Sbjct: 81  SPPPPPFVYK 90

[156][TOP]
>UniRef100_Q9SPM0 Extensin-like protein n=1 Tax=Zea mays RepID=Q9SPM0_MAIZE
          Length = 1016

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/107 (49%), Positives = 55/107 (51%), Gaps = 3/107 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPP     SP P   SPPPP       SPPPP+K   PP    SPPP     + KSPPP
Sbjct: 544 SPPPEAPVSSPQPQVKSPPPPAP---VASPPPPMKSPPPPARVASPPP-----LMKSPPP 595

Query: 185 PVKHYSPPPVYHSPPPP---KKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           P    SPP    SPPPP         KSPPPPV   SPPP   SPPP
Sbjct: 596 PAPVASPPQPLKSPPPPVLWLSTPSVKSPPPPVPVASPPPPVKSPPP 642

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 56/121 (46%), Positives = 59/121 (48%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKK----HYVYKSPPPPVKHYSPPPVYHSPPPP---KKH 160
           KSPPPP    SPPP   SPPPP +      + KSPPPP    SPP    SPPPP      
Sbjct: 559 KSPPPPAPVASPPPPMKSPPPPARVASPPPLMKSPPPPAPVASPPQPLKSPPPPVLWLST 618

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK--------HYSPPPVYHSPPP 316
              KSPPPPV   SPPP   SPPP        SP PPVK          +PPP    P P
Sbjct: 619 PSVKSPPPPVPVASPPPPVKSPPPLAP---VSSPSPPVKLPPLPAPGKSTPPPEEEKPTP 675

Query: 317 P 319
           P
Sbjct: 676 P 676

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 58/113 (51%), Positives = 61/113 (53%), Gaps = 6/113 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP----KKHYVYK 172
           SP P VK   PP    SPPPP      KSPPPP +  SPPP+  SPPPP          K
Sbjct: 553 SPQPQVKSPPPPAPVASPPPP-----MKSPPPPARVASPPPLMKSPPPPAPVASPPQPLK 607

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKK 325
           SPPPPV   S P V  SPPPP       SPPPPVK  SPPP+    SP PP K
Sbjct: 608 SPPPPVLWLSTPSV-KSPPPP---VPVASPPPPVK--SPPPLAPVSSPSPPVK 654

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 60/119 (50%), Positives = 63/119 (52%), Gaps = 12/119 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPP----KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           KSPPPP +  SPPP+  SPPPP          KSPPPPV   S P V  SPPPP      
Sbjct: 575 KSPPPPARVASPPPLMKSPPPPAPVASPPQPLKSPPPPVLWLSTPSV-KSPPPP---VPV 630

Query: 170 KSPPPPVKHYSPPPV--YHSPPPPKK----HYVYKSPPPP--VKHYSPPPVYHSPPPPK 322
            SPPPPVK  SPPP+    SP PP K        KS PPP   K   P PV  SPPP K
Sbjct: 631 ASPPPPVK--SPPPLAPVSSPSPPVKLPPLPAPGKSTPPPEEEKPTPPTPVKSSPPPEK 687

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 53/110 (48%), Positives = 55/110 (50%), Gaps = 5/110 (4%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYK 172
            S PPP     PPP   S PPP+     KS PPP    SPPP   SPPPP          K
Sbjct: 863  SSPPPTPKPLPPPAPVSLPPPE----VKSSPPPAPISSPPPPAKSPPPPAPMSSLPPPVK 918

Query: 173  SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-PPPVYHSPPPP 319
            SPPPP    SPPP   SPPPP    +   PP PVK  S PPP   S PPP
Sbjct: 919  SPPPPAPVSSPPPPMKSPPPPAP--ISSPPPAPVKPPSLPPPAPVSSPPP 966

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/108 (47%), Positives = 52/108 (48%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KS PPP    SPPP   SPPPP       S PPPVK   PP    SPPPP K     SPP
Sbjct: 886  KSSPPPAPISSPPPPAKSPPPPAP---MSSLPPPVKSPPPPAPVSSPPPPMK-----SPP 937

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            PP    SPPP    PP         S PPP    SPPP   S PP K+
Sbjct: 938  PPAPISSPPPAPVKPP---------SLPPPAPVSSPPPAVTSAPPKKE 976

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 48/116 (41%), Positives = 51/116 (43%), Gaps = 8/116 (6%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP----PKKHYVYKSPPPPVKHYSPPPVYHSPPP----PKK 157
            K+ PPP    SPPP   S PP         V K+ PPP    SPPP   S PP       
Sbjct: 790  KTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSP 849

Query: 158  HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
              V K+ PPP    SPPP     PPP        PPP VK   PP    SPPPP K
Sbjct: 850  PQVEKTSPPPAPVSSPPPTPKPLPPPAP---VSLPPPEVKSSPPPAPISSPPPPAK 902

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 51/125 (40%), Positives = 56/125 (44%), Gaps = 19/125 (15%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKK----HYVYKSPPPPVKHYSPPPVYHSPP------PP 151
            KS PPP K   PP +  SPPP +K        K PPP      PPP   SPP      PP
Sbjct: 680  KSSPPPEKSLPPPTLTTSPPPQEKPTPPSTPSKPPPPSPVETLPPPSKSSPPEEPVSSPP 739

Query: 152  KKHYVYKSP-----PPPVKHYSPPPVYHSPPPPKKH----YVYKSPPPPVKHYSPPPVYH 304
            +       P     PPP+K  SPPPV  S PPP           S PP V+  SPPP   
Sbjct: 740  QAPKSSSPPAPVSSPPPLKS-SPPPVPESSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPV 798

Query: 305  SPPPP 319
            S PPP
Sbjct: 799  SSPPP 803

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 49/120 (40%), Positives = 52/120 (43%), Gaps = 16/120 (13%)
 Frame = +2

Query: 8   PPPPVKHYSPP----PVYHSPPPPKKHYVYKSPPP--PVKHYSPPPVYHSPPP---PKKH 160
           P PPV   SPP    P     PP +      S PP  PVK   PP     PPP   P   
Sbjct: 480 PTPPVPAKSPPGTSPPASRGAPPLQAQPPAASSPPATPVKSSPPPAAVVLPPPAKTPSPP 539

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-------YSPPPVYHSPPPP 319
               SPPP     SP P   SPPPP       SPPPP+K         SPPP+  SPPPP
Sbjct: 540 APVASPPPEAPVSSPQPQVKSPPPPAP---VASPPPPMKSPPPPARVASPPPLMKSPPPP 596

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 50/109 (45%), Positives = 54/109 (49%), Gaps = 2/109 (1%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPKKHYVYKSPP 181
           SPP      SPPP     PPP K     +P PP    SPPP    S P P+     KSPP
Sbjct: 512 SPPATPVKSSPPPAAVVLPPPAK-----TPSPPAPVASPPPEAPVSSPQPQ----VKSPP 562

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKK 325
           PP    SPPP   SPPPP +     SPPP +K   PP PV  SPP P K
Sbjct: 563 PPAPVASPPPPMKSPPPPAR---VASPPPLMKSPPPPAPVA-SPPQPLK 607

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 46/110 (41%), Positives = 52/110 (47%), Gaps = 5/110 (4%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPP-----PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 166
            K PPP      PPP   SPP      P +     SPP PV   SPPP+  SPPP  +   
Sbjct: 712  KPPPPSPVETLPPPSKSSPPEEPVSSPPQAPKSSSPPAPVS--SPPPLKSSPPPVPE--- 766

Query: 167  YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
              SPPP  K  S PP+     PP+   V K+ PPP    SPPP   S PP
Sbjct: 767  -SSPPPTPK--SSPPLAPVSSPPQ---VEKTSPPPAPVSSPPPTPKSSPP 810

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 45/110 (40%), Positives = 48/110 (43%), Gaps = 4/110 (3%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPPP    SPPP   SPPPP    +   PP PV    PP    S PPP       SPP
Sbjct: 918  KSPPPPAPVSSPPPPMKSPPPPAP--ISSPPPAPV---KPP----SLPPPAP---VSSPP 965

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV----YHSPPPP 319
            P V    P     S  PP +      PPP       PP+    Y SPPPP
Sbjct: 966  PAVTSAPPKKEEDSTAPPAE----ALPPPSFNDIILPPIMANKYASPPPP 1011

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 37/91 (40%), Positives = 40/91 (43%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPPP    SPPP    PP         S PPP    SPPP   S PP K+     S  
Sbjct: 934  KSPPPPAPISSPPPAPVKPP---------SLPPPAPVSSPPPAVTSAPPKKEE---DSTA 981

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
            PP +   PP       PP     Y SPPPP+
Sbjct: 982  PPAEALPPPSFNDIILPPIMANKYASPPPPL 1012

[157][TOP]
>UniRef100_Q018S3 Oxalate/formate antiporter (ISS) (Fragment) n=1 Tax=Ostreococcus
           tauri RepID=Q018S3_OSTTA
          Length = 818

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 48/118 (40%), Positives = 60/118 (50%), Gaps = 11/118 (9%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPPVYHSPPPPKKHYV 166
           + PPPP +  SPPP +H   PP  H+ +  PP     PP  H+ PPP+ H  PPP  H  
Sbjct: 648 RGPPPPRRRGSPPPRHHRGSPP--HHQHGPPPDHGGPPPHHHHGPPPLDHRGPPPHHH-- 703

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPK 322
               PPP  H+ PPP  H PPPP  +        Y S P P+  Y+PPP     PPP+
Sbjct: 704 ---GPPPPHHHGPPPHQHGPPPPPSYEQMVPPTAYPSSPYPM--YAPPPEPPRAPPPE 756

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/109 (40%), Positives = 53/109 (48%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +  PP  +  SPP  +  PPPP++     SPPP     SPP   H PPP          P
Sbjct: 632 RGSPPRRRRRSPPRHHRGPPPPRRR---GSPPPRHHRGSPPHHQHGPPPDH------GGP 682

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PP  H+ PPP+ H  PPP  H      PPP  H+ PPP  H PPPP  +
Sbjct: 683 PPHHHHGPPPLDHRGPPPHHH-----GPPPPHHHGPPPHQHGPPPPPSY 726

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 37/102 (36%), Positives = 46/102 (45%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP+ H  PPP +H PPPP              H+ PPP  H PPPP  +   +  PP  
Sbjct: 690 PPPLDHRGPPPHHHGPPPP-------------HHHGPPPHQHGPPPPPSY--EQMVPPTA 734

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
              SP P+Y  PP P +      PP   +  +PPPV     P
Sbjct: 735 YPSSPYPMYAPPPEPPR----APPPESPRSMAPPPVTSGAVP 772

[158][TOP]
>UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH
          Length = 470

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 56/111 (50%), Positives = 59/111 (53%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP    PPPP        PPPP     PPP    PPPP   YVY SPPP
Sbjct: 378 SPPPP-----PPPPPPPPPPP--------PPPP-----PPP----PPPPPPPYVYPSPPP 415

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           P    SPPP  + PPPP   YVY  PPPP    SPP VY  PPP  + Y+Y
Sbjct: 416 PPP--SPPPYVYPPPPPP--YVY--PPPP----SPPYVYPPPPPSPQPYMY 456

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 52/97 (53%), Positives = 54/97 (55%), Gaps = 5/97 (5%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPKKHYVYKSPPP 184
           PPPP     PPP    PPPP   YVY SPPPP    SPPP VY  PPPP   YVY  PPP
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP--SPPPYVYPPPPPP---YVY--PPP 437

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPP----PPVKHY 283
           P    SPP VY  PPP  + Y+Y SPP    P   HY
Sbjct: 438 P----SPPYVYPPPPPSPQPYMYPSPPCNDLPTPVHY 470

[159][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/105 (49%), Positives = 53/105 (50%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP P   SPPPP       SPPPP    SP   Y SPPPP    V   PPP
Sbjct: 479 SPPPP----SPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEV---PPP 531

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SP   Y SPPPP  H+    PPPP    SP   Y SPPPP
Sbjct: 532 PYYEVSPEDRYLSPPPPPVHH--DPPPPPYYEVSPEDRYLSPPPP 574

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/109 (49%), Positives = 55/109 (50%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP    SP P   SPPPP       SPPP
Sbjct: 457 SPPPP----SPPPPSPSPPPPSPPP--PSPPPP----SPSPPPPSPPPPSPPPPSPSPPP 506

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
           P    SP   Y SPPPP    V   PPPP    SP   Y SPPPP  H+
Sbjct: 507 PYYEVSPEERYLSPPPPAYTEV---PPPPYYEVSPEDRYLSPPPPPVHH 552

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/111 (48%), Positives = 56/111 (50%), Gaps = 6/111 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SP   Y SPPPP    V   PPPP    SP   Y SPPPP  H+    PPP
Sbjct: 503 SPPPPYYEVSPEERYLSPPPPAYTEV---PPPPYYEVSPEDRYLSPPPPPVHH--DPPPP 557

Query: 185 PVKHYSPPPVYHSPPPPKK----HYVYKSPPPPVKHYSPPPV--YHSPPPP 319
           P    SP   Y SPPPP       Y Y SPPPP +     PV  Y SPPPP
Sbjct: 558 PYYEVSPEDRYLSPPPPSPASLPKYDYSSPPPP-RALPKLPVYDYSSPPPP 607

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 56/105 (53%), Positives = 56/105 (53%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP    SPPP   SPPPP       SPPP
Sbjct: 413 SPPPP----SPPPPSPSPPPP-------SPPPP----SPPPPSPSPPPPSP--PPPSPPP 455

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP   SPPPP       SPPPP    SPPP   SPPPP
Sbjct: 456 P----SPPP--PSPPPPSPSPPPPSPPPP----SPPPPSPSPPPP 490

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 56/105 (53%), Positives = 56/105 (53%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP    SPPP   SPPPP       SPPP
Sbjct: 430 SPPPP----SPPPPSPSPPPP-------SPPPP----SPPP--PSPPPPSPPPPSPSPPP 472

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP   SPPPP       SPPPP    SPPP   SPPPP
Sbjct: 473 P----SPPP--PSPPPPSPSPPPPSPPPP----SPPPPSPSPPPP 507

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/93 (50%), Positives = 47/93 (50%), Gaps = 1/93 (1%)
 Frame = +2

Query: 44  VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 223
           V  SPP P       SPPPP    SPPP   SPPPP       SPPPP    SPPP   S
Sbjct: 403 VLPSPPLPPP-----SPPPP----SPPPPSPSPPPP-------SPPPP----SPPPPSPS 442

Query: 224 PPPPKKHYVYKSPPPP-VKHYSPPPVYHSPPPP 319
           PPPP       SPPPP     SPPP   SPPPP
Sbjct: 443 PPPPSP--PPPSPPPPSPPPPSPPPPSPSPPPP 473

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/85 (42%), Positives = 40/85 (47%), Gaps = 19/85 (22%)
 Frame = +2

Query: 8   PPPPVKHYSP---------PPVYHSPPPPKKHYV-----YKSPPPPVKHYSPPPVYHSPP 145
           PPPP    SP         PPV+H PPPP  + V     Y SPPPP     P   Y SPP
Sbjct: 529 PPPPYYEVSPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRYLSPPPPSPASLPKYDYSSPP 588

Query: 146 PPKKH-----YVYKSPPPPVKHYSP 205
           PP+       Y Y SPPPP    +P
Sbjct: 589 PPRALPKLPVYDYSSPPPPAAGSTP 613

[160][TOP]
>UniRef100_C1PGW1 Tracheary element differentiation-related 7A n=1 Tax=Zinnia
           violacea RepID=C1PGW1_ZINEL
          Length = 300

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/107 (42%), Positives = 53/107 (49%), Gaps = 3/107 (2%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSP---PPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           PPP   H   PP +  PPP   H V+  P   PPP  H+ PPP    PPP   H     P
Sbjct: 77  PPPSPPHPVSPPPHTVPPPSPPHPVFPPPHTVPPPSPHFVPPPPNMVPPPSPPHA--NPP 134

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPP  H  PPP +  PPPP   ++    PPP    SPPP +  PPPP
Sbjct: 135 PPPPPHSVPPPPHTVPPPPPPPHII---PPPAHALSPPPPHIIPPPP 178

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 48/117 (41%), Positives = 56/117 (47%), Gaps = 8/117 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           PPP   H  PPP++  PPP   H V    +  PPP   H   PP +  PPP   H V+  
Sbjct: 45  PPPSPPHSVPPPLHPVPPPSPPHPVSPPPHTVPPPSPPHPVSPPPHTVPPPSPPHPVFPP 104

Query: 176 P---PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPKKHYV 334
           P   PPP  H+ PPP    PPP   H     PPPP  H  PPP +   PPPP  H +
Sbjct: 105 PHTVPPPSPHFVPPPPNMVPPPSPPHA--NPPPPPPPHSVPPPPHTVPPPPPPPHII 159

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 46/118 (38%), Positives = 55/118 (46%), Gaps = 8/118 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY-----VYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           S PPP   +S PP  H  PPP   +      +  PPP   H   PP +  PPP   H V+
Sbjct: 43  SVPPPSPPHSVPPPLHPVPPPSPPHPVSPPPHTVPPPSPPHPVSPPPHTVPPPSPPHPVF 102

Query: 170 KSP---PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
             P   PPP  H+ PPP    PPP   H     PPPP  H  PPP +  PPPP   ++
Sbjct: 103 PPPHTVPPPSPHFVPPPPNMVPPPSPPH--ANPPPPPPPHSVPPPPHTVPPPPPPPHI 158

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 45/114 (39%), Positives = 54/114 (47%), Gaps = 7/114 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV----YKS 175
           PP P    +PPP + SPPP      +  PPP   H  PPP++  PPP   H V    +  
Sbjct: 23  PPAPTTPSTPPPHFISPPP------HSVPPPSPPHSVPPPLHPVPPPSPPHPVSPPPHTV 76

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSP---PPPVKHYSPPPVYHSPPPPKKH 328
           PPP   H   PP +  PPP   H V+  P   PPP  H+ PPP    PPP   H
Sbjct: 77  PPPSPPHPVSPPPHTVPPPSPPHPVFPPPHTVPPPSPHFVPPPPNMVPPPSPPH 130

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/91 (43%), Positives = 44/91 (48%), Gaps = 1/91 (1%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP  H+ PPP    PPP   H     PPPP  H  PPP +  PPPP        PPP  
Sbjct: 109 PPPSPHFVPPPPNMVPPPSPPHA--NPPPPPPPHSVPPPPHTVPPPP--------PPP-- 156

Query: 191 KHYSPPPVYH-SPPPPKKHYVYKSPPPPVKH 280
            H  PPP +  SPPPP  H +   PP P  H
Sbjct: 157 -HIIPPPAHALSPPPP--HIIPPPPPSPSNH 184

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 29/64 (45%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPKKHYVYKSPPP 184
           PPPP  H  PPP +  PPPP        PPP   H  PPP +  SPPPP  H +   PP 
Sbjct: 134 PPPPPPHSVPPPPHTVPPPP--------PPP---HIIPPPAHALSPPPP--HIIPPPPPS 180

Query: 185 PVKH 196
           P  H
Sbjct: 181 PSNH 184

[161][TOP]
>UniRef100_Q581B0 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei
           RepID=Q581B0_9TRYP
          Length = 370

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/114 (45%), Positives = 56/114 (49%), Gaps = 8/114 (7%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVY 169
           K PPPP  +  PPP   Y  PPPP     Y  PPPP  +  PPP   Y  PPPP     Y
Sbjct: 85  KQPPPPAGYGQPPPPAGYGQPPPPAG---YGQPPPPAGYGQPPPPAGYGQPPPPAG---Y 138

Query: 170 KSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPP 319
             PPPP  +  PPP   Y  PPPP     Y  PPPP  +  PPP   Y  PPPP
Sbjct: 139 GQPPPPAGYGQPPPPAGYGQPPPPAG---YGQPPPPAGYGQPPPPAGYGQPPPP 189

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 49/110 (44%), Positives = 53/110 (48%), Gaps = 8/110 (7%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKS 175
           PPPP  +  PPP   Y  PPPP     Y  PPPP  +  PPP   Y  PPPP     Y  
Sbjct: 96  PPPPAGYGQPPPPAGYGQPPPPAG---YGQPPPPAGYGQPPPPAGYGQPPPPAG---YGQ 149

Query: 176 PPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPP 313
           PPPP  +  PPP   Y  PPPP     Y  PPPP  +  PPP   Y  PP
Sbjct: 150 PPPPAGYGQPPPPAGYGQPPPPAG---YGQPPPPAGYGQPPPPAGYGQPP 196

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/108 (43%), Positives = 52/108 (48%), Gaps = 6/108 (5%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKS 175
           PPPP  +  PPP   Y  PPPP     Y  PPPP  +  PPP   Y  PPPP     Y  
Sbjct: 105 PPPPAGYGQPPPPAGYGQPPPPAG---YGQPPPPAGYGQPPPPAGYGQPPPPAG---YGQ 158

Query: 176 PPPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
           PPPP  +  PPP   Y  PPPP     Y  PPPP  +  PP   + PP
Sbjct: 159 PPPPAGYGQPPPPAGYGQPPPPAG---YGQPPPPAGYGQPPCGVYKPP 203

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/111 (44%), Positives = 52/111 (46%), Gaps = 7/111 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSP 178
           PP       PPP  Y  PPPP     Y  PPPP  +  PPP   Y  PPPP     Y  P
Sbjct: 79  PPTDNGKQPPPPAGYGQPPPPAG---YGQPPPPAGYGQPPPPAGYGQPPPPAG---YGQP 132

Query: 179 PPPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPP 319
           PPP  +  PPP   Y  PPPP     Y  PPPP  +  PPP   Y  PPPP
Sbjct: 133 PPPAGYGQPPPPAGYGQPPPPAG---YGQPPPPAGYGQPPPPAGYGQPPPP 180

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 45/113 (39%), Positives = 52/113 (46%), Gaps = 7/113 (6%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHS--PPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPKKHYVYKSPP 181
           P +   + PP  +   PPPP     Y  PPPP  +  PPP   Y  PPPP     Y  PP
Sbjct: 71  PALNVLAGPPTDNGKQPPPPAG---YGQPPPPAGYGQPPPPAGYGQPPPPAG---YGQPP 124

Query: 182 PPVKHYSPPPV--YHSPPPPKKHYVYKSPPPPVKH-YSPPPVYHSPPPPKKHY 331
           PP  +  PPP   Y  PPPP     Y  PPPP  +   PPP  +  PPP   Y
Sbjct: 125 PPAGYGQPPPPAGYGQPPPPAG---YGQPPPPAGYGQPPPPAGYGQPPPPAGY 174

[162][TOP]
>UniRef100_Q9FLQ7 Formin-like protein 20 n=1 Tax=Arabidopsis thaliana RepID=FH20_ARATH
          Length = 1615

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 54/110 (49%), Positives = 55/110 (50%), Gaps = 2/110 (1%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP     PPP Y SPPPP        PPPP  + SPPP    PPPP   Y    PPP
Sbjct: 942  SPPPPPP---PPPSYGSPPPP--------PPPPPSYGSPPP----PPPPPPGYGSPPPPP 986

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKH 328
            P     PPP Y SPPPP        PPPP  H S  PPP    PPPP  H
Sbjct: 987  P-----PPPSYGSPPPP--------PPPPFSHVSSIPPP----PPPPPMH 1019

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 51/111 (45%), Positives = 55/111 (49%), Gaps = 6/111 (5%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            +P PPVK   PPP    PPPP  +      PPP  + SPPP    PPPP   Y    PPP
Sbjct: 909  APSPPVKTAPPPP----PPPPFSNAHSVLSPPPPSYGSPPP----PPPPPPSYGSPPPPP 960

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS------PPPVYHSPPPP 319
            P     PPP Y SPPPP        PPPP  + S      PPP Y SPPPP
Sbjct: 961  P-----PPPSYGSPPPP--------PPPPPGYGSPPPPPPPPPSYGSPPPP 998

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/107 (42%), Positives = 53/107 (49%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP  + SPPP    PPPP  +     PPPP   Y  PP    PPPP   +V   PPPP
Sbjct: 960  PPPPPSYGSPPP---PPPPPPGYGSPPPPPPPPPSYGSPP---PPPPPPFSHVSSIPPPP 1013

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
                 PPP++   PPP        PPPP+   +PPP    PPPP  H
Sbjct: 1014 ----PPPPMHGGAPPP-------PPPPPMHGGAPPP----PPPPPMH 1045

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/110 (45%), Positives = 55/110 (50%), Gaps = 2/110 (1%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSP 178
            SPPPP     PPP Y SPPPP        PPPP  H S  PPP    PPPP  H    +P
Sbjct: 981  SPPPPPP---PPPSYGSPPPP--------PPPPFSHVSSIPPP----PPPPPMH--GGAP 1023

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
            PPP     PPP++   PPP        PPPP+   +PPP    PPPP  H
Sbjct: 1024 PPP----PPPPMHGGAPPP-------PPPPPMHGGAPPP----PPPPPMH 1058

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/115 (39%), Positives = 54/115 (46%), Gaps = 11/115 (9%)
 Frame = +2

Query: 8    PPPPVKHYS------PPPVYHS-----PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 154
            PPPP  H        PPP++       PPPP        PPPP  H   PP    PPPP 
Sbjct: 1013 PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPP---PPPPPM 1069

Query: 155  KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                   PPPP++  +PPP    PPPP +      PPPP++  +PPP    PPPP
Sbjct: 1070 FGGAQPPPPPPMRGGAPPP----PPPPMRGGAPPPPPPPMRGGAPPP----PPPP 1116

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 42/104 (40%), Positives = 54/104 (51%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP++  +PPP    PPPP +      PPPP++  +PPP    PPPP        PPPP
Sbjct: 1077 PPPPMRGGAPPP----PPPPMRGGAPPPPPPPMRGGAPPP----PPPPMHGGAPPPPPPP 1128

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            ++  +PPP     PPP       +PPPP     PPP   +P PP
Sbjct: 1129 MRGGAPPP-----PPPPGGRGPGAPPPP-----PPPGGRAPGPP 1162

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 55/135 (40%), Positives = 57/135 (42%), Gaps = 30/135 (22%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSP-----------PPPKKHYVYKSPPPPVK--------HYSPPP 127
            SPPPP     PPP   SP           PPP   Y   +P P VK            PP
Sbjct: 859  SPPPP-----PPPPPFSPLNTTKANDYILPPPPLPYTSIAPSPSVKILPLHGISSAPSPP 913

Query: 128  VYHSPPPP------KKHYVYKSPPP----PVKHYSPPPVYHS-PPPPKKHYVYKSPPPPV 274
            V  +PPPP        H V   PPP    P     PPP Y S PPPP     Y SPPPP 
Sbjct: 914  VKTAPPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPP 973

Query: 275  KHYSPPPVYHSPPPP 319
                PPP Y SPPPP
Sbjct: 974  ---PPPPGYGSPPPP 985

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 43/106 (40%), Positives = 50/106 (47%), Gaps = 2/106 (1%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP++  +PPP    PPPP +      PPPP+   +PPP    PPPP +      PPPP
Sbjct: 1089 PPPPMRGGAPPP----PPPPMRGGAPPPPPPPMHGGAPPP----PPPPMRGGA-PPPPPP 1139

Query: 188  VKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                 P  PP    PPPP        PPPP     P P    PPPP
Sbjct: 1140 PGGRGPGAPP----PPPPPGGRAPGPPPPP----GPRPPGGGPPPP 1177

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 37/106 (34%), Positives = 39/106 (36%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP+  YS       PPPP        PPPP     P      PPPP        PPPP
Sbjct: 652 PPPPLPTYSHYQTSQLPPPP-------PPPPPFSSERPNSGTVLPPPP-------PPPPP 697

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
                P      PPPP     + S  P      PPP    P PP K
Sbjct: 698 FSSERPNSGTVLPPPPPPPLPFSSERPNSGTVLPPP----PSPPWK 739

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 39/107 (36%), Positives = 43/107 (40%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP    P P   HY     PPP     PPP   S   P    V   PPP
Sbjct: 646 SPPPP-----PPP---PPLPTYSHYQTSQLPPP----PPPPPPFSSERPNSGTVLPPPPP 693

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS--PPPP 319
                 PPP + S  P     +   PPPP+   S  P   +  PPPP
Sbjct: 694 ------PPPPFSSERPNSGTVLPPPPPPPLPFSSERPNSGTVLPPPP 734

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 52/153 (33%), Positives = 57/153 (37%), Gaps = 48/153 (31%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHS---------PPPPKKHYVYKSPPPP---VKHYS----PPPVYH 136
            SPPPP     PPP + S         PPPP        PPPP   V+  S    PPP   
Sbjct: 788  SPPPP----PPPPPFASVRRNSETLLPPPPPP------PPPPFASVRRNSETLLPPP--- 834

Query: 137  SPPPPKKHYVY-------------KSPPPPVKHYSPPPVYHSP-----------PPPKKH 244
             PPPP    +Y              SPPPP     PPP   SP           PPP   
Sbjct: 835  -PPPPPWKSLYASTFETHEACSTSSSPPPP-----PPPPPFSPLNTTKANDYILPPPPLP 888

Query: 245  YVYKSPPPPVK--------HYSPPPVYHSPPPP 319
            Y   +P P VK            PPV  +PPPP
Sbjct: 889  YTSIAPSPSVKILPLHGISSAPSPPVKTAPPPP 921

[163][TOP]
>UniRef100_UPI0001A7B3CA lipid binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B3CA
          Length = 275

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/114 (45%), Positives = 55/114 (48%), Gaps = 6/114 (5%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPP---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           PPPP     PPP    PP   PP   YV   PPP VK   PPP Y  PPPP      K P
Sbjct: 68  PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVK--PPPPPYVKPPPPP---TVKPP 122

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP---PVYHSPPPPKKHY 331
           PPP  +  PPP  ++PPPP      K PPPPV    PP   P    PPPP   Y
Sbjct: 123 PPPTPYTPPPPTPYTPPPP----TVKPPPPPVVTPPPPTPTPEAPCPPPPPTPY 172

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/98 (47%), Positives = 50/98 (51%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K PPPP     PPP    PPPP   YV K PPPP     PPP  ++PPPP     Y  PP
Sbjct: 88  KPPPPPYVKPPPPPTVKPPPPP---YV-KPPPPPTVKPPPPPTPYTPPPPTP---YTPPP 140

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 295
           P VK   PPP   +PPPP        PPPP   Y PPP
Sbjct: 141 PTVK--PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 49/112 (43%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP---PPKKHY 163
           K P  P K   PP   P  H+P PP        PPPP     PPP    PP   PP   Y
Sbjct: 40  KPPKHPAKPPKPPTVKPPTHTPKPPT-----VKPPPPYIPCPPPPYTPKPPTVKPPPPPY 94

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           V   PPP VK   PPP Y  PPPP      K PPPP  +  PPP  ++PPPP
Sbjct: 95  VKPPPPPTVK--PPPPPYVKPPPPP---TVKPPPPPTPYTPPPPTPYTPPPP 141

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/107 (44%), Positives = 51/107 (47%), Gaps = 3/107 (2%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PP VK   PPP Y  PPPP      K PPPP     PPP    PPPP  +    +PPPP 
Sbjct: 84  PPTVK--PPPPPYVKPPPPP---TVKPPPPPYVKPPPPPTVKPPPPPTPY----TPPPPT 134

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPP---PVKHYSPPPVYHSPPPPK 322
            +  PPP    PPPP    V   PPP   P     PPP    PPPPK
Sbjct: 135 PYTPPPPTVKPPPPP----VVTPPPPTPTPEAPCPPPPPTPYPPPPK 177

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 42/94 (44%), Positives = 43/94 (45%), Gaps = 6/94 (6%)
 Frame = +2

Query: 56  PPPPKKHYVYKSPPPPVKHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 226
           PP P  H V K P  P K   PP   P  H+P PP        PPPP     PPP    P
Sbjct: 31  PPKPSPHPV-KPPKHPAKPPKPPTVKPPTHTPKPPT-----VKPPPPYIPCPPPPYTPKP 84

Query: 227 P---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P   PP   YV   PPP VK   PPP Y  PPPP
Sbjct: 85  PTVKPPPPPYVKPPPPPTVK--PPPPPYVKPPPP 116

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 28/63 (44%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSP 178
           K PPPP  +  PPP  ++PPPP      K PPPPV    PP P   +P PP     Y  P
Sbjct: 120 KPPPPPTPYTPPPPTPYTPPPP----TVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175

Query: 179 PPP 187
           P P
Sbjct: 176 PKP 178

[164][TOP]
>UniRef100_UPI0001A7B0BB lipid binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B0BB
          Length = 370

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/114 (45%), Positives = 55/114 (48%), Gaps = 6/114 (5%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPP---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           PPPP     PPP    PP   PP   YV   PPP VK   PPP Y  PPPP      K P
Sbjct: 68  PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVK--PPPPPYVKPPPPP---TVKPP 122

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP---PVYHSPPPPKKHY 331
           PPP  +  PPP  ++PPPP      K PPPPV    PP   P    PPPP   Y
Sbjct: 123 PPPTPYTPPPPTPYTPPPP----TVKPPPPPVVTPPPPTPTPEAPCPPPPPTPY 172

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/98 (47%), Positives = 50/98 (51%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K PPPP     PPP    PPPP   YV K PPPP     PPP  ++PPPP     Y  PP
Sbjct: 88  KPPPPPYVKPPPPPTVKPPPPP---YV-KPPPPPTVKPPPPPTPYTPPPPTP---YTPPP 140

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 295
           P VK   PPP   +PPPP        PPPP   Y PPP
Sbjct: 141 PTVK--PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 49/112 (43%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP---PPKKHY 163
           K P  P K   PP   P  H+P PP        PPPP     PPP    PP   PP   Y
Sbjct: 40  KPPKHPAKPPKPPTVKPPTHTPKPPT-----VKPPPPYIPCPPPPYTPKPPTVKPPPPPY 94

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           V   PPP VK   PPP Y  PPPP      K PPPP  +  PPP  ++PPPP
Sbjct: 95  VKPPPPPTVK--PPPPPYVKPPPPP---TVKPPPPPTPYTPPPPTPYTPPPP 141

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/107 (44%), Positives = 51/107 (47%), Gaps = 3/107 (2%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PP VK   PPP Y  PPPP      K PPPP     PPP    PPPP  +    +PPPP 
Sbjct: 84  PPTVK--PPPPPYVKPPPPP---TVKPPPPPYVKPPPPPTVKPPPPPTPY----TPPPPT 134

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPP---PVKHYSPPPVYHSPPPPK 322
            +  PPP    PPPP    V   PPP   P     PPP    PPPPK
Sbjct: 135 PYTPPPPTVKPPPPP----VVTPPPPTPTPEAPCPPPPPTPYPPPPK 177

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 42/94 (44%), Positives = 43/94 (45%), Gaps = 6/94 (6%)
 Frame = +2

Query: 56  PPPPKKHYVYKSPPPPVKHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 226
           PP P  H V K P  P K   PP   P  H+P PP        PPPP     PPP    P
Sbjct: 31  PPKPSPHPV-KPPKHPAKPPKPPTVKPPTHTPKPPT-----VKPPPPYIPCPPPPYTPKP 84

Query: 227 P---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P   PP   YV   PPP VK   PPP Y  PPPP
Sbjct: 85  PTVKPPPPPYVKPPPPPTVK--PPPPPYVKPPPP 116

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 28/63 (44%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSP 178
           K PPPP  +  PPP  ++PPPP      K PPPPV    PP P   +P PP     Y  P
Sbjct: 120 KPPPPPTPYTPPPPTPYTPPPP----TVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175

Query: 179 PPP 187
           P P
Sbjct: 176 PKP 178

[165][TOP]
>UniRef100_Q2L049 Filamentous hemagglutinin/adhesin n=1 Tax=Bordetella avium 197N
            RepID=Q2L049_BORA1
          Length = 2621

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 58/121 (47%), Positives = 58/121 (47%), Gaps = 16/121 (13%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPKKHYVYK 172
            PPP VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPPK   V  
Sbjct: 2333 PPPKVKKVDPPP---PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP-PPPPPPKVKKVDP 2388

Query: 173  SPPPP------VKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPP 319
             PPPP      VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPP
Sbjct: 2389 PPPPPPPPPPKVKKVDPPPP-PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPP 2447

Query: 320  K 322
            K
Sbjct: 2448 K 2448

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 55/115 (47%), Positives = 55/115 (47%), Gaps = 10/115 (8%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPKKHYVYK 172
            PPP VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPP       
Sbjct: 2379 PPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPP----PPPP------- 2427

Query: 173  SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPK 322
             PPP VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPPK
Sbjct: 2428 -PPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP-PPPPPPK 2480

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 58/119 (48%), Positives = 58/119 (48%), Gaps = 13/119 (10%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP---VKHYSPPPVYHSPPPPKKHYVYKS 175
            SPPPP     PPP    PPPPK   V   PPPP   VK   PPP    PPPPK   V   
Sbjct: 2320 SPPPP-----PPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPP-PPPPPPKVKKVDPP 2373

Query: 176  PPPP-----VKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPK 322
            PPPP     VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPPK
Sbjct: 2374 PPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP-PPPPPPK 2431

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 58/121 (47%), Positives = 58/121 (47%), Gaps = 16/121 (13%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPKKHYVYK 172
            PPP VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPPK   V  
Sbjct: 2347 PPPKVKKVDPPPP-PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDP 2405

Query: 173  SPPPP-----VKHYSPPPVYHSPPPPKKHYVYKSPPPP------VKHYSPPPVYHSPPPP 319
             PPPP     VK   PPP    PPPPK   V   PPPP      VK   PPP    PPPP
Sbjct: 2406 PPPPPPPPPKVKKVDPPPP-PPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPP-PPPPPP 2463

Query: 320  K 322
            K
Sbjct: 2464 K 2464

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/110 (47%), Positives = 52/110 (47%), Gaps = 5/110 (4%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPP VK   PPP    PPPP        PPP VK   PPP    PPPPK   V   PPPP
Sbjct: 2412 PPPKVKKVDPPP----PPPP--------PPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPP 2459

Query: 188  -----VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
                 VK   PPP    PPPP        PPP VK   PPP    PPPPK
Sbjct: 2460 PPPPKVKKVDPPP----PPPP--------PPPKVKKVDPPP--PPPPPPK 2495

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/97 (40%), Positives = 39/97 (40%), Gaps = 5/97 (5%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPKKHYVYK 172
            PPP VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPPK   V K
Sbjct: 2445 PPPKVKKVDPPPP-PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP--PPPPPK---VKK 2498

Query: 173  SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
              PPP            P P  K      P P    Y
Sbjct: 2499 VDPPPKDEVD------GPKPAPKPKAQPRPSPSTARY 2529

[166][TOP]
>UniRef100_Q8GD27 Adhesin FhaB n=1 Tax=Bordetella avium RepID=Q8GD27_BORAV
          Length = 2621

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 58/121 (47%), Positives = 58/121 (47%), Gaps = 16/121 (13%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPKKHYVYK 172
            PPP VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPPK   V  
Sbjct: 2333 PPPKVKKVDPPP---PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP-PPPPPPKVKKVDP 2388

Query: 173  SPPPP------VKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPP 319
             PPPP      VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPP
Sbjct: 2389 PPPPPPPPPPKVKKVDPPPP-PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPP 2447

Query: 320  K 322
            K
Sbjct: 2448 K 2448

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 55/115 (47%), Positives = 55/115 (47%), Gaps = 10/115 (8%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPKKHYVYK 172
            PPP VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPP       
Sbjct: 2379 PPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPP----PPPP------- 2427

Query: 173  SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPK 322
             PPP VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPPK
Sbjct: 2428 -PPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP-PPPPPPK 2480

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 58/119 (48%), Positives = 58/119 (48%), Gaps = 13/119 (10%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP---VKHYSPPPVYHSPPPPKKHYVYKS 175
            SPPPP     PPP    PPPPK   V   PPPP   VK   PPP    PPPPK   V   
Sbjct: 2320 SPPPP-----PPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPP-PPPPPPKVKKVDPP 2373

Query: 176  PPPP-----VKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPK 322
            PPPP     VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPPK
Sbjct: 2374 PPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP-PPPPPPK 2431

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 58/121 (47%), Positives = 58/121 (47%), Gaps = 16/121 (13%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPKKHYVYK 172
            PPP VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPPK   V  
Sbjct: 2347 PPPKVKKVDPPPP-PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDP 2405

Query: 173  SPPPP-----VKHYSPPPVYHSPPPPKKHYVYKSPPPP------VKHYSPPPVYHSPPPP 319
             PPPP     VK   PPP    PPPPK   V   PPPP      VK   PPP    PPPP
Sbjct: 2406 PPPPPPPPPKVKKVDPPPP-PPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPP-PPPPPP 2463

Query: 320  K 322
            K
Sbjct: 2464 K 2464

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/110 (47%), Positives = 52/110 (47%), Gaps = 5/110 (4%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPP VK   PPP    PPPP        PPP VK   PPP    PPPPK   V   PPPP
Sbjct: 2412 PPPKVKKVDPPP----PPPP--------PPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPP 2459

Query: 188  -----VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
                 VK   PPP    PPPP        PPP VK   PPP    PPPPK
Sbjct: 2460 PPPPKVKKVDPPP----PPPP--------PPPKVKKVDPPP--PPPPPPK 2495

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/97 (40%), Positives = 39/97 (40%), Gaps = 5/97 (5%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-----VKHYSPPPVYHSPPPPKKHYVYK 172
            PPP VK   PPP    PPPPK   V   PPPP     VK   PPP    PPPPK   V K
Sbjct: 2445 PPPKVKKVDPPPP-PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP--PPPPPK---VKK 2498

Query: 173  SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
              PPP            P P  K      P P    Y
Sbjct: 2499 VDPPPKDEVD------GPKPAPKPKAQPRPSPSTARY 2529

[167][TOP]
>UniRef100_Q9FUR7 ENOD2 (Fragment) n=1 Tax=Styphnolobium japonicum RepID=Q9FUR7_SOPJA
          Length = 269

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 55/139 (39%), Positives = 63/139 (45%), Gaps = 28/139 (20%)
 Frame = +2

Query: 8   PPP---PVKHYSPPPVYH-----SPPPPKKHYVYKSPPP---PVKHYSPPPVY-----HS 139
           PPP   P  H  PPPVY       PPP  +   ++ PPP   P  H  PPPVY       
Sbjct: 65  PPPAYQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHEK 124

Query: 140 PPPPKKHYVYKSPPP---PVKHYSPPPVYHSPPPPKKHYVYKSPP---------PPVKHY 283
           PPP  +   ++ PPP   P  H  PPPVY  PP  K   VY+ PP          P  H 
Sbjct: 125 PPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHV 184

Query: 284 SPPPVYHSPPPPKKHYVYK 340
            PPPVY  PP  K   VY+
Sbjct: 185 KPPPVYQPPPHEKPPPVYQ 203

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 59/143 (41%), Positives = 62/143 (43%), Gaps = 31/143 (21%)
 Frame = +2

Query: 2   KSPP--PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           K PP  PP  H  PPPV H PPP +K      PPP VK   PPPVY  PP  K   VY+ 
Sbjct: 112 KPPPVYPPPHHEKPPPV-HQPPPHEKPPPEYQPPPHVK---PPPVYQPPPHVKPPPVYQP 167

Query: 176 PP---------PPVKHYSPPPVYHSPPPPKKHYVYKSP----PPPV-------------- 274
           PP          P  H  PPPVY  PP  K   VY+ P    PPPV              
Sbjct: 168 PPHHEIPPPEYQPPHHVKPPPVYQPPPHEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQ 227

Query: 275 --KHYSPPPVYHSPPPPKKHYVY 337
              H  PPP Y  PP  K   VY
Sbjct: 228 PPPHVKPPPAYQPPPHEKPPPVY 250

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 55/136 (40%), Positives = 61/136 (44%), Gaps = 28/136 (20%)
 Frame = +2

Query: 2   KSPPP---PVKHYSPPPVYHSPPPPKKHYVYKSPP---------PPVKHYSPPPVYHSPP 145
           + PPP   P  H  PPPVY  PP  K   VY+ PP          P  H  PPPVY  PP
Sbjct: 135 EKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVKPPPVYQPPP 194

Query: 146 PPKKHYVYKSP----PPPV----KHYSPPPVYHSPPPPKKHYVYKSPP--------PPVK 277
             K   VY+ P    PPPV    +   PPP Y  PP  K    Y+ PP        PP  
Sbjct: 195 HEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKPPPVYPPPH 254

Query: 278 HYSPPPVYHSPPPPKK 325
           H  PPP Y  PPP +K
Sbjct: 255 HEKPPPAY--PPPHEK 268

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 53/137 (38%), Positives = 61/137 (44%), Gaps = 26/137 (18%)
 Frame = +2

Query: 8   PPP--PVKHYSPPPVYHSPPPPKKHYVYKSPP--------PPVKHYSPPPVY-----HSP 142
           PPP  P  H  PPP Y  PP  K    Y+ PP         P  H  PPPVY       P
Sbjct: 30  PPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPHVKPPPAYQPPPHVKPPPVYQPPHHEKP 89

Query: 143 PPPKKHYVYKSPPP---PVKHYSPPPVY-----HSPPPPKKHYVYKSPPP---PVKHYSP 289
           PP  +   ++ PPP   P  H  PPPVY       PPP  +   ++ PPP   P  H  P
Sbjct: 90  PPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHEKPPPVHQPPPHEKPPPEYQPPPHVKP 149

Query: 290 PPVYHSPPPPKKHYVYK 340
           PPVY  PP  K   VY+
Sbjct: 150 PPVYQPPPHVKPPPVYQ 166

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/131 (40%), Positives = 59/131 (45%), Gaps = 25/131 (19%)
 Frame = +2

Query: 8   PPP---PVKHYSPPPVY----HSPPPPKKHYVYKSPPP---PVKHYSPPPVYHSPPPPKK 157
           PPP   P  H  PPP Y    H  PPP     ++ PPP   P  H  PPP Y  PP  K 
Sbjct: 6   PPPVYQPPHHEKPPPAYPPPHHEIPPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPHVKP 65

Query: 158 HYVYKSP----PPPV----KHYSPPPVYHSPPPPKKHYVYKSP----PPPV---KHYSPP 292
              Y+ P    PPPV     H  PPP Y  PP  K    Y+ P    PPPV    H+  P
Sbjct: 66  PPAYQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHEKP 125

Query: 293 PVYHSPPPPKK 325
           P  H PPP +K
Sbjct: 126 PPVHQPPPHEK 136

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 49/125 (39%), Positives = 54/125 (43%), Gaps = 27/125 (21%)
 Frame = +2

Query: 26  HYSPPPVY----HSPPPPKKHYVYKSPPPPV---KHYSPPPVYHSPPPPKKHYVYKSPP- 181
           H  PPPVY    H  PPP     +   PPPV    H  PPP Y  PP  K    Y+ PP 
Sbjct: 3   HVKPPPVYQPPHHEKPPPAYPPPHHEIPPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPH 62

Query: 182 -------PPVKHYSPPPVY-----HSPPPPKKHYVYKSPPP---PVKHYSPPPVY----H 304
                   P  H  PPPVY       PPP  +   ++ PPP   P  H  PPPVY    H
Sbjct: 63  VKPPPAYQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHH 122

Query: 305 SPPPP 319
             PPP
Sbjct: 123 EKPPP 127

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 34/80 (42%), Positives = 37/80 (46%), Gaps = 3/80 (3%)
 Frame = +2

Query: 110 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP---PPPKKHYVYKSPPPPVKH 280
           H  PPPVY  P   K    Y    PP  H  PPPVY SP   PPP+    Y+ PP    H
Sbjct: 3   HVKPPPVYQPPHHEKPPPAY----PPPHHEIPPPVYPSPHEKPPPE----YQPPP----H 50

Query: 281 YSPPPVYHSPPPPKKHYVYK 340
             PPP Y  PP  K    Y+
Sbjct: 51  EKPPPEYQPPPHVKPPPAYQ 70

[168][TOP]
>UniRef100_O23370 Cell wall protein like n=1 Tax=Arabidopsis thaliana
           RepID=O23370_ARATH
          Length = 428

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/114 (45%), Positives = 55/114 (48%), Gaps = 6/114 (5%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPP---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           PPPP     PPP    PP   PP   YV   PPP VK   PPP Y  PPPP      K P
Sbjct: 68  PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVK--PPPPPYVKPPPPP---TVKPP 122

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP---PVYHSPPPPKKHY 331
           PPP  +  PPP  ++PPPP      K PPPPV    PP   P    PPPP   Y
Sbjct: 123 PPPTPYTPPPPTPYTPPPP----TVKPPPPPVVTPPPPTPTPEAPCPPPPPTPY 172

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/98 (47%), Positives = 50/98 (51%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K PPPP     PPP    PPPP   YV K PPPP     PPP  ++PPPP     Y  PP
Sbjct: 88  KPPPPPYVKPPPPPTVKPPPPP---YV-KPPPPPTVKPPPPPTPYTPPPPTP---YTPPP 140

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 295
           P VK   PPP   +PPPP        PPPP   Y PPP
Sbjct: 141 PTVK--PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 49/112 (43%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP---PPKKHY 163
           K P  P K   PP   P  H+P PP        PPPP     PPP    PP   PP   Y
Sbjct: 40  KPPKHPAKPPKPPTVKPPTHTPKPPT-----VKPPPPYIPCPPPPYTPKPPTVKPPPPPY 94

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           V   PPP VK   PPP Y  PPPP      K PPPP  +  PPP  ++PPPP
Sbjct: 95  VKPPPPPTVK--PPPPPYVKPPPPP---TVKPPPPPTPYTPPPPTPYTPPPP 141

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/107 (44%), Positives = 51/107 (47%), Gaps = 3/107 (2%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PP VK   PPP Y  PPPP      K PPPP     PPP    PPPP  +    +PPPP 
Sbjct: 84  PPTVK--PPPPPYVKPPPPP---TVKPPPPPYVKPPPPPTVKPPPPPTPY----TPPPPT 134

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPP---PVKHYSPPPVYHSPPPPK 322
            +  PPP    PPPP    V   PPP   P     PPP    PPPPK
Sbjct: 135 PYTPPPPTVKPPPPP----VVTPPPPTPTPEAPCPPPPPTPYPPPPK 177

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 42/94 (44%), Positives = 43/94 (45%), Gaps = 6/94 (6%)
 Frame = +2

Query: 56  PPPPKKHYVYKSPPPPVKHYSPP---PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 226
           PP P  H V K P  P K   PP   P  H+P PP        PPPP     PPP    P
Sbjct: 31  PPKPSPHPV-KPPKHPAKPPKPPTVKPPTHTPKPPT-----VKPPPPYIPCPPPPYTPKP 84

Query: 227 P---PPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P   PP   YV   PPP VK   PPP Y  PPPP
Sbjct: 85  PTVKPPPPPYVKPPPPPTVK--PPPPPYVKPPPP 116

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 28/63 (44%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSP 178
           K PPPP  +  PPP  ++PPPP      K PPPPV    PP P   +P PP     Y  P
Sbjct: 120 KPPPPPTPYTPPPPTPYTPPPP----TVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175

Query: 179 PPP 187
           P P
Sbjct: 176 PKP 178

[169][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 49/105 (46%), Positives = 53/105 (50%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPP P+    PPP   SPPPP        PPPP     PPP   SPPPP       SPPP
Sbjct: 39  SPPSPLPPSPPPPPPPSPPPPPP----SQPPPPPSSPPPPPPPPSPPPPPP----PSPPP 90

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P+    PPP   SPPPP    +  SPPPP     PPP+   PPPP
Sbjct: 91  PLPSPPPPPPLPSPPPPPP--LPSSPPPPPPSPPPPPLSPPPPPP 133

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 49/105 (46%), Positives = 52/105 (49%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP    PPPP       SPPPP     PPP+   PPPP    +   PPP
Sbjct: 55  SPPPPPPSQPPPPPSSPPPPPPP----PSPPPPPPPSPPPPLPSPPPPPP---LPSPPPP 107

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP   SPPPP       SPPPP     PPP+   PPPP
Sbjct: 108 PPLPSSPPPPPPSPPPPP-----LSPPPPPPSPPPPPLLSPPPPP 147

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 50/104 (48%), Positives = 54/104 (51%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP     PPP   SPPPP       SPPPP+    PPP   SPPPP    +  SPPPP
Sbjct: 64  PPPPPSSPPPPPPPPSPPPPPP----PSPPPPLPSPPPPPPLPSPPPPPP--LPSSPPPP 117

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PPP+   PPPP        PPPP+   SPPP   SPPPP
Sbjct: 118 PPSPPPPPLSPPPPPPSP------PPPPL--LSPPPPPPSPPPP 153

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/105 (46%), Positives = 51/105 (48%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP    PPPP       SPP P+    PPP   SPPPP        PPP
Sbjct: 16  SPPPPPPPSPPPPPPSPPPPPPP-----SPPSPLPPSPPPPPPPSPPPPPP----SQPPP 66

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP       SPPPP+    PPP   SPPPP
Sbjct: 67  PPSSPPPPPPPPSPPPPPP----PSPPPPLPSPPPPPPLPSPPPP 107

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/105 (48%), Positives = 54/105 (51%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP+   PPPP    +   PPPP    SPPP   SPPPP       SPPP
Sbjct: 79  SPPPPPPPSPPPPLPSPPPPPP---LPSPPPPPPLPSSPPPPPPSPPPPPL-----SPPP 130

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP+   PPPP       SPPPP    SPPP   SPPPP
Sbjct: 131 PPPSPPPPPLLSPPPPP------PSPPPPPPP-SPPPPPPSPPPP 168

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 49/105 (46%), Positives = 52/105 (49%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     P P+  SPPPP       SPPPP     PPP    PPPP       SPPP
Sbjct: 31  SPPPPPPPSPPSPLPPSPPPPPP----PSPPPPPPSQPPPPPSSPPPPPPP----PSPPP 82

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP+   PPPP    +   PPPP    SPPP   SPPPP
Sbjct: 83  PPPPSPPPPLPSPPPPPP---LPSPPPPPPLPSSPPPPPPSPPPP 124

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/104 (46%), Positives = 50/104 (48%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP     PPP   SPPPP       SPPPP     P P+  SPPPP       SPPPP
Sbjct: 9   PPPPPPSSPPPPPPPSPPPPP-----PSPPPPPPPSPPSPLPPSPPPPPP----PSPPPP 59

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PPP    PPPP       SPPPP     PPP+   PPPP
Sbjct: 60  PPSQPPPPPSSPPPPPPP----PSPPPPPPPSPPPPLPSPPPPP 99

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 53/117 (45%), Positives = 55/117 (47%), Gaps = 13/117 (11%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP    SPPP   SPPPP       SPPPP     PPP+   PPPP       SPPPP
Sbjct: 105 PPPPPLPSSPPPPPPSPPPPP-----LSPPPPPPSPPPPPLLSPPPPP------PSPPPP 153

Query: 188 VKHYSPPPVYHSPPPP-------------KKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               SPPP   SPPPP               H +  SPPPP     PPP   SPPPP
Sbjct: 154 PPP-SPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPP 209

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 48/105 (45%), Positives = 49/105 (46%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP        PPPP   +  PP    PPPP       SPPP
Sbjct: 149 SPPPPPPP-SPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPP-------SPPP 200

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPP P        PPPP     PPP   SPPPP
Sbjct: 201 PPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPP 245

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 48/106 (45%), Positives = 50/106 (47%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK-KHYVYKSPP 181
           SPPPP     PPP    PPPP       SPPPP+    PPP    PPPP   H +  SPP
Sbjct: 142 SPPPPPPSPPPPPPPSPPPPPP------SPPPPL----PPPSPLPPPPPSPPHPLPPSPP 191

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP     PPP   SPPPP         PP      PPP   SPPPP
Sbjct: 192 PPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPP 237

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 47/105 (44%), Positives = 50/105 (47%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP+   SP P    PPP   H +  SPPPP     PPP   SPPPP        P P
Sbjct: 164 SPPPPLPPPSPLP---PPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPP------PLPSP 214

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P      PP+   PPPP       SPPPP     PPP   SPPPP
Sbjct: 215 PAPSPPSPPLPPPPPPP------PSPPPPPPPSPPPP---SPPPP 250

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/103 (44%), Positives = 46/103 (44%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPP   H  PP    SPPPP       SPPPP     PPP   SPP P        PPPP
Sbjct: 178 PPPSPPHPLPP----SPPPPPP----PSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPP 229

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
                PPP    PPPP       SPPPP    SPPP    PPP
Sbjct: 230 -----PPPSPPPPPPP-------SPPPP----SPPP----PPP 252

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 35/77 (45%), Positives = 36/77 (46%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPP P+    PPP   SPPPP       SPPPP     P P   SPP P       SPPP
Sbjct: 181 SPPHPLPPSPPPPPPPSPPPPPP----PSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPP 236

Query: 185 PVKHYSPPPVYHSPPPP 235
           P     PPP    PPPP
Sbjct: 237 PPPPSPPPP--SPPPPP 251

[170][TOP]
>UniRef100_UPI0001982E1E PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982E1E
          Length = 664

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/118 (44%), Positives = 59/118 (50%), Gaps = 9/118 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           S PPP     PPP   SPPPP        PPPP    +PPP   SPPPP ++     PPP
Sbjct: 35  SSPPPPDSSPPPPSSSSPPPPLASPPPSPPPPPPG--APPPKNSSPPPPPQNSKSPPPPP 92

Query: 185 PVKHYS-------PPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPPKKHY 331
           P K+ S       PPP   SPPPP  ++V   PPPP    SPP      SPPPP K +
Sbjct: 93  PSKNTSGPATSPPPPPPPSSPPPPSSNFV---PPPPRSSLSPPHAATRKSPPPPHKSW 147

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/121 (43%), Positives = 59/121 (48%), Gaps = 11/121 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSP----PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 172
           SPPPP    S     PP   SPPPP       S PPP    SPPP   SPPP        
Sbjct: 16  SPPPPPSPDSSSSASPPPPSSPPPPD------SSPPPPSSSSPPPPLASPPP-------- 61

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-------PPPVYHSPPPPKKHY 331
           SPPPP    +PPP   SPPPP ++     PPPP K+ S       PPP   SPPPP  ++
Sbjct: 62  SPPPPPPG-APPPKNSSPPPPPQNSKSPPPPPPSKNTSGPATSPPPPPPPSSPPPPSSNF 120

Query: 332 V 334
           V
Sbjct: 121 V 121

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/110 (43%), Positives = 53/110 (48%), Gaps = 4/110 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP+   SPPP    PPP        SPPP
Sbjct: 30  SPPPPS---SPPPPDSSPPPPSS----SSPPPPLA--SPPPSPPPPPPGAPPPKNSSPPP 80

Query: 185 PVKHYSPPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPK 322
           P ++   PP    PPPP K+         PPPP     PP     PPPP+
Sbjct: 81  PPQNSKSPP----PPPPSKNTSGPATSPPPPPPPSSPPPPSSNFVPPPPR 126

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 45/115 (39%), Positives = 54/115 (46%), Gaps = 10/115 (8%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY---VYKS 175
           SPPPP+   SPPP    PPP        SPPPP ++   PP    PPPP K+        
Sbjct: 51  SPPPPLA--SPPPSPPPPPPGAPPPKNSSPPPPPQNSKSPP----PPPPSKNTSGPATSP 104

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYV-------YKSPPPPVKHYSPPPVYHSPPPP 319
           PPPP     PPP  +  PPP +  +        KSPPPP K +       +PPPP
Sbjct: 105 PPPPPPSSPPPPSSNFVPPPPRSSLSPPHAATRKSPPPPHKSWPSNHGKSTPPPP 159

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 41/112 (36%), Positives = 50/112 (44%), Gaps = 22/112 (19%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS-------PPPVYHSPPPPKKHY 163
           SPPPP    +PPP   SPPPP ++     PPPP K+ S       PPP   SPPPP  ++
Sbjct: 62  SPPPPPPG-APPPKNSSPPPPPQNSKSPPPPPPSKNTSGPATSPPPPPPPSSPPPPSSNF 120

Query: 164 V---------------YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
           V                KSPPPP K +       +PPPP       S   P+
Sbjct: 121 VPPPPRSSLSPPHAATRKSPPPPHKSWPSNHGKSTPPPPPSSSSSSSSKLPI 172

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 36/75 (48%), Positives = 37/75 (49%)
 Frame = +2

Query: 95  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
           PP     SPPP     PP        SPPPP    SPPP   SPPPP       SPPPP+
Sbjct: 9   PPDSPSASPPP-----PPSPDSSSSASPPPPS---SPPPPDSSPPPPSS----SSPPPPL 56

Query: 275 KHYSPPPVYHSPPPP 319
              SPPP   SPPPP
Sbjct: 57  A--SPPP---SPPPP 66

[171][TOP]
>UniRef100_Q9M4I1 Putative proline-rich cell wall protein n=1 Tax=Vitis vinifera
           RepID=Q9M4I1_VITVI
          Length = 217

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 59/128 (46%), Positives = 65/128 (50%), Gaps = 24/128 (18%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPP---PPKKHY----VYKSPP---PPVKHYSPPPVYHSPP---PP 151
           PPP +H  P PVY SPP   PP ++     VYK PP   PP   Y PPPV   PP   PP
Sbjct: 27  PPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPPEYKPP 86

Query: 152 KKHYVYKSPP---PPVKHYSPPPVYHSPPPPKKHYVYK-----SPPPPVKHYS---PPPV 298
               VYKSPP   PP ++  P PVY  PP  K    YK      PPPP KH +   PP V
Sbjct: 87  TP--VYKSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRV 144

Query: 299 YHSPPPPK 322
              PP PK
Sbjct: 145 VRPPPTPK 152

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 54/123 (43%), Positives = 61/123 (49%), Gaps = 17/123 (13%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPP---PPVKHYSPPPVYHSPP---PPKKHYVYK 172
           P     + PPP  H PP P    VYKSPP   PP ++  P PVY  PP   PP    VY+
Sbjct: 19  PSLANDHKPPPYEHKPPLP----VYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTP--VYR 72

Query: 173 SPP---PPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVKHYSP---PPVYHSPPPP 319
            PP   PP ++  P PVY SPP  K    YK P     PPPV+   P   PP    PPPP
Sbjct: 73  PPPVEKPPPEYKPPTPVYKSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVKPPPP 132

Query: 320 KKH 328
            KH
Sbjct: 133 PKH 135

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 55/126 (43%), Positives = 60/126 (47%), Gaps = 16/126 (12%)
 Frame = +2

Query: 2   KSPP---PPVKHYSPPPVYHSPP---PPKKHYVYKSPP---PPVKHYSPPPVYHSPPPPK 154
           K PP   PP   Y PPPV   PP   PP    VYKSPP   PP ++  P PVY  PP  K
Sbjct: 59  KPPPVEKPPTPVYRPPPVEKPPPEYKPPTP--VYKSPPVEKPPPEYKPPTPVYRPPPVEK 116

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPP----- 313
               YK PP PVK   PPP  H  P  PP+   V + PP P     PP +   PP     
Sbjct: 117 PPPEYK-PPTPVK--PPPPPKHKTPTLPPR---VVRPPPTPKPPTLPPIIVRPPPTKEPS 170

Query: 314 PPKKHY 331
           PP  HY
Sbjct: 171 PPHGHY 176

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 41/96 (42%), Positives = 48/96 (50%), Gaps = 9/96 (9%)
 Frame = +2

Query: 80  VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP---PPVKHYSPPPVYHSPP---PPKK 241
           V  + P     + PPP  H PP P    VYKSPP   PP ++  P PVY  PP   PP  
Sbjct: 14  VVLTTPSLANDHKPPPYEHKPPLP----VYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTP 69

Query: 242 HYVYKSPP---PPVKHYSPPPVYHSPPPPKKHYVYK 340
             VY+ PP   PP ++  P PVY SPP  K    YK
Sbjct: 70  --VYRPPPVEKPPPEYKPPTPVYKSPPVEKPPPEYK 103

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 42/115 (36%), Positives = 47/115 (40%), Gaps = 9/115 (7%)
 Frame = +2

Query: 11  PPPVKHYSP---PPVYHSPPPPKKHYV------YKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           PPPV+   P   PP    PPPP KH           PPP  K  + PP+   PPP K+  
Sbjct: 111 PPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTKE-- 168

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
               P PP  HY   P   +PP       YK PP P K    P   H   PP  H
Sbjct: 169 ----PSPPHGHYPGHPPVETPPSTP----YKKPPTPEKKPWAPHHKHFKAPPPIH 215

[172][TOP]
>UniRef100_Q41986 Extensin (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q41986_ARATH
          Length = 97

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/87 (51%), Positives = 49/87 (56%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP    SP   Y SPP P  +  +  PPPP    SP P Y+  PPP   YVY SPPPP
Sbjct: 13  PPPPCYSNSPKXEYKSPPTP--YVXHSPPPPPXXSXSPKPAYNFXPPP---YVYSSPPPP 67

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPP 268
               +P PVY  PPPP   YVY SPPP
Sbjct: 68  YXSPAPKPVYKFPPPP---YVYNSPPP 91

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 44/92 (47%), Positives = 48/92 (52%)
 Frame = +2

Query: 62  PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 241
           PP  H     PPPP    SP   Y SPP P  +  +  PPPP    SP P Y+  PPP  
Sbjct: 3   PPHPHVCXFXPPPPCYSNSPKXEYKSPPTP--YVXHSPPPPPXXSXSPKPAYNFXPPP-- 58

Query: 242 HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
            YVY SPPPP    +P PVY  PPPP   YVY
Sbjct: 59  -YVYSSPPPPYXSPAPKPVYKFPPPP---YVY 86

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 36/75 (48%), Positives = 39/75 (52%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPP P   +SPPP       PK    Y   PPP  + SPPP Y SP P     VYK PP
Sbjct: 27  KSPPTPYVXHSPPPPPXXSXSPKP--AYNFXPPPYVYSSPPPPYXSPAPKP---VYKFPP 81

Query: 182 PPVKHYSPPPVYHSP 226
           PP  + SPPP Y  P
Sbjct: 82  PPYVYNSPPPXYXXP 96

[173][TOP]
>UniRef100_Q2R063 Transposon protein, putative, unclassified n=1 Tax=Oryza sativa
            Japonica Group RepID=Q2R063_ORYSJ
          Length = 946

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/108 (48%), Positives = 56/108 (51%), Gaps = 1/108 (0%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KSPPP     SPP   H   PP      KSPP P +  SPP    SP PP  H    +PP
Sbjct: 779  KSPPPHSPEKSPPSEAHPTSPPPSE---KSPPTPAEESSPPTPEKSPSPPSGHE--GTPP 833

Query: 182  PPVKHYSPPPVYH-SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
             PVK  SPPP  H S PPP+K     SPPP     SPPP   SPPPP+
Sbjct: 834  SPVKSSSPPPEAHVSSPPPEKS---SSPPPEAHVSSPPPPEKSPPPPE 878

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 59/131 (45%), Positives = 64/131 (48%), Gaps = 23/131 (17%)
 Frame = +2

Query: 2    KSPP-PPVKHYSPP-PVYHSPPPPKK----------HYVYKSPPPPVKHYSPPPVYHSPP 145
            KSPP PP  H SPP P  ++P PPK           H   KSPP      SPPP   SPP
Sbjct: 748  KSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPP 807

Query: 146  PPKKHYVYKSPPPPVKHYSPP---------PVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
             P +     SPP P K  SPP         PV  S PPP+ H    S PPP K  SPPP 
Sbjct: 808  TPAEE---SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHV---SSPPPEKSSSPPPE 861

Query: 299  YH--SPPPPKK 325
             H  SPPPP+K
Sbjct: 862  AHVSSPPPPEK 872

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 54/118 (45%), Positives = 57/118 (48%), Gaps = 14/118 (11%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP---------PVYHSPPPPK 154
            KSPP      SPPP   SPP P +     SPP P K  SPP         PV  S PPP+
Sbjct: 788  KSPPSEAHPTSPPPSEKSPPTPAEE---SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPE 844

Query: 155  KHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH---YVYKSPPPPVKHYSPPPVYHSPP 313
             H    S PPP K  SPPP  H  SPPPP+K       KSPP      SPPP   SPP
Sbjct: 845  AHV---SSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPP 899

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/121 (42%), Positives = 58/121 (47%), Gaps = 13/121 (10%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYV----------YKSPPPPVKHYSPPPVYH--SPP 145
            KS PP  K    PP  H+ PP  + Y            KSPPP     SPP   H  SPP
Sbjct: 741  KSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPP 800

Query: 146  PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPK 322
            P +     KSPP P +  SPP    SP PP  H    +PP PVK  SPPP  H S PPP+
Sbjct: 801  PSE-----KSPPTPAEESSPPTPEKSPSPPSGH--EGTPPSPVKSSSPPPEAHVSSPPPE 853

Query: 323  K 325
            K
Sbjct: 854  K 854

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 53/122 (43%), Positives = 57/122 (46%), Gaps = 16/122 (13%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---------SPPPPK 154
            KSPP P +  SPP    SP PP  H    +PP PVK  SPPP  H         S PPP+
Sbjct: 804  KSPPTPAEESSPPTPEKSPSPPSGHE--GTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPE 861

Query: 155  KHYVYKSPPPPVKHYSPPPVYHSPP-------PPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
             H    SPPPP K   PPP   SPP       PP +    KSPP      S PP   S P
Sbjct: 862  AH--VSSPPPPEKS-PPPPETKSPPTLTPEISPPPEG---KSPPSHTPESSSPPSKESEP 915

Query: 314  PP 319
            PP
Sbjct: 916  PP 917

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 56/135 (41%), Positives = 61/135 (45%), Gaps = 26/135 (19%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVY----HSPPPPKKHYVY-KSPP-PPVKHYSPP-PVYHSPPPPKK- 157
            KSPP P    S PP      H+P PPK      KSPP PP  H SPP P  ++P PPK  
Sbjct: 715  KSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSS 774

Query: 158  ---------HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP------ 292
                     H   KSPP      SPPP   SPP P +     SPP P K  SPP      
Sbjct: 775  PPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEE---SSPPTPEKSPSPPSGHEGT 831

Query: 293  ---PVYHSPPPPKKH 328
               PV  S PPP+ H
Sbjct: 832  PPSPVKSSSPPPEAH 846

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 49/119 (41%), Positives = 60/119 (50%), Gaps = 12/119 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSP 178
           +SP  P +  +P P   SP  P K  +   P P +K   SPP  Y +PPPP   ++ KSP
Sbjct: 466 ESPEEPPEEPTPSPTPSSPESPAK--MAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSP 523

Query: 179 ------PP---PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPK 322
                 PP   P   YSPP    S PPP+     KSPP P   +SPPPV   H+P PPK
Sbjct: 524 ERKKAPPPQAEPPTEYSPPATPESSPPPEG----KSPPTPTASHSPPPVPEGHTPSPPK 578

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 55/128 (42%), Positives = 58/128 (45%), Gaps = 22/128 (17%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVY----HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSPPPPK 154
            KSPP P    S PP      H P PPK    V KSPP P    S    P P  H+P PPK
Sbjct: 682  KSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPK 741

Query: 155  KH-YVYKSPP-PPVKHYSPP-PVYHSPPPPKK----------HYVYKSPPPPVKHYSPPP 295
                  KSPP PP  H SPP P  ++P PPK           H   KSPP      SPPP
Sbjct: 742  SSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPP 801

Query: 296  VYHSPPPP 319
               SPP P
Sbjct: 802  SEKSPPTP 809

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/120 (40%), Positives = 58/120 (48%), Gaps = 12/120 (10%)
 Frame = +2

Query: 8   PPPPVKHY-SPPPVYHSPPPPKKHYVYKSP------PP---PVKHYSPPPVYHSPPPPKK 157
           P P +K   SPP  Y +PPPP   ++ KSP      PP   P   YSPP    S PPP+ 
Sbjct: 494 PAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEG 553

Query: 158 HYVYKSPPPPVKHYSPPPVY--HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
               KSPP P   +SPPPV   H+P PPK      S PP  +    P    SPPP  + Y
Sbjct: 554 ----KSPPTPTASHSPPPVPEGHTPSPPK------SGPPAGESPPTPESKASPPPTPEEY 603

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 57/124 (45%), Positives = 61/124 (49%), Gaps = 17/124 (13%)
 Frame = +2

Query: 2    KSPPPPV-KHYSPPPVY---HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSPPPPK 154
            KSPP P  K  SPPP     H+P PPK      KSPP P    S    P P  H P PPK
Sbjct: 649  KSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPK 708

Query: 155  K-HYVYKSPPPPVKHYS----PPPVYHSPPPPKKH-YVYKSPP-PPVKHYSPP-PVYHSP 310
                V KSPP P    S    P P  H+P PPK      KSPP PP  H SPP P  ++P
Sbjct: 709  STPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTP 768

Query: 311  PPPK 322
             PPK
Sbjct: 769  SPPK 772

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 49/135 (36%), Positives = 58/135 (42%), Gaps = 28/135 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVY--HSPPPPKKH----------YVYKSPPPPVKHYSPPPVYHSPP 145
           KSPP P   +SPPPV   H+P PPK                SPPP  + Y+P P   +PP
Sbjct: 554 KSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPP 613

Query: 146 ----PPKKHYVYKSPPPPVKH-YSPPPVYHSPP----PPKKHYVYKSPPPPVKH------ 280
               PP       SPPPP    ++P P   +PP    PP       SPPPP         
Sbjct: 614 AEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSP 673

Query: 281 -YSPPPVYHSPPPPK 322
             S PP   SPP P+
Sbjct: 674 PKSTPPTEKSPPTPE 688

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/127 (36%), Positives = 56/127 (44%), Gaps = 21/127 (16%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKH-YSPPPVYHSPP----PPKK 157
           SPPP  + Y+P P   +PP    PP       SPPPP    ++P P   +PP    PP  
Sbjct: 595 SPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTP 654

Query: 158 HYVYKSPPPPVKH-YSPPPVYHSPP----PPKKHYVYKSPPPPVKH-------YSPPPVY 301
                SPPPP    ++P P   +PP    PP       SPPPP           S PPV 
Sbjct: 655 ESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVE 714

Query: 302 HSPPPPK 322
            SPP P+
Sbjct: 715 KSPPTPE 721

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 44/112 (39%), Positives = 51/112 (45%), Gaps = 5/112 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           SPPP  K    P   HSPPP P+ H    +P PP    S PP   SPP P+      SPP
Sbjct: 548 SPPPEGKSPPTPTASHSPPPVPEGH----TPSPP---KSGPPAGESPPTPESK---ASPP 597

Query: 182 PPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           P  + Y+P P   +PP    PP       SPPPP      P    S PP +K
Sbjct: 598 PTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEK 649

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 56/126 (44%), Positives = 60/126 (47%), Gaps = 19/126 (15%)
 Frame = +2

Query: 2   KSPPPPV-KHYSPPPVY---HSPPPPKK-HYVYKSPP-PPVKHYSPPPVY---HSPPPPK 154
           KSPP P  K  SPPP     H+P PP+      KSPP P  K  SPPP     H+P PPK
Sbjct: 616 KSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPK 675

Query: 155 K-HYVYKSPPPPVKHYS----PPPVYHSPPPPKK-HYVYKSPPPPVKHYS----PPPVYH 304
                 KSPP P    S    P P  H P PPK    V KSPP P    S    P P  H
Sbjct: 676 STPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGH 735

Query: 305 SPPPPK 322
           +P PPK
Sbjct: 736 TPSPPK 741

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 54/124 (43%), Positives = 60/124 (48%), Gaps = 17/124 (13%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV--YHSPPPPKK-HYVYKSPP-PPVKHYSPPPVY---HSPPPPKK- 157
           +SPP P    SPPP    ++P PPK      KSPP P  K  SPPP     H+P PP+  
Sbjct: 585 ESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPEST 644

Query: 158 HYVYKSPP-PPVKHYSPPPVY---HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSP 310
               KSPP P  K  SPPP     H+P PPK      KSPP P    S    P P  H P
Sbjct: 645 PPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMP 704

Query: 311 PPPK 322
            PPK
Sbjct: 705 SPPK 708

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 45/123 (36%), Positives = 55/123 (44%), Gaps = 17/123 (13%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVY------HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           PP     Y  PP        H PPPP++    +SP  P +  +P P   SP  P K  + 
Sbjct: 438 PPEKSPAYEEPPAAPSTPTSHGPPPPEE----ESPEEPPEEPTPSPTPSSPESPAK--MA 491

Query: 170 KSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSP------PP---PVKHYSPPPV-YHSPPP 316
             P P +K   SPP  Y +PPPP   ++ KSP      PP   P   YSPP     SPPP
Sbjct: 492 PPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPP 551

Query: 317 PKK 325
             K
Sbjct: 552 EGK 554

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 45/135 (33%), Positives = 55/135 (40%), Gaps = 29/135 (21%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPP-PPKKHYVYKSPPP----PVKHYSPPPVYHSPPPPKKHYV- 166
           +P  P +    PP+   P  PP+K   Y+ PP     P  H  PPP   SP  P +    
Sbjct: 418 TPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHGPPPPEEESPEEPPEEPTP 477

Query: 167 ----------YKSPPPPVKHY----SPPPVYHSPPPPKKHYVYKSP-----PP----PVK 277
                      K  PPP        SPP  Y +PPPP   ++ KSP     PP    P  
Sbjct: 478 SPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPT 537

Query: 278 HYSPPPVYHSPPPPK 322
            YSPP    S PPP+
Sbjct: 538 EYSPPATPESSPPPE 552

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 46/122 (37%), Positives = 53/122 (43%), Gaps = 21/122 (17%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYH-SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY---- 169
            +PP PVK  SPPP  H S PPP+K     SPPP     SPPP   SPPPP+         
Sbjct: 831  TPPSPVKSSSPPPEAHVSSPPPEKS---SSPPPEAHVSSPPPPEKSPPPPETKSPPTLTP 887

Query: 170  --------KSPP--------PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 301
                    KSPP        PP K   PPP   +P P       KS PP  +    P + 
Sbjct: 888  EISPPPEGKSPPSHTPESSSPPSKESEPPP---TPTP-------KSSPPSHEEREVPTIT 937

Query: 302  HS 307
            +S
Sbjct: 938  YS 939

[174][TOP]
>UniRef100_A5B4T6 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5B4T6_VITVI
          Length = 358

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 13/116 (11%)
 Frame = -2

Query: 340 LVYVMFLWWWWGMV--------DWRGRVVLNRRRRGLVYVMFLWWWWGMVN-WRGRVVLH 188
           LV++   WWWW +V         W G V+++ RRR    V   WWWW +V+ W    +L 
Sbjct: 160 LVFISRGWWWWRVVLVWLLGRWRWWGLVLVDWRRRWWRLVFVWWWWWRVVHVW----LLR 215

Query: 187 RWWWRFVHVVFL-WWGWGMVNRRRRVVLNWRRRRFVHVVFLWWWWG---MVNRRRR 32
            WWWR VHV  L WW WG+V       L  RRR +  +V +WWWW    +VN RRR
Sbjct: 216 WWWWRVVHVWLLGWWWWGLV-------LVDRRRWWWRLVLIWWWWWRLILVNWRRR 264

[175][TOP]
>UniRef100_C1PGW2 Tracheary element differentiation-related 7B n=1 Tax=Zinnia
           violacea RepID=C1PGW2_ZINEL
          Length = 283

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 48/114 (42%), Positives = 55/114 (48%), Gaps = 7/114 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           PPP   H  PPP +  PPP   H V    +  PPP   H   PP +  PPP   H+V   
Sbjct: 61  PPPLPPHSVPPPSHTVPPPSPPHPVSPPPHTVPPPSPPHPVSPPPHTVPPPSPPHHVSPP 120

Query: 176 P---PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           P   PPP  H+ PPP    PPPP  H+V   PPPP  +  PPP    PP P  H
Sbjct: 121 PHTVPPPSPHFVPPPPNTVPPPPAPHFV---PPPPPPYIIPPP----PPSPSNH 167

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/121 (40%), Positives = 58/121 (47%), Gaps = 11/121 (9%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYV-- 166
           S PPP  H+  PP +  PPP   H V    +  PPP   H  PPP +  PPP   H V  
Sbjct: 30  STPPP--HFISPPPHSVPPPSPPHSVPPPLHPVPPPLPPHSVPPPSHTVPPPSPPHPVSP 87

Query: 167 --YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP---PPPVKHYSPPPVYHSPPPPKKHY 331
             +  PPP   H   PP +  PPP   H+V   P   PPP  H+ PPP    PPPP  H+
Sbjct: 88  PPHTVPPPSPPHPVSPPPHTVPPPSPPHHVSPPPHTVPPPSPHFVPPPPNTVPPPPAPHF 147

Query: 332 V 334
           V
Sbjct: 148 V 148

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/120 (41%), Positives = 57/120 (47%), Gaps = 11/120 (9%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYV----YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           PPP   H  PPP++  PPP   H V    +  PPP   H   PP +  PPP   H V  S
Sbjct: 45  PPPSPPHSVPPPLHPVPPPLPPHSVPPPSHTVPPPSPPHPVSPPPHTVPPPSPPHPV--S 102

Query: 176 PPP-------PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
           PPP       P  H SPPP  H+ PPP  H+V    PPP     PPP  H  PPP   Y+
Sbjct: 103 PPPHTVPPPSPPHHVSPPP--HTVPPPSPHFV----PPPPNTVPPPPAPHFVPPPPPPYI 156

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 49/120 (40%), Positives = 58/120 (48%), Gaps = 11/120 (9%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV----YKS 175
           PP P    +PPP + SPPP      +  PPP   H  PPP++  PPP   H V    +  
Sbjct: 23  PPAPTTPSTPPPHFISPPP------HSVPPPSPPHSVPPPLHPVPPPLPPHSVPPPSHTV 76

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-------PVKHYSPPPVYHSPPPPKKHYV 334
           PPP   H   PP +  PPP   H V  SPPP       P  H SPPP  H+ PPP  H+V
Sbjct: 77  PPPSPPHPVSPPPHTVPPPSPPHPV--SPPPHTVPPPSPPHHVSPPP--HTVPPPSPHFV 132

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/100 (42%), Positives = 48/100 (48%), Gaps = 7/100 (7%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-------PVKHYSPPPVYHSPPPPKKHYV 166
           PPP   H   PP +  PPP   H V  SPPP       P  H SPPP  H+ PPP  H+V
Sbjct: 77  PPPSPPHPVSPPPHTVPPPSPPHPV--SPPPHTVPPPSPPHHVSPPP--HTVPPPSPHFV 132

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS 286
               PPP     PPP  H  PPP   Y+   PPP   ++S
Sbjct: 133 ----PPPPNTVPPPPAPHFVPPPPPPYIIPPPPPSPSNHS 168

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 48/111 (43%), Positives = 56/111 (50%), Gaps = 3/111 (2%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP---PPKKHYVYKSPP 181
           PPP    +PPP   +P  P  H++  SPPP   H  PPP   SPP   PP  H V    P
Sbjct: 14  PPPSPAATPPPAPTTPSTPPPHFI--SPPP---HSVPPP---SPPHSVPPPLHPV----P 61

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
           PP+  +S PP  H+ PPP       SPP PV   SPPP +  PPP   H V
Sbjct: 62  PPLPPHSVPPPSHTVPPP-------SPPHPV---SPPP-HTVPPPSPPHPV 101

[176][TOP]
>UniRef100_B4QQM0 GD13257 n=1 Tax=Drosophila simulans RepID=B4QQM0_DROSI
          Length = 400

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 64/156 (41%), Positives = 70/156 (44%), Gaps = 49/156 (31%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP--------------------VYHSPPPP--KKHYVYKSPPPPVKH-- 112
           +PPPP   Y PPP                    VY  PPPP  KK  VY  PPPP     
Sbjct: 130 APPPPKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVVVYTPPPPPPPKKV 189

Query: 113 -YSPPPV-------YH-----------SPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPP 229
            Y+PPP        YH           +PPPPK  Y+    PPP K    +PPPVY   P
Sbjct: 190 VYTPPPTGILKDDGYHYGQPSVKFEVSAPPPPKVEYL----PPPTKKVIIAPPPVY--VP 243

Query: 230 PPKKHYVYKSPPPP----VKHYSPPPVYHSPPPPKK 325
           PP K  VY  PPPP    V  Y+PPP    PPPPKK
Sbjct: 244 PPTKKVVYTPPPPPPTKKVVVYTPPP----PPPPKK 275

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 60/124 (48%), Positives = 65/124 (52%), Gaps = 15/124 (12%)
 Frame = +2

Query: 11  PPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPP----VKHYSPPPVYHSPPPPKKHYVYK 172
           PPP K    +PPPVY   PPP K  VY  PPPP    V  Y+PPP    PPPPKK  VY 
Sbjct: 227 PPPTKKVIIAPPPVY--VPPPTKKVVYTPPPPPPTKKVVVYTPPP----PPPPKK-VVYT 279

Query: 173 SPPPPVK-----HYSPPPV---YHSPPPPKKHYVYKSPPPPVKH-YSPPPVYHSPPPPKK 325
            PP  +      HY  P V     +P PPK  Y+   PPPP K  Y  PPVY  PPP KK
Sbjct: 280 PPPTGILKDDGYHYGQPSVKFEVSAPAPPKVEYL---PPPPTKKVYVAPPVY-VPPPTKK 335

Query: 326 HYVY 337
             VY
Sbjct: 336 VVVY 339

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 59/133 (44%), Positives = 63/133 (47%), Gaps = 23/133 (17%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPV-------YH-----------SPPPPKKHYVYKSPPPPVKH-YSPP 124
           PPPP K   Y+PPP        YH           +P PPK  Y+   PPPP K  Y  P
Sbjct: 269 PPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPAPPKVEYL---PPPPTKKVYVAP 325

Query: 125 PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP--PPPVKHYSPPPV 298
           PVY  PPP KK  VY  PPPP      PPVY  PPP KK  VY  P  PPP K     P 
Sbjct: 326 PVY-VPPPTKKVVVYTPPPPP------PPVY-IPPPTKKVVVYTPPPPPPPTKKVYVTPK 377

Query: 299 YHSPPPPKKHYVY 337
               PP +K Y Y
Sbjct: 378 VEYLPPVQKGYSY 390

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 63/152 (41%), Positives = 71/152 (46%), Gaps = 43/152 (28%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPV-------YH-----------SPPPPKKHYVYKSPPPPVKHY--SP 121
           PPPP K   Y+PPP        YH           +PPPPK  Y+    PPP K    +P
Sbjct: 182 PPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPPPKVEYL----PPPTKKVIIAP 237

Query: 122 PPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPVYHSPPPPKKHYVYKSPPPPV-----K 277
           PPVY  PPP KK      PPPP K    Y+PPP    PPPPKK  VY  PP  +      
Sbjct: 238 PPVY-VPPPTKKVVYTPPPPPPTKKVVVYTPPP----PPPPKK-VVYTPPPTGILKDDGY 291

Query: 278 HY------------SPPPVYHSPPPP-KKHYV 334
           HY            +PP V + PPPP KK YV
Sbjct: 292 HYGQPSVKFEVSAPAPPKVEYLPPPPTKKVYV 323

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 58/146 (39%), Positives = 65/146 (44%), Gaps = 37/146 (25%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHS------------------------PPPPKKHYVYKSPPPPVKHY 115
           P PP   Y+PP V HS                        PPPPK  Y+    PPP K  
Sbjct: 91  PTPPRPVYTPPVVIHSEPAGVLKDDGYHYGQPSVKFEVSAPPPPKVEYL----PPPTKKV 146

Query: 116 --SPPPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPVYHSPPPPKKHYVYKSPPPPV-- 274
             +PPPVY  PPP KK      PPPP K    Y+PPP    PPPPKK  VY  PP  +  
Sbjct: 147 VIAPPPVY-VPPPTKKVVYTPPPPPPTKKVVVYTPPP----PPPPKK-VVYTPPPTGILK 200

Query: 275 ---KHYSPPPV---YHSPPPPKKHYV 334
               HY  P V     +PPPPK  Y+
Sbjct: 201 DDGYHYGQPSVKFEVSAPPPPKVEYL 226

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 44/94 (46%), Positives = 48/94 (51%), Gaps = 2/94 (2%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP--P 181
           PPP  K Y  PPVY  PPP KK  VY  PPPP      PPVY  PPP KK  VY  P  P
Sbjct: 315 PPPTKKVYVAPPVY-VPPPTKKVVVYTPPPPP------PPVY-IPPPTKKVVVYTPPPPP 366

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
           PP K     P     PP +K Y Y + P P  ++
Sbjct: 367 PPTKKVYVTPKVEYLPPVQKGYSYPNDPQPAFNF 400

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 54/141 (38%), Positives = 62/141 (43%), Gaps = 41/141 (29%)
 Frame = +2

Query: 26  HYSPP--PV--------YHSPPPPKKHYVYKSPPPPVKH-YSPPPVYHS----------- 139
           HY+PP  PV        + S PP   +   K  P P +  Y+PP V HS           
Sbjct: 58  HYAPPRAPVVIDVPYVPHESAPPVVVYEAPKPRPTPPRPVYTPPVVIHSEPAGVLKDDGY 117

Query: 140 -------------PPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPP- 271
                        PPPPK  Y+    PPP K    +PPPVY   PPP K  VY  PPPP 
Sbjct: 118 HYGQPSVKFEVSAPPPPKVEYL----PPPTKKVVIAPPPVY--VPPPTKKVVYTPPPPPP 171

Query: 272 ---VKHYSPPPVYHSPPPPKK 325
              V  Y+PPP    PPPPKK
Sbjct: 172 TKKVVVYTPPP----PPPPKK 188

[177][TOP]
>UniRef100_Q9T0I5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0I5_ARATH
          Length = 448

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/129 (41%), Positives = 57/129 (44%), Gaps = 20/129 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP-PKKHY--------------VYKSPP-----PPVKHYSP 121
           K  PPPV  Y PPP    PPP PKK                VYK PP     PPV  Y P
Sbjct: 220 KEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKP 279

Query: 122 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 301
           PP    PPP   H + K P PP K   PP   H PP  K     K  PPPV  + PPP  
Sbjct: 280 PPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKI 339

Query: 302 HSPPPPKKH 328
             PPP  +H
Sbjct: 340 VIPPPKIEH 348

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 56/118 (47%), Positives = 59/118 (50%), Gaps = 13/118 (11%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPPVYHSPPP-PKKHYVYK 172
           PPPV  Y PPP    PPP     VY  PP     PPV  Y PPP    PPP PKK    K
Sbjct: 193 PPPVPVYEPPPKKEIPPPVP---VYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPK 249

Query: 173 SP----PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY---HSPPPPKK 325
            P    PPPV  Y PPP    PPP     VYK PPP ++H  P PV+     P PPKK
Sbjct: 250 PPKIEHPPPVPVYKPPPKIEKPPPVP---VYK-PPPKIEHPPPVPVHKLPKKPCPPKK 303

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 55/127 (43%), Positives = 58/127 (45%), Gaps = 19/127 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVKHY----SPPPVYHSPPPPK 154
           K  PPPV  Y PPP    PPP     VYK P     PPP+        PP + H PP P 
Sbjct: 205 KEIPPPVPVYDPPPKKEVPPPVP---VYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVP- 260

Query: 155 KHYVYKSP-----PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-- 313
              VYK P     PPPV  Y PPP    PPP   H + K P PP K   PP   H PP  
Sbjct: 261 ---VYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTK 317

Query: 314 ---PPKK 325
              PPKK
Sbjct: 318 KPCPPKK 324

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 56/132 (42%), Positives = 59/132 (44%), Gaps = 22/132 (16%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHY---- 163
           PPPV  Y PPP    PPP   H + K P PP K   PP   H PP     PPKK      
Sbjct: 271 PPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPV 330

Query: 164 -VYKSPP----PPVKHYSPPPVYHSPPPPKKHY--------VYKSPPPPVKHYSPPPVYH 304
            V+K PP    PP K   PPPV    PPPK  +        V K  PPPV  Y PP V  
Sbjct: 331 PVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIP 390

Query: 305 SPPPPKKHYVYK 340
             P P    VYK
Sbjct: 391 KKPCPPPVPVYK 402

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 52/115 (45%), Positives = 54/115 (46%), Gaps = 13/115 (11%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSP---PPPVKHYSPPPVYHSPPPPKKHYVYKSP- 178
           PPP++    PP    P PPK    Y  P   PPPV  Y PPP    PPP     VY  P 
Sbjct: 169 PPPLEL---PPFLKKPCPPK----YSPPVEVPPPVPVYEPPPKKEIPPPVP---VYDPPP 218

Query: 179 ----PPPVKHYSPPPVYHSPPP-PKKHYVYKSP----PPPVKHYSPPPVYHSPPP 316
               PPPV  Y PPP    PPP PKK    K P    PPPV  Y PPP    PPP
Sbjct: 219 KKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPP 273

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/107 (41%), Positives = 48/107 (44%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K  PPPV  + PPP    PPP  +H      PPPV  Y PPP    PP      V K  P
Sbjct: 324 KVDPPPVPVHKPPPKIVIPPPKIEH------PPPVPVYKPPPKIEHPPIYIPPIVKKPCP 377

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           PPV  Y PP V    P P    VYK P   +     PP+   PP PK
Sbjct: 378 PPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKPCPPLPQLPPLPK 424

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 47/105 (44%), Positives = 51/105 (48%), Gaps = 1/105 (0%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 193
           PP K +  P  +  PPP +     K P PP   YSPP V   PP P    VY+ PP   K
Sbjct: 157 PPFKGFDHP--FPLPPPLELPPFLKKPCPP--KYSPP-VEVPPPVP----VYEPPP---K 204

Query: 194 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP-PKK 325
              PPPV    PPPKK       PPPV  Y PPP    PPP PKK
Sbjct: 205 KEIPPPVPVYDPPPKKEV-----PPPVPVYKPPPKVELPPPIPKK 244

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 40/103 (38%), Positives = 43/103 (41%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPPV  Y PPP    PP      V K  PPPV  Y PP V    P P    VYK P   +
Sbjct: 349 PPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVI 408

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PP+   PP P      K PP P K+   P     PP P
Sbjct: 409 PKKPCPPLPQLPPLP------KFPPLPPKYIHHPKFGKWPPLP 445

[178][TOP]
>UniRef100_Q40552 Pistil extensin like protein (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q40552_TOBAC
          Length = 393

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/106 (46%), Positives = 53/106 (50%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-YSPPPVYHSPPPPKKHYVYKSPP 181
           SP PPVK   PPP    P PP +      PPPP K    PPPV  S P P K      PP
Sbjct: 104 SPSPPVKPPPPPPSPCKPSPPDQSTKQPPPPPPSKQPPPPPPVKASSPSPAKQ--PPPPP 161

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPVK  SP P   SPPPP+      +  PP+K   PP    SPPPP
Sbjct: 162 PPVKSPSPSPAKQSPPPPRAPSPSPATQPPIKQPPPPSAKKSPPPP 207

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/109 (43%), Positives = 51/109 (46%), Gaps = 6/109 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHS-----PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 166
           K PPPP     P P   S     PPPP K      PPPPVK  SP P    PPPP     
Sbjct: 110 KPPPPPPSPCKPSPPDQSTKQPPPPPPSKQ---PPPPPPVKASSPSPAKQPPPPPPP--- 163

Query: 167 YKSPPP-PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 310
            KSP P P K   PPP   SP P  +  + + PPP  K   PPPV + P
Sbjct: 164 VKSPSPSPAKQSPPPPRAPSPSPATQPPIKQPPPPSAKKSPPPPVAYPP 212

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/102 (43%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = +2

Query: 8   PPPPVKH-YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           PPPP K    PPPV  S P P K      PPPPVK  SP P   SPPPP+      +  P
Sbjct: 133 PPPPSKQPPPPPPVKASSPSPAKQ--PPPPPPPVKSPSPSPAKQSPPPPRAPSPSPATQP 190

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 310
           P+K   PP    SPPPP  +       PPV   SP P    P
Sbjct: 191 PIKQPPPPSAKKSPPPPVAY-------PPVMAPSPSPAAEPP 225

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 45/98 (45%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +2

Query: 38  PPVYHSPPP--PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-YSPP 208
           PP+   PP   PK      SP PPVK   PPP    P PP +      PPPP K    PP
Sbjct: 89  PPIGGGPPVNRPKP----SSPSPPVKPPPPPPSPCKPSPPDQSTKQPPPPPPSKQPPPPP 144

Query: 209 PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           PV  S P P K      PPPPVK  SP P   SPPPP+
Sbjct: 145 PVKASSPSPAKQ--PPPPPPPVKSPSPSPAKQSPPPPR 180

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 41/103 (39%), Positives = 45/103 (43%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPPVK  SP P    PPPP          PPVK  SP P   SPPPP+      +  PP
Sbjct: 142 PPPPVKASSPSPAKQPPPPP----------PPVKSPSPSPAKQSPPPPRAPSPSPATQPP 191

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           +K   PPP     PPP   Y     P P     PP +   P P
Sbjct: 192 IKQ-PPPPSAKKSPPPPVAYPPVMAPSPSPAAEPPIIAPFPSP 233

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 38/102 (37%), Positives = 44/102 (43%), Gaps = 7/102 (6%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPPVK  SP P   SPPPP+      +  PP+K   PP    SPPPP  +       PP
Sbjct: 160 PPPPVKSPSPSPAKQSPPPPRAPSPSPATQPPIKQPPPPSAKKSPPPPVAY-------PP 212

Query: 188 VKHYSPPPVYHSP-------PPPKKHYVYKSPPPPVKHYSPP 292
           V   SP P    P       P      + + P PPV    PP
Sbjct: 213 VMAPSPSPAAEPPIIAPFPSPTANLPLIPRRPAPPVVKPLPP 254

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 48/132 (36%), Positives = 49/132 (37%), Gaps = 28/132 (21%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSP------PPPVKHYSP------------PPVY 133
           PPPP    SPPP   SPPPP        P      PP      P            PP+ 
Sbjct: 33  PPPPSPLPSPPPPSPSPPPPSTLIPLIPPFTGGFLPPLPGSKLPGLLPLIPNLPDLPPIG 92

Query: 134 HSPP-----PPKKHYVYKSPPPPVKHYSPPPVYHS-----PPPPKKHYVYKSPPPPVKHY 283
             PP     P       K PPPP     P P   S     PPPP K      PPPPVK  
Sbjct: 93  GGPPVNRPKPSSPSPPVKPPPPPPSPCKPSPPDQSTKQPPPPPPSKQ---PPPPPPVKAS 149

Query: 284 SPPPVYHSPPPP 319
           SP P    PPPP
Sbjct: 150 SPSPAKQPPPPP 161

[179][TOP]
>UniRef100_Q01944 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01944_SOLLC
          Length = 75

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/86 (54%), Positives = 51/86 (59%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 211
           SPPP Y+  PPP       SPPPP  + SPPP   SPPPP   Y Y SPPPP K   PPP
Sbjct: 4   SPPPYYYKSPPP------PSPPPPYYYKSPPPPSPSPPPP---YYYSSPPPP-KPSPPPP 53

Query: 212 VYHSPPPPKKHYVYKSPPPPVKHYSP 289
            Y+S PPP K    KSPPPP  + SP
Sbjct: 54  YYYSSPPPPK----KSPPPPYYYSSP 75

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/89 (56%), Positives = 53/89 (59%), Gaps = 2/89 (2%)
 Frame = +2

Query: 53  SPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 226
           SPPP    Y YKSPPPP    SPPP Y+  SPPPP       SPPPP  + SPPP   SP
Sbjct: 4   SPPP----YYYKSPPPP----SPPPPYYYKSPPPPSP-----SPPPPYYYSSPPPPKPSP 50

Query: 227 PPPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
           PPP   Y Y SPPPP K   PPP Y+S P
Sbjct: 51  PPP---YYYSSPPPP-KKSPPPPYYYSSP 75

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/84 (55%), Positives = 49/84 (58%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPPK      SPPPP 
Sbjct: 5   PPPYYYKSPPPP--SPPPP---YYYKSPPPPSPSPPPPYYYSSPPPPK-----PSPPPPY 54

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSP 262
            + SPPP   SPPPP   Y Y SP
Sbjct: 55  YYSSPPPPKKSPPPP---YYYSSP 75

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 43/75 (57%), Positives = 45/75 (60%)
 Frame = +2

Query: 95  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 274
           PPP  + SPPP   SPPPP   Y YKSPPPP     PP  Y SPPPPK      SPPPP 
Sbjct: 5   PPPYYYKSPPP--PSPPPP---YYYKSPPPPSPSPPPPYYYSSPPPPK-----PSPPPPY 54

Query: 275 KHYSPPPVYHSPPPP 319
            + SPPP   SPPPP
Sbjct: 55  YYSSPPPPKKSPPPP 69

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 38/67 (56%), Positives = 42/67 (62%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SP PP  +Y Y SPPPP K   PPP Y+S PPP K    KSPPP
Sbjct: 17  SPPPPYYYKSPPPP--SPSPPPPYY-YSSPPPP-KPSPPPPYYYSSPPPPK----KSPPP 68

Query: 185 PVKHYSP 205
           P  + SP
Sbjct: 69  PYYYSSP 75

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 33/59 (55%), Positives = 34/59 (57%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           KSPPPP     PP  Y SPPPPK      SPPPP  + SPPP   SPPPP   Y Y SP
Sbjct: 25  KSPPPPSPSPPPPYYYSSPPPPK-----PSPPPPYYYSSPPPPKKSPPPP---YYYSSP 75

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 34/62 (54%), Positives = 34/62 (54%)
 Frame = +2

Query: 137 SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           SPPP    Y YKSPPPP           SPPPP   Y YKSPPPP     PP  Y SPPP
Sbjct: 4   SPPP----YYYKSPPPP-----------SPPPP---YYYKSPPPPSPSPPPPYYYSSPPP 45

Query: 317 PK 322
           PK
Sbjct: 46  PK 47

[180][TOP]
>UniRef100_B9DHX5 AT4G38770 protein (Fragment) n=1 Tax=Arabidopsis thaliana
           RepID=B9DHX5_ARATH
          Length = 277

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/129 (41%), Positives = 57/129 (44%), Gaps = 20/129 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP-PKKHY--------------VYKSPP-----PPVKHYSP 121
           K  PPPV  Y PPP    PPP PKK                VYK PP     PPV  Y P
Sbjct: 49  KEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKP 108

Query: 122 PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 301
           PP    PPP   H + K P PP K   PP   H PP  K     K  PPPV  + PPP  
Sbjct: 109 PPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKI 168

Query: 302 HSPPPPKKH 328
             PPP  +H
Sbjct: 169 VIPPPKIEH 177

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 56/118 (47%), Positives = 59/118 (50%), Gaps = 13/118 (11%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPPVYHSPPP-PKKHYVYK 172
           PPPV  Y PPP    PPP     VY  PP     PPV  Y PPP    PPP PKK    K
Sbjct: 22  PPPVPVYEPPPKKEIPPPVP---VYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPK 78

Query: 173 SP----PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY---HSPPPPKK 325
            P    PPPV  Y PPP    PPP     VYK PPP ++H  P PV+     P PPKK
Sbjct: 79  PPKIEHPPPVPVYKPPPKIEKPPPVP---VYK-PPPKIEHPPPVPVHKLPKKPCPPKK 132

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 55/127 (43%), Positives = 58/127 (45%), Gaps = 19/127 (14%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVKHY----SPPPVYHSPPPPK 154
           K  PPPV  Y PPP    PPP     VYK P     PPP+        PP + H PP P 
Sbjct: 34  KEIPPPVPVYDPPPKKEVPPPVP---VYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVP- 89

Query: 155 KHYVYKSP-----PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-- 313
              VYK P     PPPV  Y PPP    PPP   H + K P PP K   PP   H PP  
Sbjct: 90  ---VYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTK 146

Query: 314 ---PPKK 325
              PPKK
Sbjct: 147 KPCPPKK 153

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 56/132 (42%), Positives = 59/132 (44%), Gaps = 22/132 (16%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHY---- 163
           PPPV  Y PPP    PPP   H + K P PP K   PP   H PP     PPKK      
Sbjct: 100 PPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPV 159

Query: 164 -VYKSPP----PPVKHYSPPPVYHSPPPPKKHY--------VYKSPPPPVKHYSPPPVYH 304
            V+K PP    PP K   PPPV    PPPK  +        V K  PPPV  Y PP V  
Sbjct: 160 PVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIP 219

Query: 305 SPPPPKKHYVYK 340
             P P    VYK
Sbjct: 220 KKPCPPPVPVYK 231

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 53/123 (43%), Positives = 57/123 (46%), Gaps = 14/123 (11%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP----- 178
           PPV+   P PVY   PPPKK       PPPV  Y PPP    PPP     VYK P     
Sbjct: 17  PPVEVPPPVPVYE--PPPKKEI-----PPPVPVYDPPPKKEVPPPVP---VYKPPPKVEL 66

Query: 179 PPPVKHY----SPPPVYHSPPPPKKHYVYKSP-----PPPVKHYSPPPVYHSPPPPKKHY 331
           PPP+        PP + H PP P    VYK P     PPPV  Y PPP    PPP   H 
Sbjct: 67  PPPIPKKPCPPKPPKIEHPPPVP----VYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHK 122

Query: 332 VYK 340
           + K
Sbjct: 123 LPK 125

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 49/106 (46%), Positives = 49/106 (46%), Gaps = 13/106 (12%)
 Frame = +2

Query: 38  PPVYHSPPPPKKHYVYKSP---PPPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVK 193
           PP    P PPK    Y  P   PPPV  Y PPP    PPP     VY  P     PPPV 
Sbjct: 4   PPFLKKPCPPK----YSPPVEVPPPVPVYEPPPKKEIPPPVP---VYDPPPKKEVPPPVP 56

Query: 194 HYSPPPVYHSPPP-PKKHYVYKSP----PPPVKHYSPPPVYHSPPP 316
            Y PPP    PPP PKK    K P    PPPV  Y PPP    PPP
Sbjct: 57  VYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPP 102

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/107 (41%), Positives = 48/107 (44%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K  PPPV  + PPP    PPP  +H      PPPV  Y PPP    PP      V K  P
Sbjct: 153 KVDPPPVPVHKPPPKIVIPPPKIEH------PPPVPVYKPPPKIEHPPIYIPPIVKKPCP 206

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           PPV  Y PP V    P P    VYK P   +     PP+   PP PK
Sbjct: 207 PPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKPCPPLPQLPPLPK 253

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 40/103 (38%), Positives = 43/103 (41%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPPV  Y PPP    PP      V K  PPPV  Y PP V    P P    VYK P   +
Sbjct: 178 PPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVI 237

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PP+   PP P      K PP P K+   P     PP P
Sbjct: 238 PKKPCPPLPQLPPLP------KFPPLPPKYIHHPKFGKWPPLP 274

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/77 (46%), Positives = 36/77 (46%), Gaps = 9/77 (11%)
 Frame = +2

Query: 122 PPVYHSPPPPKKHYVYKSP---PPPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVK 277
           PP    P PPK    Y  P   PPPV  Y PPP    PPP     VY  P     PPPV 
Sbjct: 4   PPFLKKPCPPK----YSPPVEVPPPVPVYEPPPKKEIPPPVP---VYDPPPKKEVPPPVP 56

Query: 278 HYSPPPVYHSPPP-PKK 325
            Y PPP    PPP PKK
Sbjct: 57  VYKPPPKVELPPPIPKK 73

[181][TOP]
>UniRef100_Q9M7N8 Proline-rich protein 4 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7N8_ARATH
          Length = 448

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 59/120 (49%), Positives = 62/120 (51%), Gaps = 15/120 (12%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPPVYHSPPP-PKKHYVYK 172
           PPPV  Y PPP    PPP     VY  PP     PPV  Y PPP    PPP PKK    K
Sbjct: 193 PPPVPVYEPPPKKEIPPPVP---VYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPK 249

Query: 173 SP----PPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP----PPKK 325
            P    PPPV  Y PPP + H PP P    VYK PPP ++H  P PV H PP    PPKK
Sbjct: 250 PPKIEHPPPVPVYKPPPKIEHPPPVP----VYK-PPPKIEHPPPVPV-HKPPKKPCPPKK 303

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/114 (46%), Positives = 54/114 (47%), Gaps = 6/114 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           K  PPPV  Y PPP    PPP PKK      PP P K   PPPV    PPPK  +     
Sbjct: 220 KEVPPPVPVYKPPPKVELPPPIPKK----PCPPKPPKIEHPPPVPVYKPPPKIEH----- 270

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKK 325
           PPPV  Y PPP    PPP   H   K P PP K   PP   H PP     PPKK
Sbjct: 271 PPPVPVYKPPPKIEHPPPVPVHKPPKKPCPPKKVDPPPVPVHKPPTKKPCPPKK 324

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 53/133 (39%), Positives = 56/133 (42%), Gaps = 27/133 (20%)
 Frame = +2

Query: 11  PPPVKHYSPP-PVYHSPP----------------PPKKHY-----VYKSP-----PPPVK 109
           PPP K   PP PVY  PP                PPK  +     VYK P     PPPV 
Sbjct: 216 PPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEHPPPVP 275

Query: 110 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 289
            Y PPP    PPP   H   K P PP K   PP   H PP  K     K  PPPV  + P
Sbjct: 276 VYKPPPKIEHPPPVPVHKPPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKP 335

Query: 290 PPVYHSPPPPKKH 328
           PP    PPP  +H
Sbjct: 336 PPKIVIPPPKIEH 348

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 56/132 (42%), Positives = 58/132 (43%), Gaps = 22/132 (16%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHY---- 163
           PPPV  Y PPP    PPP   H   K P PP K   PP   H PP     PPKK      
Sbjct: 271 PPPVPVYKPPPKIEHPPPVPVHKPPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPV 330

Query: 164 -VYKSPP----PPVKHYSPPPVYHSPPPPKKHY--------VYKSPPPPVKHYSPPPVYH 304
            V+K PP    PP K   PPPV    PPPK  +        V K  PPPV  Y PP V  
Sbjct: 331 PVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIP 390

Query: 305 SPPPPKKHYVYK 340
             P P    VYK
Sbjct: 391 KKPCPPPVPVYK 402

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 52/115 (45%), Positives = 54/115 (46%), Gaps = 13/115 (11%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSP---PPPVKHYSPPPVYHSPPPPKKHYVYKSP- 178
           PPP++    PP    P PPK    Y  P   PPPV  Y PPP    PPP     VY  P 
Sbjct: 169 PPPLEL---PPFLKKPCPPK----YSPPVEVPPPVPVYEPPPKKEIPPPVP---VYDPPP 218

Query: 179 ----PPPVKHYSPPPVYHSPPP-PKKHYVYKSP----PPPVKHYSPPPVYHSPPP 316
               PPPV  Y PPP    PPP PKK    K P    PPPV  Y PPP    PPP
Sbjct: 219 KKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEHPPP 273

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/107 (41%), Positives = 48/107 (44%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K  PPPV  + PPP    PPP  +H      PPPV  Y PPP    PP      V K  P
Sbjct: 324 KVDPPPVPVHKPPPKIVIPPPKIEH------PPPVPVYKPPPKIEHPPIYIPPIVKKPCP 377

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           PPV  Y PP V    P P    VYK P   +     PP+   PP PK
Sbjct: 378 PPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKPCPPLPQLPPLPK 424

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 47/105 (44%), Positives = 51/105 (48%), Gaps = 1/105 (0%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 193
           PP K +  P  +  PPP +     K P PP   YSPP V   PP P    VY+ PP   K
Sbjct: 157 PPFKGFDHP--FPLPPPLELPPFLKKPCPP--KYSPP-VEVPPPVP----VYEPPP---K 204

Query: 194 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP-PKK 325
              PPPV    PPPKK       PPPV  Y PPP    PPP PKK
Sbjct: 205 KEIPPPVPVYDPPPKKEV-----PPPVPVYKPPPKVELPPPIPKK 244

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 40/103 (38%), Positives = 43/103 (41%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPPV  Y PPP    PP      V K  PPPV  Y PP V    P P    VYK P   +
Sbjct: 349 PPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVI 408

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PP+   PP P      K PP P K+   P     PP P
Sbjct: 409 PKKPCPPLPQLPPLP------KFPPLPPKYIHHPKFGKWPPLP 445

[182][TOP]
>UniRef100_B9RIB5 Extensin, proline-rich protein, putative n=1 Tax=Ricinus communis
           RepID=B9RIB5_RICCO
          Length = 144

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 55/99 (55%), Positives = 59/99 (59%), Gaps = 1/99 (1%)
 Frame = +2

Query: 5   SPPP-PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           SPPP P K+ SPPP   SPPPP   Y Y+SPPPP    SP     SPPPP   Y YKSPP
Sbjct: 32  SPPPLPYKYMSPPPPSPSPPPP---YYYQSPPPP----SP-----SPPPP---YYYKSPP 76

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
           PP     PPP   SP PP  +Y YKSPPPP    SP P+
Sbjct: 77  PPSPSPPPPP---SPSPPPPYY-YKSPPPP--SLSPHPL 109

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 43/80 (53%), Positives = 46/80 (57%), Gaps = 1/80 (1%)
 Frame = +2

Query: 83  YKSPPP-PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 259
           Y SPPP P K+ SPPP   SPPPP   Y Y+SPPPP     PP  Y SPPPP       S
Sbjct: 30  YSSPPPLPYKYMSPPPPSPSPPPP---YYYQSPPPPSPSPPPPYYYKSPPPPS-----PS 81

Query: 260 PPPPVKHYSPPPVYHSPPPP 319
           PPPP     PPP Y+  PPP
Sbjct: 82  PPPPPSPSPPPPYYYKSPPP 101

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 36/71 (50%), Positives = 38/71 (53%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPP     PP  Y SPPPP       SPPPP     P P   SPPPP   Y YKSPP
Sbjct: 57  QSPPPPSPSPPPPYYYKSPPPPS-----PSPPPP-----PSP---SPPPP---YYYKSPP 100

Query: 182 PPVKHYSPPPV 214
           PP    SP P+
Sbjct: 101 PP--SLSPHPL 109

[183][TOP]
>UniRef100_Q0IRA5 Os11g0657400 protein n=1 Tax=Oryza sativa Japonica Group
            RepID=Q0IRA5_ORYSJ
          Length = 1064

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 59/131 (45%), Positives = 64/131 (48%), Gaps = 23/131 (17%)
 Frame = +2

Query: 2    KSPP-PPVKHYSPP-PVYHSPPPPKK----------HYVYKSPPPPVKHYSPPPVYHSPP 145
            KSPP PP  H SPP P  ++P PPK           H   KSPP      SPPP   SPP
Sbjct: 748  KSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPP 807

Query: 146  PPKKHYVYKSPPPPVKHYSPP---------PVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
             P +     SPP P K  SPP         PV  S PPP+ H    S PPP K  SPPP 
Sbjct: 808  TPAEE---SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHV---SSPPPEKSSSPPPE 861

Query: 299  YH--SPPPPKK 325
             H  SPPPP+K
Sbjct: 862  AHVSSPPPPEK 872

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 54/118 (45%), Positives = 57/118 (48%), Gaps = 14/118 (11%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP---------PVYHSPPPPK 154
            KSPP      SPPP   SPP P +     SPP P K  SPP         PV  S PPP+
Sbjct: 788  KSPPSEAHPTSPPPSEKSPPTPAEE---SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPE 844

Query: 155  KHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH---YVYKSPPPPVKHYSPPPVYHSPP 313
             H    S PPP K  SPPP  H  SPPPP+K       KSPP      SPPP   SPP
Sbjct: 845  AHV---SSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPP 899

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 56/134 (41%), Positives = 61/134 (45%), Gaps = 23/134 (17%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPKKHYVYKSP 178
            KSPP P +  SPP    SP PP  H    +PP PVK  SPPP  H S PPP+K     SP
Sbjct: 804  KSPPTPAEESSPPTPEKSPSPPSGHE--GTPPSPVKSSSPPPEAHVSSPPPEKS---SSP 858

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVY------------KSPP--------PPVKHYSPP-- 292
            PP     SPPP   SPPPP+                 KSPP        PP K   PP  
Sbjct: 859  PPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPT 918

Query: 293  PVYHSPPPPKKHYV 334
            P   S PP  + YV
Sbjct: 919  PTPKSSPPSHEEYV 932

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/121 (42%), Positives = 58/121 (47%), Gaps = 13/121 (10%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYV----------YKSPPPPVKHYSPPPVYH--SPP 145
            KS PP  K    PP  H+ PP  + Y            KSPPP     SPP   H  SPP
Sbjct: 741  KSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPP 800

Query: 146  PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH-SPPPPK 322
            P +     KSPP P +  SPP    SP PP  H    +PP PVK  SPPP  H S PPP+
Sbjct: 801  PSE-----KSPPTPAEESSPPTPEKSPSPPSGH--EGTPPSPVKSSSPPPEAHVSSPPPE 853

Query: 323  K 325
            K
Sbjct: 854  K 854

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 55/129 (42%), Positives = 60/129 (46%), Gaps = 21/129 (16%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPPKKH--- 160
            KSP PP  H   PP  V  S PPP+ H    S PPP K  SPPP  H  SPPPP+K    
Sbjct: 820  KSPSPPSGHEGTPPSPVKSSSPPPEAHV---SSPPPEKSSSPPPEAHVSSPPPPEKSPPP 876

Query: 161  YVYKSPPPPVKHYSPPPVYHSPP--------PPKKHY------VYKSPPPPVKHYSPPPV 298
               KSPP      SPPP   SPP        PP K          KS PP  + Y PP  
Sbjct: 877  PETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSP 936

Query: 299  YHSPPPPKK 325
              S PPP++
Sbjct: 937  AKSTPPPEE 945

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 56/135 (41%), Positives = 61/135 (45%), Gaps = 26/135 (19%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVY----HSPPPPKKHYVY-KSPP-PPVKHYSPP-PVYHSPPPPKK- 157
            KSPP P    S PP      H+P PPK      KSPP PP  H SPP P  ++P PPK  
Sbjct: 715  KSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSS 774

Query: 158  ---------HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP------ 292
                     H   KSPP      SPPP   SPP P +     SPP P K  SPP      
Sbjct: 775  PPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEE---SSPPTPEKSPSPPSGHEGT 831

Query: 293  ---PVYHSPPPPKKH 328
               PV  S PPP+ H
Sbjct: 832  PPSPVKSSSPPPEAH 846

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 49/119 (41%), Positives = 60/119 (50%), Gaps = 12/119 (10%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSP 178
           +SP  P +  +P P   SP  P K  +   P P +K   SPP  Y +PPPP   ++ KSP
Sbjct: 466 ESPEEPPEEPTPSPTPSSPESPAK--MAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSP 523

Query: 179 ------PP---PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV--YHSPPPPK 322
                 PP   P   YSPP    S PPP+     KSPP P   +SPPPV   H+P PPK
Sbjct: 524 ERKKAPPPQAEPPTEYSPPATPESSPPPEG----KSPPTPTASHSPPPVPEGHTPSPPK 578

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 55/128 (42%), Positives = 58/128 (45%), Gaps = 22/128 (17%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVY----HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSPPPPK 154
            KSPP P    S PP      H P PPK    V KSPP P    S    P P  H+P PPK
Sbjct: 682  KSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPK 741

Query: 155  KH-YVYKSPP-PPVKHYSPP-PVYHSPPPPKK----------HYVYKSPPPPVKHYSPPP 295
                  KSPP PP  H SPP P  ++P PPK           H   KSPP      SPPP
Sbjct: 742  SSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPP 801

Query: 296  VYHSPPPP 319
               SPP P
Sbjct: 802  SEKSPPTP 809

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/114 (41%), Positives = 55/114 (48%), Gaps = 6/114 (5%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            KS PP  + Y PP    S PPP++    KSPP      S PP   S PPP      KS P
Sbjct: 922  KSSPPSHEEYVPPSPAKSTPPPEE----KSPPSHTPESSSPPSEESEPPPSP--TPKSSP 975

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVKHYSPP-PVYHSPPPPKK 325
            P  + Y PP    S PPP+K     +P     PP  + Y PP PV  SPPP +K
Sbjct: 976  PSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEK 1029

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/120 (40%), Positives = 58/120 (48%), Gaps = 12/120 (10%)
 Frame = +2

Query: 8   PPPPVKHY-SPPPVYHSPPPPKKHYVYKSP------PP---PVKHYSPPPVYHSPPPPKK 157
           P P +K   SPP  Y +PPPP   ++ KSP      PP   P   YSPP    S PPP+ 
Sbjct: 494 PAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEG 553

Query: 158 HYVYKSPPPPVKHYSPPPVY--HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
               KSPP P   +SPPPV   H+P PPK      S PP  +    P    SPPP  + Y
Sbjct: 554 ----KSPPTPTASHSPPPVPEGHTPSPPK------SGPPAGESPPTPESKASPPPTPEEY 603

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 57/124 (45%), Positives = 61/124 (49%), Gaps = 17/124 (13%)
 Frame = +2

Query: 2    KSPPPPV-KHYSPPPVY---HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSPPPPK 154
            KSPP P  K  SPPP     H+P PPK      KSPP P    S    P P  H P PPK
Sbjct: 649  KSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPK 708

Query: 155  K-HYVYKSPPPPVKHYS----PPPVYHSPPPPKKH-YVYKSPP-PPVKHYSPP-PVYHSP 310
                V KSPP P    S    P P  H+P PPK      KSPP PP  H SPP P  ++P
Sbjct: 709  STPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTP 768

Query: 311  PPPK 322
             PPK
Sbjct: 769  SPPK 772

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 49/135 (36%), Positives = 58/135 (42%), Gaps = 28/135 (20%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVY--HSPPPPKKH----------YVYKSPPPPVKHYSPPPVYHSPP 145
           KSPP P   +SPPPV   H+P PPK                SPPP  + Y+P P   +PP
Sbjct: 554 KSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPP 613

Query: 146 ----PPKKHYVYKSPPPPVKH-YSPPPVYHSPP----PPKKHYVYKSPPPPVKH------ 280
               PP       SPPPP    ++P P   +PP    PP       SPPPP         
Sbjct: 614 AEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSP 673

Query: 281 -YSPPPVYHSPPPPK 322
             S PP   SPP P+
Sbjct: 674 PKSTPPTEKSPPTPE 688

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 55/139 (39%), Positives = 61/139 (43%), Gaps = 29/139 (20%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYH--SPPPPKKHYV---YKSPPPPVKHYSPPPVYHSPP-------- 145
            S PPP K  SPPP  H  SPPPP+K       KSPP      SPPP   SPP        
Sbjct: 848  SSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSS 907

Query: 146  PPKKHY------VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP--------PPVKHY 283
            PP K          KS PP  + Y PP    S PPP++    KSPP        PP +  
Sbjct: 908  PPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEE----KSPPSHTPESSSPPSEES 963

Query: 284  SPPP--VYHSPPPPKKHYV 334
             PPP     S PP  + YV
Sbjct: 964  EPPPSPTPKSSPPSHEEYV 982

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/127 (36%), Positives = 56/127 (44%), Gaps = 21/127 (16%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKH-YSPPPVYHSPP----PPKK 157
           SPPP  + Y+P P   +PP    PP       SPPPP    ++P P   +PP    PP  
Sbjct: 595 SPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTP 654

Query: 158 HYVYKSPPPPVKH-YSPPPVYHSPP----PPKKHYVYKSPPPPVKH-------YSPPPVY 301
                SPPPP    ++P P   +PP    PP       SPPPP           S PPV 
Sbjct: 655 ESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVE 714

Query: 302 HSPPPPK 322
            SPP P+
Sbjct: 715 KSPPTPE 721

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 45/109 (41%), Positives = 50/109 (45%), Gaps = 1/109 (0%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSP 178
            KSPP      S PP   S PPP      KS PP  + Y PP P   +PPP +     KSP
Sbjct: 896  KSPPSHTPESSSPPSKESEPPPTP--TPKSSPPSHEEYVPPSPAKSTPPPEE-----KSP 948

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            P      S PP   S PPP      KS PP  + Y PP    S PPP+K
Sbjct: 949  PSHTPESSSPPSEESEPPPSP--TPKSSPPSHEEYVPPSPAKSTPPPEK 995

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 44/112 (39%), Positives = 51/112 (45%), Gaps = 5/112 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           SPPP  K    P   HSPPP P+ H    +P PP    S PP   SPP P+      SPP
Sbjct: 548 SPPPEGKSPPTPTASHSPPPVPEGH----TPSPP---KSGPPAGESPPTPESK---ASPP 597

Query: 182 PPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           P  + Y+P P   +PP    PP       SPPPP      P    S PP +K
Sbjct: 598 PTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEK 649

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 56/126 (44%), Positives = 60/126 (47%), Gaps = 19/126 (15%)
 Frame = +2

Query: 2   KSPPPPV-KHYSPPPVY---HSPPPPKK-HYVYKSPP-PPVKHYSPPPVY---HSPPPPK 154
           KSPP P  K  SPPP     H+P PP+      KSPP P  K  SPPP     H+P PPK
Sbjct: 616 KSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPK 675

Query: 155 K-HYVYKSPPPPVKHYS----PPPVYHSPPPPKK-HYVYKSPPPPVKHYS----PPPVYH 304
                 KSPP P    S    P P  H P PPK    V KSPP P    S    P P  H
Sbjct: 676 STPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGH 735

Query: 305 SPPPPK 322
           +P PPK
Sbjct: 736 TPSPPK 741

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 54/124 (43%), Positives = 60/124 (48%), Gaps = 17/124 (13%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPV--YHSPPPPKK-HYVYKSPP-PPVKHYSPPPVY---HSPPPPKK- 157
           +SPP P    SPPP    ++P PPK      KSPP P  K  SPPP     H+P PP+  
Sbjct: 585 ESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPEST 644

Query: 158 HYVYKSPP-PPVKHYSPPPVY---HSPPPPKK-HYVYKSPPPPVKHYS----PPPVYHSP 310
               KSPP P  K  SPPP     H+P PPK      KSPP P    S    P P  H P
Sbjct: 645 PPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMP 704

Query: 311 PPPK 322
            PPK
Sbjct: 705 SPPK 708

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 40/98 (40%), Positives = 47/98 (47%), Gaps = 6/98 (6%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP- 178
            KSPP      S PP   S PPP      KS PP  + Y PP    S PPP+K     +P 
Sbjct: 946  KSPPSHTPESSSPPSEESEPPPSP--TPKSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPT 1003

Query: 179  ----PPPVKHYSPP-PVYHSPPPPKKHYVYKSPPPPVK 277
                PP  + Y PP PV  SPPP +K    + PP PV+
Sbjct: 1004 INSSPPSEEEYMPPSPVKSSPPPAEKS---QPPPSPVE 1038

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 45/123 (36%), Positives = 55/123 (44%), Gaps = 17/123 (13%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVY------HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           PP     Y  PP        H PPPP++    +SP  P +  +P P   SP  P K  + 
Sbjct: 438 PPEKSPAYEEPPAAPSTPTSHGPPPPEE----ESPEEPPEEPTPSPTPSSPESPAK--MA 491

Query: 170 KSPPPPVKHY-SPPPVYHSPPPPKKHYVYKSP------PP---PVKHYSPPPV-YHSPPP 316
             P P +K   SPP  Y +PPPP   ++ KSP      PP   P   YSPP     SPPP
Sbjct: 492 PPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPP 551

Query: 317 PKK 325
             K
Sbjct: 552 EGK 554

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 45/135 (33%), Positives = 55/135 (40%), Gaps = 29/135 (21%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPP-PPKKHYVYKSPPP----PVKHYSPPPVYHSPPPPKKHYV- 166
           +P  P +    PP+   P  PP+K   Y+ PP     P  H  PPP   SP  P +    
Sbjct: 418 TPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHGPPPPEEESPEEPPEEPTP 477

Query: 167 ----------YKSPPPPVKHY----SPPPVYHSPPPPKKHYVYKSP-----PP----PVK 277
                      K  PPP        SPP  Y +PPPP   ++ KSP     PP    P  
Sbjct: 478 SPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPT 537

Query: 278 HYSPPPVYHSPPPPK 322
            YSPP    S PPP+
Sbjct: 538 EYSPPATPESSPPPE 552

[184][TOP]
>UniRef100_B8A7W6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A7W6_ORYSI
          Length = 512

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/117 (43%), Positives = 54/117 (46%), Gaps = 14/117 (11%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           P P K  +P    HSPPPP      +SPPPP    SPP    SPPP        SPPPP 
Sbjct: 400 PAPAKKPAPESSKHSPPPPPPPAPVQSPPPPAPVVSPPSPVFSPPPA------FSPPPPP 453

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--------------VYHSPPPP 319
           K   PPPV   PPPP   +   SPPPP    SPPP               Y SPPPP
Sbjct: 454 KTSPPPPVSSPPPPPPPAF---SPPPPPPTMSPPPPIQEPVILPPILSAKYQSPPPP 507

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/92 (47%), Positives = 47/92 (51%), Gaps = 2/92 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPP    SPP    SPPP        SPPPP K   PPPV   PPPP   +   SPP
Sbjct: 425 QSPPPPAPVVSPPSPVFSPPPA------FSPPPPPKTSPPPPVSSPPPPPPPAF---SPP 475

Query: 182 PPVKHYSPPPVYHSPP--PPKKHYVYKSPPPP 271
           PP    SPPP    P   PP     Y+SPPPP
Sbjct: 476 PPPPTMSPPPPIQEPVILPPILSAKYQSPPPP 507

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/76 (46%), Positives = 41/76 (53%), Gaps = 5/76 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPV--YHSPPPPKKHYVY 169
           SPP PV  +SPPP +  PPPPK      V   PPPP   +SPPP     SPPPP +  V 
Sbjct: 435 SPPSPV--FSPPPAFSPPPPPKTSPPPPVSSPPPPPPPAFSPPPPPPTMSPPPPIQEPVI 492

Query: 170 KSPPPPVKHYSPPPVY 217
             P    K+ SPPP +
Sbjct: 493 LPPILSAKYQSPPPPF 508

[185][TOP]
>UniRef100_Q9M6T6 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9M6T6_ARATH
          Length = 448

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/114 (46%), Positives = 54/114 (47%), Gaps = 6/114 (5%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPP-PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           K  PPPV  Y PPP    PPP PKK      PP P K   PPPV    PPPK  +     
Sbjct: 220 KEVPPPVPVYKPPPKVELPPPIPKK----PCPPKPPKIEHPPPVPVFKPPPKIEH----- 270

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKK 325
           PPPV  Y PPP    PPP   H   K P PP K   PP   H PP     PPKK
Sbjct: 271 PPPVPVYKPPPKIEHPPPVPVHKPPKKPCPPKKVDPPPVPVHKPPTKKPCPPKK 324

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 58/120 (48%), Positives = 62/120 (51%), Gaps = 15/120 (12%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPP-----PPVKHYSPPPVYHSPPP-PKKHYVYK 172
           PPPV  Y PPP    PPP     VY  PP     PPV  Y PPP    PPP PKK    K
Sbjct: 193 PPPVPVYEPPPKKEIPPPVP---VYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPK 249

Query: 173 SP----PPPVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP----PPKK 325
            P    PPPV  + PPP + H PP P    VYK PPP ++H  P PV H PP    PPKK
Sbjct: 250 PPKIEHPPPVPVFKPPPKIEHPPPVP----VYK-PPPKIEHPPPVPV-HKPPKKPCPPKK 303

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 56/132 (42%), Positives = 58/132 (43%), Gaps = 22/132 (16%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-----PPKKHY---- 163
           PPPV  Y PPP    PPP   H   K P PP K   PP   H PP     PPKK      
Sbjct: 271 PPPVPVYKPPPKIEHPPPVPVHKPPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPV 330

Query: 164 -VYKSPP----PPVKHYSPPPVYHSPPPPKKHY--------VYKSPPPPVKHYSPPPVYH 304
            V+K PP    PP K   PPPV    PPPK  +        V K  PPPV  Y PP V  
Sbjct: 331 PVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIP 390

Query: 305 SPPPPKKHYVYK 340
             P P    VYK
Sbjct: 391 KKPCPPPVPVYK 402

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/133 (39%), Positives = 56/133 (42%), Gaps = 27/133 (20%)
 Frame = +2

Query: 11  PPPVKHYSPP-PVYHSPP----------------PPKKHY-----VYKSP-----PPPVK 109
           PPP K   PP PVY  PP                PPK  +     V+K P     PPPV 
Sbjct: 216 PPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVFKPPPKIEHPPPVP 275

Query: 110 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 289
            Y PPP    PPP   H   K P PP K   PP   H PP  K     K  PPPV  + P
Sbjct: 276 VYKPPPKIEHPPPVPVHKPPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKP 335

Query: 290 PPVYHSPPPPKKH 328
           PP    PPP  +H
Sbjct: 336 PPKIVIPPPKIEH 348

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 51/115 (44%), Positives = 54/115 (46%), Gaps = 13/115 (11%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSP---PPPVKHYSPPPVYHSPPPPKKHYVYKSP- 178
           PPP++    PP    P PPK    Y  P   PPPV  Y PPP    PPP     VY  P 
Sbjct: 169 PPPLEL---PPFLKKPCPPK----YSPPVEVPPPVPVYEPPPKKEIPPPVP---VYDPPP 218

Query: 179 ----PPPVKHYSPPPVYHSPPP-PKKHYVYKSP----PPPVKHYSPPPVYHSPPP 316
               PPPV  Y PPP    PPP PKK    K P    PPPV  + PPP    PPP
Sbjct: 219 KKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVFKPPPKIEHPPP 273

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/107 (41%), Positives = 48/107 (44%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           K  PPPV  + PPP    PPP  +H      PPPV  Y PPP    PP      V K  P
Sbjct: 324 KVDPPPVPVHKPPPKIVIPPPKIEH------PPPVPVYKPPPKIEHPPIYIPPIVKKPCP 377

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           PPV  Y PP V    P P    VYK P   +     PP+   PP PK
Sbjct: 378 PPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKPCPPLPQLPPLPK 424

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 47/105 (44%), Positives = 51/105 (48%), Gaps = 1/105 (0%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 193
           PP K +  P  +  PPP +     K P PP   YSPP V   PP P    VY+ PP   K
Sbjct: 157 PPFKGFDHP--FPLPPPLELPPFLKKPCPP--KYSPP-VEVPPPVP----VYEPPP---K 204

Query: 194 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP-PKK 325
              PPPV    PPPKK       PPPV  Y PPP    PPP PKK
Sbjct: 205 KEIPPPVPVYDPPPKKEV-----PPPVPVYKPPPKVELPPPIPKK 244

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 40/103 (38%), Positives = 43/103 (41%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPPV  Y PPP    PP      V K  PPPV  Y PP V    P P    VYK P   +
Sbjct: 349 PPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVI 408

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                PP+   PP P      K PP P K+   P     PP P
Sbjct: 409 PKKPCPPLPQLPPLP------KFPPLPPKYIHHPKFGKWPPLP 445

[186][TOP]
>UniRef100_UPI000198347D PREDICTED: hypothetical protein isoform 2 n=1 Tax=Vitis vinifera
           RepID=UPI000198347D
          Length = 217

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 58/128 (45%), Positives = 64/128 (50%), Gaps = 24/128 (18%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPP---PPKKHY----VYKSPP---PPVKHYSPPPVYHSPP---PP 151
           PPP +H  P PVY SPP   PP ++     VYK PP   PP   Y PPPV   PP   PP
Sbjct: 27  PPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPPEYKPP 86

Query: 152 KKHYVYKSPP---PPVKHYSPPPVYHSPPPPKKHYVYK-----SPPPPVKHYS---PPPV 298
               VYK PP   PP ++  P PVY  PP  K    YK      PPPP KH +   PP V
Sbjct: 87  TP--VYKPPPVEKPPPEYKPPTPVYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRV 144

Query: 299 YHSPPPPK 322
              PP PK
Sbjct: 145 VRPPPTPK 152

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 53/123 (43%), Positives = 60/123 (48%), Gaps = 17/123 (13%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPP---PPVKHYSPPPVYHSPP---PPKKHYVYK 172
           P     + PPP  H PP P    VYKSPP   PP ++  P PVY  PP   PP    VY+
Sbjct: 19  PSLANDHKPPPYEHKPPLP----VYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTP--VYR 72

Query: 173 SPP---PPVKHYSPPPVYHSPPPPKKHYVYKSP-----PPPVKHYSP---PPVYHSPPPP 319
            PP   PP ++  P PVY  PP  K    YK P     PPPV+   P   PP    PPPP
Sbjct: 73  PPPVEKPPPEYKPPTPVYKPPPVEKPPPEYKPPTPVYKPPPVEKPPPEYKPPTPVKPPPP 132

Query: 320 KKH 328
            KH
Sbjct: 133 PKH 135

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 54/126 (42%), Positives = 60/126 (47%), Gaps = 16/126 (12%)
 Frame = +2

Query: 2   KSPP---PPVKHYSPPPVYHSPP---PPKKHYVYKSPP---PPVKHYSPPPVYHSPPPPK 154
           K PP   PP   Y PPPV   PP   PP    VYK PP   PP ++  P PVY  PP  K
Sbjct: 59  KPPPVEKPPTPVYRPPPVEKPPPEYKPPTP--VYKPPPVEKPPPEYKPPTPVYKPPPVEK 116

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPP----- 313
               YK PP PVK   PPP  H  P  PP+   V + PP P     PP +   PP     
Sbjct: 117 PPPEYK-PPTPVK--PPPPPKHKTPTLPPR---VVRPPPTPKPPTLPPIIVRPPPTKEPS 170

Query: 314 PPKKHY 331
           PP+ HY
Sbjct: 171 PPQGHY 176

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/96 (41%), Positives = 47/96 (48%), Gaps = 9/96 (9%)
 Frame = +2

Query: 80  VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP---PPVKHYSPPPVYHSPP---PPKK 241
           V  + P     + PPP  H PP P    VYKSPP   PP ++  P PVY  PP   PP  
Sbjct: 14  VVLTTPSLANDHKPPPYEHKPPLP----VYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTP 69

Query: 242 HYVYKSPP---PPVKHYSPPPVYHSPPPPKKHYVYK 340
             VY+ PP   PP ++  P PVY  PP  K    YK
Sbjct: 70  --VYRPPPVEKPPPEYKPPTPVYKPPPVEKPPPEYK 103

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 42/115 (36%), Positives = 47/115 (40%), Gaps = 9/115 (7%)
 Frame = +2

Query: 11  PPPVKHYSP---PPVYHSPPPPKKHYV------YKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           PPPV+   P   PP    PPPP KH           PPP  K  + PP+   PPP K+  
Sbjct: 111 PPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTKE-- 168

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
               P PP  HY   P   +PP       YK PP P K    P   H   PP  H
Sbjct: 169 ----PSPPQGHYPGHPPVETPPSTP----YKKPPTPEKKPWAPHHKHFKAPPPIH 215

[187][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/106 (48%), Positives = 51/106 (48%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP    SPPP   SP PP       SPPPP    SPPP   SP PP        PPP
Sbjct: 1758 SPPPPSLSPSPPPPSTSPSPPPPS-ASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPP 1816

Query: 185  PVKHYSPPP-VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P     PPP    SPPPP       SPPPP    SPPP   SP PP
Sbjct: 1817 PASPSPPPPSASPSPPPPSSS---PSPPPPSSSPSPPPPSLSPSPP 1859

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 54/107 (50%), Positives = 55/107 (51%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP    SPPP   SPPPP       SPPPP    SPPP   SP PP       SPPP
Sbjct: 1740 SPPPPSPPPSPPP---SPPPP-------SPPPPSLSPSPPPPSTSPSPPPPS-ASPSPPP 1788

Query: 185  PVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P    SPPP  +  SPPPP       SPPPP    SPPP   SP PP
Sbjct: 1789 PSASPSPPPPSLSPSPPPPS---TSPSPPPPPASPSPPPPSASPSPP 1832

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 52/105 (49%), Positives = 53/105 (50%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP    SPPP   SP PP       SPPPP    SPPP   SP PP    +  SPPP
Sbjct: 1753 SPPPP----SPPPPSLSPSPPPPS-TSPSPPPPSASPSPPPPSASPSPPPPS-LSPSPPP 1806

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P    SPPP   SP PP       SPPPP    SPPP   SP PP
Sbjct: 1807 PSTSPSPPPPPASPSPPPPS-ASPSPPPPSSSPSPPPPSSSPSPP 1850

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/110 (43%), Positives = 53/110 (48%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP    SPPP   SP PP    +  SPPPP    SPPP   SP PP       SPPP
Sbjct: 1776 SPPPPSASPSPPPPSASPSPPPPS-LSPSPPPPSTSPSPPPPPASPSPPPPS-ASPSPPP 1833

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
            P    SPPP   SP PP        PP P     PPP   +PP P + ++
Sbjct: 1834 PSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPPPSPPTPPAPPRPFL 1883

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 52/107 (48%), Positives = 55/107 (51%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SP PP    +  SPPPP    SPPP   SPPPP         PP
Sbjct: 261 SPPPPSVSPSPPPPSLSPSPPPPS-LSPSPPPPSLSPSPPP---SPPPPSTSPSPPPRPP 316

Query: 185 PVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP  +  SPPPP    +  SPPPP    SPPP   SP PP
Sbjct: 317 PSASPSPPPPSLSPSPPPPS---LSPSPPPPSLSPSPPPPSFSPSPP 360

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/107 (49%), Positives = 53/107 (49%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP    SPPP   SP PP       SPPPP    SPPP   SP PP       SPPP
Sbjct: 1767 SPPPPSTSPSPPPPSASPSPPPPS-ASPSPPPPSLSPSPPPPSTSPSPPPPP-ASPSPPP 1824

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVYHSPPPP 319
            P    SPPP   SP PP       SPPPP    SPP  P   SPPPP
Sbjct: 1825 PSASPSPPPPSSSPSPPPPS-SSPSPPPPSLSPSPPPSPPPSSPPPP 1870

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/109 (48%), Positives = 57/109 (52%), Gaps = 4/109 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           SPPPP    SPPP  +  SPPPP    +  SPPPP    SPPP   SP PP    +  SP
Sbjct: 234 SPPPPSLSPSPPPPSISPSPPPPS---LSPSPPPPSVSPSPPPPSLSPSPPPPS-LSPSP 289

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPP 319
           PPP    SPPP   SPPPP         PPP    SPPP  +  SPPPP
Sbjct: 290 PPPSLSPSPPP---SPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPP 335

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/105 (49%), Positives = 54/105 (51%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            +PPPP+    PPP   SPPPP       SPPPP    SPPP   SPPPP       SPPP
Sbjct: 1722 NPPPPLP---PPPSPPSPPPP-------SPPPPSPPPSPPP---SPPPP-------SPPP 1761

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P    SPPP   SP PP       SPPPP    SPPP   SP PP
Sbjct: 1762 PSLSPSPPPPSTSPSPPPPS-ASPSPPPPSASPSPPPPSLSPSPP 1805

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/105 (48%), Positives = 53/105 (50%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP         PPP    SPPP   SP PP    +  SPPP
Sbjct: 288 SPPPPSLSPSPPP---SPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPS-LSPSPPP 343

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP   SP PP    +  SPPP     SPPP   SPPPP
Sbjct: 344 PSLSPSPPPPSFSPSPPPPS-LSPSPPPATPPPSPPP--PSPPPP 385

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 51/112 (45%), Positives = 54/112 (48%), Gaps = 7/112 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP-----VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           SPPPP    SPPP        SPPPP    +  SPPPP    SPPP   SP PP   +  
Sbjct: 301 SPPPPSTSPSPPPRPPPSASPSPPPPS---LSPSPPPPSLSPSPPPPSLSPSPPPPSF-S 356

Query: 170 KSPPPPVKHYSPPPVY--HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            SPPPP    SPPP     SPPPP        PP P     PPP+   PPPP
Sbjct: 357 PSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPLPPPPI---PPPP 405

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 52/108 (48%), Positives = 57/108 (52%), Gaps = 4/108 (3%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPP 181
           P PP     PP    SPPPP    +  SPPPP    SPPP  +  SPPPP    +  SPP
Sbjct: 212 PSPP--SLPPPSASPSPPPPS---LSPSPPPPSLSPSPPPPSISPSPPPPS---LSPSPP 263

Query: 182 PPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP    SPPP  +  SPPPP    +  SPPPP    SPPP   SPPPP
Sbjct: 264 PPSVSPSPPPPSLSPSPPPPS---LSPSPPPPSLSPSPPP---SPPPP 305

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 54/113 (47%), Positives = 56/113 (49%), Gaps = 8/113 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           S PPP    SPPP   SP PP    +  SPPPP    SPPP   SP PP    V  SPPP
Sbjct: 216 SLPPPSASPSPPPPSLSPSPPPPS-LSPSPPPPSISPSPPPPSLSPSPPPPS-VSPSPPP 273

Query: 185 PVKHYSPPP--VYHSPPPPK-KHYVYKSPPPPVKHYSPPP-----VYHSPPPP 319
           P    SPPP  +  SPPPP        SPPPP    SPPP        SPPPP
Sbjct: 274 PSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPP 326

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/106 (48%), Positives = 56/106 (52%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            +SPPPP+    PPP+   PPPP       +PPPP+    PPP   SPPPP       SPP
Sbjct: 1706 QSPPPPLP---PPPL---PPPP-------NPPPPLP---PPPSPPSPPPP-------SPP 1742

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PP    SPPP   SPPPP       SPPPP    SPPP   SP PP
Sbjct: 1743 PPSPPPSPPP---SPPPP-------SPPPPSLSPSPPPPSTSPSPP 1778

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/105 (46%), Positives = 52/105 (49%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SP PP   +   SPPPP    SPPP    P PP       SPPP
Sbjct: 331 SPPPPSLSPSPPPPSLSPSPPPPSFS-PSPPPPSLSPSPPPATPPPSPPPP-----SPPP 384

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P+    PPP   SPPPP        PPPP+    PPP    PPPP
Sbjct: 385 PLP---PPP---SPPPP-------LPPPPI----PPPPSPPPPPP 412

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 53/109 (48%), Positives = 56/109 (51%), Gaps = 4/109 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSP 178
           SPP P    SPP    S PPP       SPPPP    SPPP  +  SPPPP    +  SP
Sbjct: 204 SPPYPPSLPSPP----SLPPPSAS---PSPPPPSLSPSPPPPSLSPSPPPPS---ISPSP 253

Query: 179 PPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPP    SPPP  V  SPPPP    +  SPPPP    SPPP   SP PP
Sbjct: 254 PPPSLSPSPPPPSVSPSPPPPS---LSPSPPPPSLSPSPPPPSLSPSPP 299

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 47/103 (45%), Positives = 49/103 (47%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP    SPPP   SP PP    +  SPPPP    SPPP   SP PP    +  SPPP  
Sbjct: 315 PPPSASPSPPPPSLSPSPPPPS-LSPSPPPPSLSPSPPPPSFSPSPPPPS-LSPSPPPAT 372

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              SPPP   SPPPP        PP P     PPP    PPPP
Sbjct: 373 PPPSPPP--PSPPPPLPPPPSPPPPLPPPPIPPPPSPPPPPPP 413

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 52/106 (49%), Positives = 53/106 (50%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP    SPPP   SPPP        SPPPP    SPPP   SPPPP       SPPP
Sbjct: 1535 SPPPP----SPPPPSPSPPP--------SPPPP----SPPP---SPPPP-------SPPP 1568

Query: 185  PVKHYSPPPVYHSP-PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P+    PPPV  SP PPP         PPP    SPPP    PPPP
Sbjct: 1569 PL---PPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPP 1611

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 52/106 (49%), Positives = 54/106 (50%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP-PPPKKHYVYKSPP 181
            SPPPP    SPPP   SPPPP       SPPPP+    PPPV  SP PPP         P
Sbjct: 1551 SPPPP----SPPP---SPPPP-------SPPPPL---PPPPVPPSPLPPPSPPPSPPPSP 1593

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PP    SPPP    PPPP       SPPPP+    PPPV   PPPP
Sbjct: 1594 PPSPPPSPPPPLPLPPPP-------SPPPPL---PPPPV---PPPP 1626

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 48/115 (41%), Positives = 49/115 (42%), Gaps = 10/115 (8%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP----------PVYHSPPPPK 154
            SPPP      PPP    P PP       +PPPP    SPP          P   SPPPP 
Sbjct: 1657 SPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPP----SPPPPNAPSPSSMPPSQSPPPPL 1712

Query: 155  KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                   PP P     PPP   SPPPP       SPPPP    SPPP   SPPPP
Sbjct: 1713 PPPPLPPPPNPPPPLPPPPSPPSPPPP-------SPPPPSPPPSPPP---SPPPP 1757

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/105 (43%), Positives = 51/105 (48%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            +PPPP    +PPP   SPPP        SPPP     SPPP   +PPPP       +PPP
Sbjct: 750  APPPPAPPPAPPP---SPPPSPPPSPPPSPPP-----SPPP--PTPPPP-------APPP 792

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P    SPPP    P PP       +PPPP    SPPP    PPPP
Sbjct: 793  PTPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLPPPP 833

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/105 (43%), Positives = 50/105 (47%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            +PPPP    SPPP    P PP       +PPPP    SPPP    PPPP       SPPP
Sbjct: 789  APPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLPPPP-------SPPP 837

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P+    PPP+   PPPP        PPPP    SPPP     PPP
Sbjct: 838  PL---PPPPL---PPPP-------LPPPPSPPPSPPPSPPPSPPP 869

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/105 (43%), Positives = 50/105 (47%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            +PPPP    SPPP    P PP       +PPPP    SPPP    PPPP       SPPP
Sbjct: 1058 APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLPPPP-------SPPP 1106

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P+    PPP+   PPPP        PPPP    SPPP     PPP
Sbjct: 1107 PL---PPPPL---PPPP-------LPPPPSPPPSPPPSPPPSPPP 1138

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 50/105 (47%), Positives = 53/105 (50%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPP        SPPPP    SPPP   SPPPP        PPP
Sbjct: 679 SPPPP----SPPPPSPSPPP--------SPPPPSPPPSPPP--PSPPPPLP--PPPLPPP 722

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P+   SPPP     PPP       SPPPP    +PPP   +PPPP
Sbjct: 723 PLPPPSPPPSPPPSPPP-------SPPPP----TPPP--PAPPPP 754

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/107 (44%), Positives = 53/107 (49%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSP 178
            +PPPP    SPPP    PPPP       SPPPP+      PPP+   PPPP         
Sbjct: 817  NPPPP----SPPPPLPLPPPP-------SPPPPLPPPPLPPPPL---PPPPSPPPSPPPS 862

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPP    SPPP   +PPPP       +PPPP    SPPP   SPPPP
Sbjct: 863  PPPSPPPSPPPP--TPPPP-------APPPPAPPPSPPP---SPPPP 897

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/107 (44%), Positives = 53/107 (49%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSP 178
            +PPPP    SPPP    PPPP       SPPPP+      PPP+   PPPP         
Sbjct: 995  NPPPP----SPPPPLPLPPPP-------SPPPPLPPPPLPPPPL---PPPPSPPPSPPPS 1040

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPP    SPPP   +PPPP       +PPPP    SPPP   SPPPP
Sbjct: 1041 PPPSPPPSPPPP--TPPPP-------APPPPAPPPSPPP---SPPPP 1075

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/107 (44%), Positives = 53/107 (49%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSP 178
            +PPPP    SPPP    PPPP       SPPPP+      PPP+   PPPP         
Sbjct: 1086 NPPPP----SPPPPLPLPPPP-------SPPPPLPPPPLPPPPL---PPPPSPPPSPPPS 1131

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPP    SPPP   +PPPP       +PPPP    SPPP   SPPPP
Sbjct: 1132 PPPSPPPSPPPP--TPPPP-------APPPPAPPPSPPP---SPPPP 1166

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 47/106 (44%), Positives = 49/106 (46%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSP-PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            SPPPP+    PPPV  SP PPP         PPP    SPPP    PPPP       SPP
Sbjct: 1565 SPPPPLP---PPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPP-------SPP 1614

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PP+    PPP    PP P        PPPP    SPPP     PPP
Sbjct: 1615 PPL----PPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 1656

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 48/106 (45%), Positives = 52/106 (49%), Gaps = 2/106 (1%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           PPPP+   SPPP     PPP       SPPPP    +PPP   +PPPP         PPP
Sbjct: 720 PPPPLPPPSPPPSPPPSPPP-------SPPPP----TPPP--PAPPPPAPPPAPPPSPPP 766

Query: 188 VKHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               SPPP   SPP  PP       +PPPP    SPPP   SPPPP
Sbjct: 767 SPPPSPPP---SPPPSPPPPTPPPPAPPPPTPPPSPPP---SPPPP 806

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 47/103 (45%), Positives = 51/103 (49%)
 Frame = +2

Query: 11   PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
            PPP    SPPP   SPPPP       +PPPP    SPPP    P PP       +PPPP 
Sbjct: 768  PPPSPPPSPPP---SPPPPTPPP--PAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPP- 821

Query: 191  KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               SPPP    PPPP       SPPPP+    PPP+   PPPP
Sbjct: 822  ---SPPPPLPLPPPP-------SPPPPL---PPPPL---PPPP 848

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 46/107 (42%), Positives = 51/107 (47%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5    SPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
            SPPPP+      PPP+   PPPP         PPP    SPPP   +PPPP       +P
Sbjct: 834  SPPPPLPPPPLPPPPL---PPPPSPPPSPPPSPPPSPPPSPPPP--TPPPP-------AP 881

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPP    SPPP    P PP       +PPPP    SPPP    PPPP
Sbjct: 882  PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLPPPP 924

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 47/103 (45%), Positives = 51/103 (49%)
 Frame = +2

Query: 11   PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
            PPP    SPPP   SPPPP       +PPPP    SPPP    P PP       +PPPP 
Sbjct: 859  PPPSPPPSPPP---SPPPPTPPP--PAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP- 912

Query: 191  KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               SPPP    PPPP       SPPPP+    PPP+   PPPP
Sbjct: 913  ---SPPPPLPLPPPP-------SPPPPL---PPPPL---PPPP 939

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 46/107 (42%), Positives = 51/107 (47%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5    SPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
            SPPPP+      PPP+   PPPP         PPP    SPPP   +PPPP       +P
Sbjct: 1012 SPPPPLPPPPLPPPPL---PPPPSPPPSPPPSPPPSPPPSPPPP--TPPPP-------AP 1059

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPP    SPPP    P PP       +PPPP    SPPP    PPPP
Sbjct: 1060 PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLPPPP 1102

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 47/103 (45%), Positives = 51/103 (49%)
 Frame = +2

Query: 11   PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
            PPP    SPPP   SPPPP       +PPPP    SPPP    P PP       +PPPP 
Sbjct: 1037 PPPSPPPSPPP---SPPPPTPPP--PAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP- 1090

Query: 191  KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               SPPP    PPPP       SPPPP+    PPP+   PPPP
Sbjct: 1091 ---SPPPPLPLPPPP-------SPPPPL---PPPPL---PPPP 1117

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 46/105 (43%), Positives = 50/105 (47%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP+    PPP    PP P        PPPP+    PPP+   PPPP         PP
Sbjct: 1192 SPPPPL----PPPPLPPPPVPPPPSPPPLPPPPLP---PPPL---PPPPSPPPSPPPSPP 1241

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P    SPPP   SPPPP       +PPPP    SPPP    PPPP
Sbjct: 1242 PSPPPSPPP---SPPPPTPPP--PAPPPPTPPPSPPPPTPPPPPP 1281

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 45/105 (42%), Positives = 50/105 (47%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            +PPPP    SPPP    P PP       +PPPP    SPPP    PPPP       SPPP
Sbjct: 880  APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLPPPP-------SPPP 928

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P+    PPP    PP P        PPPP+    PPP+   PPPP
Sbjct: 929  PL----PPPPLPPPPVPPPPSPPPLPPPPL---PPPPL---PPPP 963

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 49/106 (46%), Positives = 52/106 (49%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP        PPPP+   SPPP     PPP       SPPP
Sbjct: 695 SPPPPSPPPSPPP--PSPPPPLP--PPPLPPPPLPPPSPPPSPPPSPPP-------SPPP 743

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPP 319
           P    +PPP   +PPPP         PPP    SPPP    SPPPP
Sbjct: 744 P----TPPP--PAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPP 783

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 44/105 (41%), Positives = 46/105 (43%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            +PPPP    SPPP   SPPPP        PP P     PPP+   P PP        PPP
Sbjct: 1149 APPPPAPPPSPPP---SPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPP 1205

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PV    PPP    P PP        PPPP    SPPP     PPP
Sbjct: 1206 PV----PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 1246

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/104 (45%), Positives = 50/104 (48%), Gaps = 1/104 (0%)
 Frame = +2

Query: 11   PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
            PPP    SPPP   SPPPP       +PPPP    SPPP   SPPPP        PP P 
Sbjct: 1128 PPPSPPPSPPP---SPPPPTP--PPPAPPPPAPPPSPPP---SPPPPTPPPPAPPPPNPP 1179

Query: 191  KHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPP 319
                PPP+   P PP        PPPPV    SPPP+   PPPP
Sbjct: 1180 PPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPL---PPPP 1220

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 45/106 (42%), Positives = 47/106 (44%), Gaps = 2/106 (1%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPPV    PPP     PPP        PPPP    SPPP+   P PP +     SPPPP
Sbjct: 2119 PPPPVP---PPPTPPPSPPPL-------PPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPP 2168

Query: 188  VKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                 P  PP   SP PP       SPPP     SP P    PPPP
Sbjct: 2169 SPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPP 2214

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/104 (42%), Positives = 51/104 (49%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP    SPPP+   P PP +     SPPPP    SPP    +PPP         PPPP
Sbjct: 2137 PPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPP----SPP----TPPPLPPPSPSPLPPPP 2188

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            +    PPP    P PP +  +  SPPPP     PPP+   PPPP
Sbjct: 2189 I----PPPPSPPPHPPPQSPLPPSPPPPP---PPPPL---PPPP 2222

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 45/104 (43%), Positives = 47/104 (45%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP    SPPP     PPP        PP P     PPP   SPPPP       SPPPP
Sbjct: 960  PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPP---SPPPPLPLPPPPSPPPP 1016

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            +    PPP+   PPPP        PPPP    SPPP     PPP
Sbjct: 1017 L---PPPPL---PPPP-------LPPPPSPPPSPPPSPPPSPPP 1047

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 45/114 (39%), Positives = 46/114 (40%), Gaps = 10/114 (8%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP    SPPP     PPP       SPPP      PPP    P PP       +PPPP
Sbjct: 1637 PPPPSPPPSPPPSPPPSPPP-------SPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPP 1689

Query: 188  VKHYSPP----------PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                SPP          P   SPPPP        PP P     PPP   SPPPP
Sbjct: 1690 ----SPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPP 1739

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/107 (42%), Positives = 51/107 (47%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5    SPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
            SPPPP+      PPP+   PPPP         PPP    SPPP   +PPPP       +P
Sbjct: 1103 SPPPPLPPPPLPPPPL---PPPPSPPPSPPPSPPPSPPPSPPPP--TPPPP-------AP 1150

Query: 179  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPP    SPPP   SPPPP        PP P     PPP+   PPPP
Sbjct: 1151 PPPAPPPSPPP---SPPPPTPPPPAPPPPNPPPPSPPPPL---PPPP 1191

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/103 (42%), Positives = 46/103 (44%)
 Frame = +2

Query: 11   PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
            PPP    SPPP    PPPP       SPPPP+    PPP    PP P        PPPP 
Sbjct: 1593 PPPSPPPSPPPPLPLPPPP-------SPPPPL----PPPPVPPPPSPPPLPPPPLPPPPS 1641

Query: 191  KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               SPPP     PPP       SPPP      PPP   +PPPP
Sbjct: 1642 PPPSPPPSPPPSPPP-------SPPPSPSPLPPPP---TPPPP 1674

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 43/106 (40%), Positives = 45/106 (42%), Gaps = 2/106 (1%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP    S P    SPPPP        PP P     PPP     PPP        PPPP
Sbjct: 2088 PPPPSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPP-------LPPPP 2140

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPP 319
                SPPP+   P PP +     SPPPP     P  PP   SP PP
Sbjct: 2141 TPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPP 2186

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 42/103 (40%), Positives = 46/103 (44%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP    SPPP+   PPP         PPPP      PP+  SPPPP        PPP 
Sbjct: 2124 PPPPTPPPSPPPL--PPPPTPPPSPPPLPPPPTPPPQSPPL-PSPPPPSPPTPPPLPPPS 2180

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
                 PPP+   PP P  H   +SP PP     PPP    PPP
Sbjct: 2181 PSPLPPPPI-PPPPSPPPHPPPQSPLPPSPPPPPPPPPLPPPP 2222

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 45/105 (42%), Positives = 50/105 (47%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            +PPPP    SPPP    PPPP       SPPPP+    PPP    PP P        PPP
Sbjct: 908  NPPPP----SPPPPLPLPPPP-------SPPPPL----PPPPLPPPPVPPPPSPPPLPPP 952

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P+    PPP+   PPPP         PPP    SPPP   +PPPP
Sbjct: 953  PL---PPPPL---PPPPSPPPSPPPSPPPSPPPSPPP--PTPPPP 989

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 46/106 (43%), Positives = 51/106 (48%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP+    PPP    PP P        PPPP+    PPP+   PPPP         PP
Sbjct: 925  SPPPPL----PPPPLPPPPVPPPPSPPPLPPPPLP---PPPL---PPPPSPPPSPPPSPP 974

Query: 185  PVKHYSPPPVYHSPP-PPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P    SPPP    PP PP  +    SPPPP+    PPP   SPPPP
Sbjct: 975  PSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLP-LPPPP---SPPPP 1016

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 45/104 (43%), Positives = 47/104 (45%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPPV    PPP    P PP        PPPP    SPPP     PPP        PP P
Sbjct: 936  PPPPV----PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAP 991

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                 PPP   SPPPP       SPPPP+    PPP+   PPPP
Sbjct: 992  PPPNPPPP---SPPPPLPLPPPPSPPPPL---PPPPL---PPPP 1026

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 45/104 (43%), Positives = 47/104 (45%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP    SPPP     PPP       SPPPP     PPP    P PP        PP P
Sbjct: 1119 PPPPSPPPSPPPSPPPSPPP-------SPPPPTP---PPPAPPPPAPPPSPPPSPPPPTP 1168

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                 PPP   +PPPP       SPPPP+    PPP   SPPPP
Sbjct: 1169 PPPAPPPP---NPPPP-------SPPPPL---PPPP---SPPPP 1196

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 49/109 (44%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSP- 178
            SPPPP+    PPP   SPPPP        PPPPV    SPPP+   P PP       SP 
Sbjct: 913  SPPPPLP-LPPPP---SPPPPLP--PPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPP 966

Query: 179  --PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              PPP    SPPP    P PP       +PPPP    SPPP    PPPP
Sbjct: 967  PSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLPPPP 1011

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/108 (42%), Positives = 50/108 (46%), Gaps = 3/108 (2%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-SPPPVYHSPP-PPKKHYVYKSP 178
            +PPP      PPP    P PP  +    SPPPP+    SPPP    PP PP       SP
Sbjct: 1154 APPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSP 1213

Query: 179  PP-PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PP P     PPP+   PPPP         PPP    SPPP   SPPPP
Sbjct: 1214 PPLPPPPLPPPPL---PPPPSPPPSPPPSPPPSPPPSPPP---SPPPP 1255

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 45/115 (39%), Positives = 47/115 (40%), Gaps = 10/115 (8%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP+    PPP    PP P        PPPP    SPPP     PPP       SPPP
Sbjct: 1612 SPPPPL----PPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPP-------SPPP 1660

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP----------PVYHSPPPP 319
                  PPP    P PP       +PPPP    SPP          P   SPPPP
Sbjct: 1661 SPSPLPPPPTPPPPSPPLPSPPLPAPPPP----SPPPPNAPSPSSMPPSQSPPPP 1711

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/107 (41%), Positives = 48/107 (44%), Gaps = 2/107 (1%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPP 181
            +PPP      PPP    P PP  +    SPPPP+    PP P    PPPP        PP
Sbjct: 885  APPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPP-------LPP 937

Query: 182  PPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPV    SPPP+   P PP       SPPP      PP    SPPPP
Sbjct: 938  PPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 984

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/105 (43%), Positives = 51/105 (48%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP     PPP   +PPPP       +PPP      PPP    P PP  +    SPPP
Sbjct: 1139 SPPPPTP---PPP---APPPP-------APPPSPPPSPPPPTPPPPAPPPPNPPPPSPPP 1185

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P+    PPP   SPPPP        PPPP+    PPPV   PPPP
Sbjct: 1186 PL---PPPP---SPPPP-------LPPPPL---PPPPV---PPPP 1211

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 46/100 (46%), Positives = 50/100 (50%), Gaps = 2/100 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           SPPPP    SPPP  +  SPPP        SPPPP    SPPP    PPPP       SP
Sbjct: 349 SPPPPSFSPSPPPPSLSPSPPPATPP---PSPPPP----SPPPPL--PPPP-------SP 392

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
           PPP+    PPP+   PPPP       SPPPP     PPP+
Sbjct: 393 PPPL---PPPPI---PPPP-------SPPPP----PPPPL 415

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 41/94 (43%), Positives = 46/94 (48%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP    P PP       SPPPP+    PPP   SPPPP        PPP
Sbjct: 358 SPPPPSLSPSPPPATPPPSPPPP-----SPPPPLP---PPP---SPPPP-------LPPP 399

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS 286
           P+    PPP   SPPPP        PPPP+  ++
Sbjct: 400 PI---PPPP---SPPPP--------PPPPLAPFT 419

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 44/103 (42%), Positives = 46/103 (44%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPP     SPP    SPPPP        PPP      PPP+   PPPP       SPPP 
Sbjct: 2151 PPPTPPPQSPP--LPSPPPPSPPTPPPLPPPSPSPLPPPPI---PPPP-------SPPPH 2198

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
                SP P   SPPPP        PPPP+    PPP   SPPP
Sbjct: 2199 PPPQSPLP--PSPPPP-------PPPPPL---PPPP---SPPP 2226

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 40/97 (41%), Positives = 47/97 (48%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP    +PPP+    PPP    +   PPPP+    PPP    P PP +  +  SPPP
Sbjct: 2164 SPPPPSPP-TPPPL----PPPSPSPL---PPPPI----PPPPSPPPHPPPQSPLPPSPPP 2211

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 295
            P     PPP+   PPPP       SPPP     S PP
Sbjct: 2212 PP---PPPPL---PPPP-------SPPP-----SQPP 2230

[188][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 52/105 (49%), Positives = 52/105 (49%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP       SPPPP     PPP   SPPPP       SPPP
Sbjct: 427 SPPPPPPPSPPPPPPPSPPPPPP----PSPPPPPPPSPPPPPPPSPPPPSP--PPPSPPP 480

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP    PPPP       SPPPP     PPP   SPPPP
Sbjct: 481 P----SPPPPSPPPPPP------PSPPPPPPPSPPPPPPPSPPPP 515

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 50/105 (47%), Positives = 50/105 (47%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP    PPPP       SPPPP     PPP   SPPPP        PPP
Sbjct: 262 SPPPP----SPPPPSPPPPPPP------SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 311

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     P P   SPPPP       SPPPP     PPP   SPPPP
Sbjct: 312 PPSPPPPSPPPPSPPPP-------SPPPPPPPSPPPPPPPSPPPP 349

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 52/106 (49%), Positives = 52/106 (49%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP-PPKKHYVYKSPP 181
           SPPPP     PPP   SPPPP       SPPPP    SPPP    PP PP       SPP
Sbjct: 381 SPPPPPPPSPPPPPPPSPPPP-------SPPPP----SPPPPSPPPPSPPPPSPPPPSPP 429

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP     PPP   SPPPP       SPPPP     PPP   SPPPP
Sbjct: 430 PPPPPSPPPPPPPSPPPPPP----PSPPPPPPPSPPPPPPPSPPPP 471

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/105 (47%), Positives = 50/105 (47%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP    PPPP       SPPPP     PPP   SPPPP       SPPP
Sbjct: 417 SPPPP----SPPPPSPPPPPPP------SPPPPPPPSPPPPPPPSPPPPPP----PSPPP 462

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP    P PP       SPPPP     PPP   SPPPP
Sbjct: 463 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 507

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 52/105 (49%), Positives = 52/105 (49%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP       SPPPP     PPP   SPPPP       SPPP
Sbjct: 280 SPPPPPPPSPPPPPPPSPPPP-------SPPPPSPPPPPPP---SPPPP-------SPPP 322

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP    PPPP       SPPPP     PPP   SPPPP
Sbjct: 323 P----SPPPPSPPPPPP------PSPPPPPPPSPPPPPPPSPPPP 357

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/105 (45%), Positives = 48/105 (45%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP        PPPP     PPP    PPPP        PPP
Sbjct: 306 SPPPPPPPSPPPP---SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 362

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                SPPP    PPPP       SPPPP     PPP   SPPPP
Sbjct: 363 SPPPPSPPPPSPPPPPP------PSPPPPPPPSPPPPPPPSPPPP 401

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/105 (48%), Positives = 51/105 (48%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP       SPPPP    SPPP   SPPPP        PP 
Sbjct: 373 SPPPPPPPSPPPPPPPSPPPPPP----PSPPPP----SPPP--PSPPPPSPPPPSPPPPS 422

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP       SPPPP     PPP   SPPPP
Sbjct: 423 PPPPSPPPPPPPSPPPPPP----PSPPPPPPPSPPPPPPPSPPPP 463

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/105 (48%), Positives = 51/105 (48%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP     PPP   SPPPP       SPPP
Sbjct: 412 SPPPP----SPPPP--SPPPP-------SPPPPPPPSPPPPPPPSPPPPPP----PSPPP 454

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP        PP P     PPP   SPPPP
Sbjct: 455 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 499

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/105 (45%), Positives = 48/105 (45%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP        PP P     PPP   SPPPP       SPPP
Sbjct: 451 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP----PSPPP 506

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP        PP P     PPP   SPPPP
Sbjct: 507 PPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 548

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/105 (47%), Positives = 50/105 (47%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP    PPPP       SPPPP    SPPP    PPPP       SPPP
Sbjct: 244 SPPPP----SPPPPSPPPPPP------PSPPPP----SPPPPSPPPPPP------PSPPP 283

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP        PPPP     P P   SPPPP
Sbjct: 284 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/105 (50%), Positives = 53/105 (50%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP       SPPPP    SPPP    PPPP       SPPP
Sbjct: 337 SPPPPPPPSPPPPPPPSPPPPSP--PPPSPPPP----SPPPPSPPPPPP------PSPPP 384

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP       SPPPP    SPPP   SPPPP
Sbjct: 385 PPPPSPPPPPPPSPPPP-------SPPPP----SPPP--PSPPPP 416

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/106 (49%), Positives = 52/106 (49%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP    PPPP       SPPPP     PPP   SPPPP       SPPP
Sbjct: 363 SPPPP----SPPPPSPPPPPPP------SPPPPPPPSPPPPPPPSPPPP-------SPPP 405

Query: 185 PVKHYSPPPVYHSPP-PPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP    PP PP       SPPPP     PPP   SPPPP
Sbjct: 406 P----SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 447

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 49/105 (46%), Positives = 49/105 (46%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP    PPPP       SPPPP     PPP    P PP       SPPP
Sbjct: 368 SPPPPSPPPPPPPSPPPPPPP-------SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 420

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP    PPPP       SPPPP     PPP   SPPPP
Sbjct: 421 P----SPPPPSPPPPPP------PSPPPPPPPSPPPPPPPSPPPP 455

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/111 (47%), Positives = 54/111 (48%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP    PPPP       SPPPP     PPP   SPPPP       SPPP
Sbjct: 477 SPPPP----SPPPPSPPPPPPP------SPPPPPPPSPPPPPPPSPPPP-------SPPP 519

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 337
           P    SPPP   SPPPP        PPPP     P P   SPPPP +  VY
Sbjct: 520 P----SPPP--PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPCQVCVY 564

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/105 (49%), Positives = 52/105 (49%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP    PPPP       SPPPP    SPPP    PPPP       SPPP
Sbjct: 226 SPPPP----SPPPPSPPPPPPP------SPPPP----SPPPPSPPPPPP------PSPPP 265

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP    PPPP       SPPPP     PPP   SPPPP
Sbjct: 266 P----SPPPPSPPPPPP------PSPPPPPPPSPPPPPPPSPPPP 300

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/105 (49%), Positives = 52/105 (49%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP       SPPPP     PPP   SPPPP       SPPP
Sbjct: 236 SPPPPPPPSPPPP---SPPPP-------SPPPPPPPSPPPP---SPPPP-------SPPP 275

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP       SPPPP    SPPP    PPPP
Sbjct: 276 PPPPSPPPPPPPSPPPPPP----PSPPPP----SPPPPSPPPPPP 312

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/105 (47%), Positives = 50/105 (47%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP       SPPPP    SPPP    PPPP       SPPP
Sbjct: 301 SPPPPSPPPPPPP---SPPPP-------SPPPP----SPPPPSPPPPPP------PSPPP 340

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP        PP P     PPP   SPPPP
Sbjct: 341 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/105 (47%), Positives = 50/105 (47%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP    P PP       SPPPP    SPPP    PPPP       SPPP
Sbjct: 389 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPPPPP------SPPP 438

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP       SPPPP     PPP   SPPPP
Sbjct: 439 PPPPSPPPPPPPSPPPPPP----PSPPPPPPPSPPPP---SPPPP 476

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/105 (45%), Positives = 48/105 (45%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP       SPPPP     PPP   SPPPP        PPP
Sbjct: 288 SPPPPPPPSPPPP---SPPPP-------SPPPPPPPSPPPP---SPPPPSPPPPSPPPPP 334

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP    PPPP        PPP     SPPP    PPPP
Sbjct: 335 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 379

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 50/105 (47%), Positives = 50/105 (47%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP       SPPPP    SPPP   SPPPP        PPP
Sbjct: 329 SPPPPPPPSPPPPPPPSPPPPPP----PSPPPP----SPPPP--SPPPPSPPPPSPPPPP 378

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP    PPPP        PPP     SPPP   SPPPP
Sbjct: 379 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP--PSPPPP 421

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 50/105 (47%), Positives = 50/105 (47%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP       SPPPP    SPPP   SPPPP        PPP
Sbjct: 443 SPPPPPPPSPPPPPPPSPPPPPP----PSPPPP----SPPPP--SPPPPSPPPPSPPPPP 492

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP    PPPP        PPP     SPPP   SPPPP
Sbjct: 493 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP--PSPPPP 535

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/105 (46%), Positives = 49/105 (46%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP    P PP       SPPPP     PPP   SPPPP       SPPP
Sbjct: 345 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP----PSPPP 400

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    SPPP   SPPPP        PP P     PPP   SPPPP
Sbjct: 401 P----SPPP--PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 439

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 52/105 (49%), Positives = 52/105 (49%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP        PP P     PPP   SPPPP       SPPP
Sbjct: 397 SPPPP----SPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP----PSPPP 446

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP       SPPPP    SPPP   SPPPP
Sbjct: 447 PPPPSPPPPPPPSPPPPPP----PSPPPP----SPPP--PSPPPP 481

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 53/105 (50%), Positives = 53/105 (50%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP        PPPP    SPPP   SPPPP       SPPP
Sbjct: 216 SPPPP----SPPPP--SPPPPSPPPPSPPPPPP---PSPPP--PSPPPP-------SPPP 257

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP       SPPPP     PPP   SPPPP
Sbjct: 258 PPPPSPPPP---SPPPP-------SPPPPPPPSPPPPPPPSPPPP 292

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/105 (47%), Positives = 50/105 (47%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP    SPPP   SPPPP        PP 
Sbjct: 191 SPPPP----SPPPP--SPPPP-------SPPPP----SPPPP--SPPPPSPPPPSPPPPS 231

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPP   SPPPP        PPPP     P P   SPPPP
Sbjct: 232 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 42/93 (45%), Positives = 42/93 (45%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 220
           P   SPPPP       SPPPP    SPP     P PP       SPPPP    SPPP   
Sbjct: 187 PGIPSPPPP-------SPPPP----SPP----PPSPPPPSPPPPSPPPP----SPPP--P 225

Query: 221 SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP        PPPP     P P   SPPPP
Sbjct: 226 SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 44/85 (51%), Positives = 45/85 (52%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP   SPPPP       SPPPP    SPPP    PPPP       SPPP
Sbjct: 516 SPPPP----SPPPP--SPPPP-------SPPPP----SPPP----PPPP-------SPPP 547

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKS 259
           P    SPPP   SPPPP +  VY S
Sbjct: 548 P----SPPP--PSPPPPCQVCVYIS 566

[189][TOP]
>UniRef100_Q8IRB3 CG32241 n=1 Tax=Drosophila melanogaster RepID=Q8IRB3_DROME
          Length = 440

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 60/137 (43%), Positives = 66/137 (48%), Gaps = 28/137 (20%)
 Frame = +2

Query: 11  PPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPVYHSPPPPKKHYVYKS 175
           PPP K    +PPPVY   PPP K  +Y  PPPP      Y+PPP     PPP K  VY  
Sbjct: 254 PPPTKKVVIAPPPVY--VPPPTKKVIYTPPPPPPTKKVVYTPPP-----PPPTKKVVYTP 306

Query: 176 PPPPVKH----YSPPPV-------YH-----------SPPPPKKHYVYKSPPPPVKH-YS 286
           PPPP       Y+PPP        YH           +PP PK  Y+   PPPP K  Y 
Sbjct: 307 PPPPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYL---PPPPTKKVYV 363

Query: 287 PPPVYHSPPPPKKHYVY 337
            PPVY  PPP KK  VY
Sbjct: 364 APPVY-VPPPTKKVVVY 379

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 67/175 (38%), Positives = 70/175 (40%), Gaps = 65/175 (37%)
 Frame = +2

Query: 5   SPPPPVKHY----------SPPPVY-----------HSPPPPKKHYVYKSPPPPVKH--- 112
           +PP P   Y          +PPPVY             PPPP K  VY  PPPP      
Sbjct: 244 APPAPKVEYLPPPTKKVVIAPPPVYVPPPTKKVIYTPPPPPPTKKVVYTPPPPPPTKKVV 303

Query: 113 YSPPPVYHSPPPPKK----------------HY-----------------VYKSPPPPVK 193
           Y+PPP    PPPPKK                HY                  Y  PPP  K
Sbjct: 304 YTPPP---PPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYLPPPPTKK 360

Query: 194 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-----VYHSPPPP---KKHYV 334
            Y  PPVY  PPP KK  VY  PPPP   Y PPP     VY  PPPP   KK YV
Sbjct: 361 VYVAPPVY-VPPPTKKVVVYTPPPPPPPVYIPPPTKKVVVYTPPPPPPPTKKVYV 414

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 55/124 (44%), Positives = 61/124 (49%), Gaps = 16/124 (12%)
 Frame = +2

Query: 11  PPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPVYHSPPPPKKHYVYKS 175
           PPP K    +PPPVY   PPP K  VY  PPPP      Y+PP     PPPP K  VY  
Sbjct: 141 PPPTKKVVIAPPPVY--VPPPTKKVVYTPPPPPPTKKVVYTPP-----PPPPTKKVVYTP 193

Query: 176 PPPPVKH---YSPPPVYHSPPPPKKHYVYKSPPPPV-----KHYSPPPV---YHSPPPPK 322
           PPPP      Y+PPP    PPPP K  VY  PP  +      HY  P V     +PP PK
Sbjct: 194 PPPPPTKKVVYTPPP----PPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPK 249

Query: 323 KHYV 334
             Y+
Sbjct: 250 VEYL 253

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 54/114 (47%), Positives = 59/114 (51%), Gaps = 10/114 (8%)
 Frame = +2

Query: 26  HYSPPPV---YHSPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPV 190
           HY  P V     +PPPPK  Y+    PPP K    +PPPVY  PPP KK      PPPP 
Sbjct: 119 HYGQPSVKFEVSAPPPPKVEYL----PPPTKKVVIAPPPVY-VPPPTKKVVYTPPPPPPT 173

Query: 191 KH--YSPPPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPVYHSPPPPKKHYVY 337
           K   Y+PP     PPPP K  VY  PPPP      Y+PPP    PPPP K  VY
Sbjct: 174 KKVVYTPP-----PPPPTKKVVYTPPPPPPTKKVVYTPPP----PPPPPKKVVY 218

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 55/125 (44%), Positives = 62/125 (49%), Gaps = 15/125 (12%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPVYHSPPPPKKHYVYK 172
           PPPP K   Y+PPP     PPP K  VY  PPPP      Y+PPP    PPPP K  VY 
Sbjct: 169 PPPPTKKVVYTPPP-----PPPTKKVVYTPPPPPPTKKVVYTPPP----PPPPPKKVVYT 219

Query: 173 SPPPPVK-----HYSPPPV---YHSPPPPKKHYVYKSPPPPVKHY--SPPPVYHSPPPPK 322
            PP  +      HY  P V     +PP PK  Y+    PPP K    +PPPVY   PPP 
Sbjct: 220 PPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYL----PPPTKKVVIAPPPVY--VPPPT 273

Query: 323 KHYVY 337
           K  +Y
Sbjct: 274 KKVIY 278

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 59/133 (44%), Positives = 63/133 (47%), Gaps = 23/133 (17%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPV-------YH-----------SPPPPKKHYVYKSPPPPVKH-YSPP 124
           PPPP K   Y+PPP        YH           +PP PK  Y+   PPPP K  Y  P
Sbjct: 309 PPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYL---PPPPTKKVYVAP 365

Query: 125 PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP--PPPVKHYSPPPV 298
           PVY  PPP KK  VY  PPPP      PPVY  PPP KK  VY  P  PPP K     P 
Sbjct: 366 PVY-VPPPTKKVVVYTPPPPP------PPVY-IPPPTKKVVVYTPPPPPPPTKKVYVTPK 417

Query: 299 YHSPPPPKKHYVY 337
               PP +K Y Y
Sbjct: 418 VEYLPPVQKGYSY 430

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 56/129 (43%), Positives = 63/129 (48%), Gaps = 26/129 (20%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPV-------YH-----------SPPPPKKHYVYKSPPPPVKHY--SP 121
           PPPP K   Y+PPP        YH           +PP PK  Y+    PPP K    +P
Sbjct: 209 PPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYL----PPPTKKVVIAP 264

Query: 122 PPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 295
           PPVY  PPP KK      PPPP K   Y+PP     PPPP K  VY  PPPP     PPP
Sbjct: 265 PPVY-VPPPTKKVIYTPPPPPPTKKVVYTPP-----PPPPTKKVVYTPPPPP-----PPP 313

Query: 296 --VYHSPPP 316
             V ++PPP
Sbjct: 314 KKVVYTPPP 322

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 48/105 (45%), Positives = 52/105 (49%), Gaps = 11/105 (10%)
 Frame = +2

Query: 35  PPPVYHSPPPPKKHYVYKSP----PPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVKH 196
           PPP     PPP K  V   P    PPP K   Y+PP     PPPP K  VY  PPPP   
Sbjct: 133 PPPKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPP-----PPPPTKKVVYTPPPPPPTK 187

Query: 197 ---YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPP 316
              Y+PP     PPPP K  VY  PPPP     PPP  V ++PPP
Sbjct: 188 KVVYTPP-----PPPPTKKVVYTPPPPP-----PPPKKVVYTPPP 222

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 44/94 (46%), Positives = 48/94 (51%), Gaps = 2/94 (2%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP--P 181
           PPP  K Y  PPVY  PPP KK  VY  PPPP      PPVY  PPP KK  VY  P  P
Sbjct: 355 PPPTKKVYVAPPVY-VPPPTKKVVVYTPPPPP------PPVY-IPPPTKKVVVYTPPPPP 406

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
           PP K     P     PP +K Y Y + P P  ++
Sbjct: 407 PPTKKVYVTPKVEYLPPVQKGYSYPNDPQPAFNF 440

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 51/124 (41%), Positives = 59/124 (47%), Gaps = 20/124 (16%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPP---PKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYK 172
           P PP   Y+PP V  S P        Y Y  P    +  +PPP  V + PPP KK  +  
Sbjct: 92  PTPPRPVYTPPVVIPSEPAGVLKDDGYHYGQPSVKFEVSAPPPPKVEYLPPPTKKVVI-- 149

Query: 173 SPPPPVKHYSPPP---VYHS--PPPPKKHYVYKSPPPPVKH---YSPPP-------VYHS 307
             PPPV  Y PPP   V ++  PPPP K  VY  PPPP      Y+PPP       VY  
Sbjct: 150 -APPPV--YVPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTP 206

Query: 308 PPPP 319
           PPPP
Sbjct: 207 PPPP 210

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 55/157 (35%), Positives = 64/157 (40%), Gaps = 53/157 (33%)
 Frame = +2

Query: 26  HYSPP--PVYHSPPPPKKHYVYKSPPP--------------PVKHYSPPPV--------- 130
           HY+PP  PV    P    +  ++S PP              P   Y+PP V         
Sbjct: 58  HYAPPSAPVVIDVP----YVPHESAPPRVVVYEAPKPKPTPPRPVYTPPVVIPSEPAGVL 113

Query: 131 ----YH-----------SPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKS 259
               YH           +PPPPK  Y+    PPP K    +PPPVY   PPP K  VY  
Sbjct: 114 KDDGYHYGQPSVKFEVSAPPPPKVEYL----PPPTKKVVIAPPPVY--VPPPTKKVVYTP 167

Query: 260 PPPPVKH---YSPPP-------VY-HSPPPPKKHYVY 337
           PPPP      Y+PPP       VY   PPPP K  VY
Sbjct: 168 PPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVY 204

[190][TOP]
>UniRef100_B4LR98 GJ12419 n=1 Tax=Drosophila virilis RepID=B4LR98_DROVI
          Length = 2967

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/98 (45%), Positives = 60/98 (61%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            +P PPVK  +PPPV  + PPP K    ++ PPPVK  +PPPV  + PPP K    ++ PP
Sbjct: 1136 TPQPPVKQATPPPVKQATPPPVK----QATPPPVKQATPPPVKPATPPPVK----QATPP 1187

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
            PVK  +PPPV  + PPP K    ++ PP VK ++  PV
Sbjct: 1188 PVKQATPPPVKQATPPPMK----QATPPLVKEFAAVPV 1221

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 45/110 (40%), Positives = 61/110 (55%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            + PP      S P    +P PP K    ++ PPPVK  +PPPV  + PPP K    ++ P
Sbjct: 1119 EEPPTSAPQESQPGKQSTPQPPVK----QATPPPVKQATPPPVKQATPPPVK----QATP 1170

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 331
            PPVK  +PPPV  + PPP K    ++ PPPVK  +PPP+  + PP  K +
Sbjct: 1171 PPVKPATPPPVKQATPPPVK----QATPPPVKQATPPPMKQATPPLVKEF 1216

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 45/119 (37%), Positives = 62/119 (52%), Gaps = 11/119 (9%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            ++ PPPVK  +PPPV  + PPP K    ++ PPPVK  +PPPV  + PPP K    ++ P
Sbjct: 1143 QATPPPVKQATPPPVKQATPPPVK----QATPPPVKPATPPPVKQATPPPVK----QATP 1194

Query: 182  PPVKHYSPPPVYHSPPPPKKHYV-----------YKSPPPPVKHYSPPPVYHSPPPPKK 325
            PPVK  +PPP+  + PP  K +             K    P+K  + PP   + PP  K
Sbjct: 1195 PPVKQATPPPMKQATPPLVKEFAAVPVKAAAAASVKQETLPIKKGTTPPGKQATPPSVK 1253

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 38/123 (30%), Positives = 51/123 (41%), Gaps = 18/123 (14%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSP-------PPPKKHYVYKSPPPPVKHYSP-------PPVYHSP 142
            +PP    +  PPP  H P       PP     VY + PPP +H SP       PP+Y +P
Sbjct: 2647 APPGSGPNARPPPYLHGPEHHGGPPPPGSLASVYGAGPPPARHASPHLNPYRAPPIYGNP 2706

Query: 143  PPPKKHYVYKSPPPPVKHYSPPPVYHSPP----PPKKHYVYKSPPPPVKHYSPPPVYHSP 310
                 +Y  +  PP   +  P PV ++      PP  +Y      PP    +P  V  S 
Sbjct: 2707 -----NYPPRVGPPGSANMRPGPVDYAAGARGYPPYGYYPPPLSTPPAHAAAPSSVIVSA 2761

Query: 311  PPP 319
            PPP
Sbjct: 2762 PPP 2764

[191][TOP]
>UniRef100_Q9M4I2 Putative proline-rich cell wall protein n=1 Tax=Vitis vinifera
           RepID=Q9M4I2_VITVI
          Length = 204

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 57/117 (48%), Positives = 61/117 (52%), Gaps = 13/117 (11%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPP- 181
           PPP +H  P PVY SPP  K    YK PP PV  Y PPPV   PPP  K    VYKSPP 
Sbjct: 27  PPPYEHKPPLPVYKSPPLGKPPPEYK-PPTPV--YRPPPV-EKPPPEYKPLTPVYKSPPV 82

Query: 182 --PPVKHYSPPPVYHSPPPPKKHYVYK-----SPPPPVKHYS---PPPVYHSPPPPK 322
             PP ++  P PVY  PP  K    YK      PPPP KH +   PP V   PP PK
Sbjct: 83  EKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPK 139

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 50/121 (41%), Positives = 57/121 (47%), Gaps = 13/121 (10%)
 Frame = +2

Query: 2   KSPP---PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP--PPKKHYV 166
           KSPP   PP ++  P PVY  PP  K    YK PP PVK   PPP  H  P  PP+    
Sbjct: 78  KSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYK-PPTPVK--PPPPPKHKTPTLPPR---- 130

Query: 167 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY-SPPPV-------YHSPPPPK 322
              PPP  K  + PP+   PPP K+      P PP  HY   PPV       Y  PP P+
Sbjct: 131 VVRPPPTPKPPTLPPIIVRPPPTKE------PSPPHGHYPGHPPVETPPSTPYKKPPTPE 184

Query: 323 K 325
           K
Sbjct: 185 K 185

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 42/100 (42%), Positives = 50/100 (50%), Gaps = 13/100 (13%)
 Frame = +2

Query: 80  VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP---PPVKHYSPPPVYHSPP---PPKK 241
           V  + P     + PPP  H PP P    VYKSPP   PP ++  P PVY  PP   PP +
Sbjct: 14  VVLTTPSLANDHKPPPYEHKPPLP----VYKSPPLGKPPPEYKPPTPVYRPPPVEKPPPE 69

Query: 242 HY----VYKSPP---PPVKHYSPPPVYHSPPPPKKHYVYK 340
           +     VYKSPP   PP ++  P PVY  PP  K    YK
Sbjct: 70  YKPLTPVYKSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYK 109

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 42/115 (36%), Positives = 47/115 (40%), Gaps = 9/115 (7%)
 Frame = +2

Query: 11  PPPVKHYSP---PPVYHSPPPPKKHYV------YKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           PPPV+   P   PP    PPPP KH           PPP  K  + PP+   PPP K+  
Sbjct: 98  PPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTKE-- 155

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
               P PP  HY   P   +PP       YK PP P K    P   H   PP  H
Sbjct: 156 ----PSPPHGHYPGHPPVETPPSTP----YKKPPTPEKKPWAPHHKHFKAPPPIH 202

[192][TOP]
>UniRef100_O04216 Extensin (Fragment) n=1 Tax=Bromheadia finlaysoniana
           RepID=O04216_BROFI
          Length = 71

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 44/82 (53%), Positives = 48/82 (58%)
 Frame = +2

Query: 35  PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 214
           PPP   SPPPP   Y YKSPPPP     PP  Y SPPPP       SPPPP  + SPPP 
Sbjct: 1   PPPPSPSPPPP---YYYKSPPPPSPSPPPPYYYKSPPPPS-----PSPPPPYYYKSPPPP 52

Query: 215 YHSPPPPKKHYVYKSPPPPVKH 280
             SPPP    Y+Y SPPPP+ +
Sbjct: 53  PPSPPPT---YIYSSPPPPIPY 71

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 39/67 (58%), Positives = 39/67 (58%)
 Frame = +2

Query: 119 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
           PPP   SPPPP   Y YKSPPPP    SP     SPPPP   Y YKSPPPP     PP  
Sbjct: 1   PPPPSPSPPPP---YYYKSPPPP----SP-----SPPPP---YYYKSPPPPSPSPPPPYY 45

Query: 299 YHSPPPP 319
           Y SPPPP
Sbjct: 46  YKSPPPP 52

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 32/64 (50%), Positives = 36/64 (56%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP  + SPPP   SPPPP   Y YKSPPPP            PP P   Y+Y SPPP
Sbjct: 23  SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPP------------PPSPPPTYIYSSPPP 67

Query: 185 PVKH 196
           P+ +
Sbjct: 68  PIPY 71

[193][TOP]
>UniRef100_B8ATQ0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ATQ0_ORYSI
          Length = 225

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 51/119 (42%), Positives = 59/119 (49%), Gaps = 15/119 (12%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-----KHYSPPPVYHS--PPPPKKHYV 166
           P  P  H SPPP +H PPPP  H    SPPPP       H+ PPP + S  PPPP   Y 
Sbjct: 112 PAQPPAHRSPPP-HHLPPPPPAH---PSPPPPAHTSPPPHHLPPPAHASPPPPPPPSRYP 167

Query: 167 YKSPPPPVKHYSPPPVY---HSPPPPKKHYVYKSPPPPVKH-----YSPPPVYHSPPPP 319
             SPPPP   Y PPP +    + PPP+ H   +  PPP  H      +P P Y S  PP
Sbjct: 168 PHSPPPPAHKYPPPPPHGKAAAAPPPRGH---RKLPPPSPHSVNLAMAPSPSYFSADPP 223

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 48/114 (42%), Positives = 60/114 (52%), Gaps = 6/114 (5%)
 Frame = +2

Query: 5   SPP--PPVKHYSPPPVYHSPPPPKKHYVYKSPPP--PVKHYSPPPVYHSPPPPKKHYVYK 172
           SPP  PP  + +    +H     ++ + +   PP  P  H SPPP +H PPPP  H    
Sbjct: 79  SPPAEPPSSYNATEHKHHGHHHHRRRHHHGEAPPAQPPAHRSPPP-HHLPPPPPAH---P 134

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKH 328
           SPPPP  H SPPP +H PPP   H     PPPP ++  +SPPP  H  PPP  H
Sbjct: 135 SPPPPA-HTSPPP-HHLPPPA--HASPPPPPPPSRYPPHSPPPPAHKYPPPPPH 184

[194][TOP]
>UniRef100_B4IZN1 GH15808 n=1 Tax=Drosophila grimshawi RepID=B4IZN1_DROGR
          Length = 470

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 54/155 (34%), Positives = 70/155 (45%), Gaps = 53/155 (34%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPP----------- 148
           P PV H++P PVYH+P P   H    VY + P PV H++P PVYH+P P           
Sbjct: 58  PAPVVHHAPAPVYHAPAPVVHHAPAPVYHA-PAPVVHHAPAPVYHAPAPVAHVAAGTLKE 116

Query: 149 -------PKKHYVYKSP---------------------PPPVKHYSPPPVYHSPPPPKKH 244
                  P K +V   P                     P PV H++P PVYH+P P   H
Sbjct: 117 DGYHYQQPAKQFVIDVPQYHASAPAPVHHAPAPVVHHAPAPVVHHAPAPVYHAPAPVVHH 176

Query: 245 ----YVYKSP-------PPPVKHYSPPPVYHSPPP 316
                V+ +P       P PV H++P PVYH+P P
Sbjct: 177 APAPVVHHAPAPVVHHAPAPVVHHAPAPVYHAPAP 211

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 42/107 (39%), Positives = 55/107 (51%), Gaps = 3/107 (2%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           S P PV H   P V+H+P P   H    VY + P PV H++P PV H  P P  H+    
Sbjct: 138 SAPAPVHHAPAPVVHHAPAPVVHHAPAPVYHA-PAPVVHHAPAPVVHHAPAPVVHHA--- 193

Query: 176 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
            P PV H++P PVYH+P P               +++P PVYH+P P
Sbjct: 194 -PAPVVHHAPAPVYHAPAP--------------VYHAPAPVYHAPAP 225

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 48/130 (36%), Positives = 61/130 (46%), Gaps = 28/130 (21%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP-VYHSPPPPKKHY---VYKSP 178
           P PV H++P PVYH+P P   H      P PV H++P P V+H+P P   H    VY +P
Sbjct: 155 PAPVVHHAPAPVYHAPAPVVHH-----APAPVVHHAPAPVVHHAPAPVVHHAPAPVYHAP 209

Query: 179 PPPVKHYSPPPVYHSPPP---------PKKHYVYKSPP----------PPVKH-----YS 286
            P   +++P PVYH+P P          +  Y Y  P           PPV H     Y 
Sbjct: 210 AP--VYHAPAPVYHAPAPVVHEAAGTLKEDGYHYGKPSVKFEPKQEYLPPVVHKPAPVYQ 267

Query: 287 PPPVYHSPPP 316
           P PV H P P
Sbjct: 268 PAPVVHKPAP 277

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 49/138 (35%), Positives = 60/138 (43%), Gaps = 36/138 (26%)
 Frame = +2

Query: 11  PPPVKHYSPPP-VYHSPPPPKKHY---VYKSPPPPVKHYSPPPVYHSPPP---------P 151
           P PV H++P P V+H+P P   H    VY +P P   +++P PVYH+P P          
Sbjct: 178 PAPVVHHAPAPVVHHAPAPVVHHAPAPVYHAPAP--VYHAPAPVYHAPAPVVHEAAGTLK 235

Query: 152 KKHYVYKSPP----------PPVKH-----YSPPPVYHSPPP--PKKHYVYKSPPPPVKH 280
           +  Y Y  P           PPV H     Y P PV H P P       V+K  P  VK 
Sbjct: 236 EDGYHYGKPSVKFEPKQEYLPPVVHKPAPVYQPAPVVHKPAPVYHPAPVVHKPAPVVVKE 295

Query: 281 YSPP------PVYHSPPP 316
           Y PP      PV H P P
Sbjct: 296 YLPPVVHKPAPVVHKPAP 313

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/93 (39%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
 Frame = +2

Query: 47  YHSPPPPKKHYV---YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVY 217
           YH   P K+  V   ++S P PV H   P V+H+P P     VY + P PV H++P PVY
Sbjct: 32  YHYQQPAKQFEVQQYHESAPAPVYHAPAPVVHHAPAP-----VYHA-PAPVVHHAPAPVY 85

Query: 218 HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           H+             P PV H++P PVYH+P P
Sbjct: 86  HA-------------PAPVVHHAPAPVYHAPAP 105

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 46/113 (40%), Positives = 48/113 (42%), Gaps = 11/113 (9%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP------PVYHSPPPPKKHYVYK 172
           P PV H  P PVYH  P      V+K  P  VK Y PP      PV H P P  +     
Sbjct: 317 PAPVVH-KPAPVYHPAP-----VVHKPAPVVVKEYLPPVVHKPAPVVHKPAPVYQPAPVV 370

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-----YSPPPVYHSPPP 316
             P PV  Y P PV H P P     V K   PPV H     Y P PV H P P
Sbjct: 371 HKPAPV--YHPAPVVHKPAP----VVVKEYLPPVVHKPAPVYQPAPVVHKPAP 417

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 46/114 (40%), Positives = 48/114 (42%), Gaps = 13/114 (11%)
 Frame = +2

Query: 14  PPVKH-----YSPPPVYHSPPPP--KKHYVYKSPPPPVKHYSPP------PVYHSPPPPK 154
           PPV H     Y P PV H P P       V+K  P  VK Y PP      PV H P P  
Sbjct: 256 PPVVHKPAPVYQPAPVVHKPAPVYHPAPVVHKPAPVVVKEYLPPVVHKPAPVVHKPAPVY 315

Query: 155 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           +       P PV  Y P PV H P P     V K   PPV H  P PV H P P
Sbjct: 316 QPAPVVHKPAPV--YHPAPVVHKPAP----VVVKEYLPPVVH-KPAPVVHKPAP 362

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/106 (40%), Positives = 45/106 (42%), Gaps = 5/106 (4%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 193
           PPV H  P PV H P P  +       P PV  Y P PV H P P     V K   PPV 
Sbjct: 347 PPVVH-KPAPVVHKPAPVYQPAPVVHKPAPV--YHPAPVVHKPAP----VVVKEYLPPVV 399

Query: 194 H-----YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           H     Y P PV H P P  +       P PV  Y P PV H P P
Sbjct: 400 HKPAPVYQPAPVVHKPAPVYQPAPVVHKPAPV--YQPAPVVHKPAP 443

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 42/101 (41%), Positives = 44/101 (43%)
 Frame = +2

Query: 14  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 193
           PPV H  P PV H P P  +       P PV  Y P PV H P P     V K   PPV 
Sbjct: 298 PPVVH-KPAPVVHKPAPVYQPAPVVHKPAPV--YHPAPVVHKPAP----VVVKEYLPPVV 350

Query: 194 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
           H  P PV H P P  +       P PV  Y P PV H P P
Sbjct: 351 H-KPAPVVHKPAPVYQPAPVVHKPAPV--YHPAPVVHKPAP 388

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 43/113 (38%), Positives = 46/113 (40%), Gaps = 10/113 (8%)
 Frame = +2

Query: 11  PPPVKH-----YSPPPVYHSPPPPKKHYVYKSPPPPVKH-----YSPPPVYHSPPPPKKH 160
           P PV H     Y P PV H P P     V K   PPV H     Y P PV H P P  + 
Sbjct: 366 PAPVVHKPAPVYHPAPVVHKPAP----VVVKEYLPPVVHKPAPVYQPAPVVHKPAPVYQP 421

Query: 161 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                 P PV  Y P PV H P P     VY+  P PV H      Y + P P
Sbjct: 422 APVVHKPAPV--YQPAPVVHKPAP-----VYRQ-PEPVHHGHQDYSYPNDPQP 466

[195][TOP]
>UniRef100_Q212G2 Peptidase C14, caspase catalytic subunit p20 n=1 Tax=Rhodopseudomonas
            palustris BisB18 RepID=Q212G2_RHOPB
          Length = 1026

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/108 (44%), Positives = 52/108 (48%), Gaps = 4/108 (3%)
 Frame = +2

Query: 8    PPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKS 175
            PPPP    +P  PPV    PPP        PPPPV   +PPP  V    PPP        
Sbjct: 895  PPPPAARPAPAAPPVVRPAPPPPPVVRQAPPPPPVVRQAPPPPPVVRQAPPPPPVVHQAP 954

Query: 176  PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PPPPV   +PPP    PPPP    V  +PPPP     PPPV   PPPP
Sbjct: 955  PPPPVVRQAPPP----PPPPPPPVVRPAPPPPPP--PPPPVMRPPPPP 996

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/111 (44%), Positives = 55/111 (49%), Gaps = 7/111 (6%)
 Frame = +2

Query: 8    PPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKKHYVYK 172
            PPPPV   +PPP  V    PPP        PPPPV H +PPP   V  +PPPP       
Sbjct: 915  PPPPVVRQAPPPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPPPPPP----- 969

Query: 173  SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPP 319
             PPPPV   +PPP    PPPP    +   PPPP     PPP     +PPPP
Sbjct: 970  -PPPPVVRPAPPP----PPPPPPPVMRPPPPPP-----PPPAAARPAPPPP 1010

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/103 (42%), Positives = 48/103 (46%), Gaps = 2/103 (1%)
 Frame = +2

Query: 8    PPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            PPPPV   +  PPPV    PPP        PPPPV   +PPP    PPPP    V  +PP
Sbjct: 925  PPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPPP----PPPPPPPVVRPAPP 980

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 310
            PP     PPPV   PPPP        PPP     +PPP    P
Sbjct: 981  PPPP--PPPPVMRPPPPP-------PPPPAAARPAPPPPAAKP 1014

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 45/113 (39%), Positives = 53/113 (46%), Gaps = 8/113 (7%)
 Frame = +2

Query: 5    SPPP---PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKKHYVY 169
            +PPP   P    +PP V  +P PP        PPPP    +P  PPV    PPP      
Sbjct: 863  TPPPAAAPPATPTPPAVRPAPAPPPVVRPAPPPPPPAARPAPAAPPVVRPAPPPPPVVRQ 922

Query: 170  KSPPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              PPPPV   +PPP   V  +PPPP   +    PPP V+   PPP    PPPP
Sbjct: 923  APPPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPPPP----PPPP 971

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 43/114 (37%), Positives = 53/114 (46%), Gaps = 9/114 (7%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP---PVKHYSPPPVYHSPPPPKKHYVYKS 175
            +P PP     P P   +P PP       +PPP   P    +PP V  +P PP        
Sbjct: 835  APTPPPAAARPQPAAPAPVPPPPAAGRPTPPPAAAPPATPTPPAVRPAPAPPPVVRPAPP 894

Query: 176  PPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPP--VKHYSPPP--VYHSPPPP 319
            PPPP    +P  PPV    PPP    V ++PPPP  V+   PPP  V  +PPPP
Sbjct: 895  PPPPAARPAPAAPPVVRPAPPPPP-VVRQAPPPPPVVRQAPPPPPVVRQAPPPP 947

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/90 (41%), Positives = 41/90 (45%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPPV   +PPP    PPPP    V  +PPPP     PPPV   PPPP        PPPP
Sbjct: 955  PPPPVVRQAPPP----PPPPPPPVVRPAPPPPPP--PPPPVMRPPPPP--------PPPP 1000

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 277
                  PP    PP  K   +    P PV+
Sbjct: 1001 AAARPAPP----PPAAKPCTLPNGQPCPVR 1026

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 37/109 (33%), Positives = 45/109 (41%), Gaps = 5/109 (4%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP- 184
            P PP    + PP   +PP   K     +P PP     P P   +P PP       +PPP 
Sbjct: 812  PLPP----AAPPSPATPPSAAKPPATVAPTPPPAAARPQPAAPAPVPPPPAAGRPTPPPA 867

Query: 185  --PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPP 319
              P    +PP V  +P PP        PPPP    +P  PPV    PPP
Sbjct: 868  AAPPATPTPPAVRPAPAPPPVVRPAPPPPPPAARPAPAAPPVVRPAPPP 916

[196][TOP]
>UniRef100_C5XFE4 Putative uncharacterized protein Sb03g042800 n=1 Tax=Sorghum
           bicolor RepID=C5XFE4_SORBI
          Length = 401

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 57/144 (39%), Positives = 68/144 (47%), Gaps = 35/144 (24%)
 Frame = +2

Query: 2   KSPP------PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP------ 145
           KSPP      PP  +  PPP Y  P PP+ +Y+    PPP +   PP  Y +PP      
Sbjct: 202 KSPPLPYQYSPPPSNQLPPPAYQYPSPPQNYYI---SPPPYQQSMPPNNYQTPPTSQGTK 258

Query: 146 -PPKKH------YVYKSPPPPVKH-YSPPP-VYHSPPPPKKHYVYKSP------------ 262
            P + H      Y Y SPPP  +H Y PPP VY  PPPP   Y+ KSP            
Sbjct: 259 SPVQPHKYLPPPYYYNSPPPQHQHNYVPPPLVYQYPPPP---YINKSPLLPSSPVTPYHY 315

Query: 263 -PPPVKHYSPPPV-YHSPPPPKKH 328
             PP   YSPPP  Y S PPP ++
Sbjct: 316 NSPPTYQYSPPPYNYLSSPPPAQY 339

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 50/120 (41%), Positives = 64/120 (53%), Gaps = 15/120 (12%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPP P ++ SPP ++ SPP P ++    SPPP   +  PPP Y  P PP+ +Y+    PP
Sbjct: 187 SPPLPYQYPSPPAIHKSPPLPYQY----SPPP--SNQLPPPAYQYPSPPQNYYI---SPP 237

Query: 185 PVKHYSPPPVYHSPP-------PPKKH------YVYKSPPPPVKH-YSPPP-VYHSPPPP 319
           P +   PP  Y +PP       P + H      Y Y SPPP  +H Y PPP VY  PPPP
Sbjct: 238 PYQQSMPPNNYQTPPTSQGTKSPVQPHKYLPPPYYYNSPPPQHQHNYVPPPLVYQYPPPP 297

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 56/144 (38%), Positives = 67/144 (46%), Gaps = 39/144 (27%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHY-------VYKSPPPPV--------------KHYS 118
           KSP  P K Y PPP Y++ PPP+  +       VY+ PPPP                HY+
Sbjct: 258 KSPVQPHK-YLPPPYYYNSPPPQHQHNYVPPPLVYQYPPPPYINKSPLLPSSPVTPYHYN 316

Query: 119 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-------------PVYHSPP-PPKKHYVYK 256
            PP Y   PPP   Y Y S PPP + YSPP             P   SPP  P+  Y Y 
Sbjct: 317 SPPTYQYSPPP---YNYLSSPPPAQ-YSPPLPPNAPKHLHPNAPHAKSPPASPQPLYQYN 372

Query: 257 SPPPP--VKHYSPPPV--YHSPPP 316
           +PPPP  V   + PP+  Y SPPP
Sbjct: 373 TPPPPNDVMPSTMPPLHSYQSPPP 396

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/106 (35%), Positives = 55/106 (51%), Gaps = 21/106 (19%)
 Frame = +2

Query: 83  YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV---- 250
           Y SPP P ++ SPP ++ SPP P ++    SPPP   +  PPP Y  P PP+ +Y+    
Sbjct: 185 YSSPPLPYQYPSPPAIHKSPPLPYQY----SPPP--SNQLPPPAYQYPSPPQNYYISPPP 238

Query: 251 ---------YKSPP------PPVK--HYSPPPVYHSPPPPKKHYVY 337
                    Y++PP       PV+   Y PPP Y++ PPP+  + Y
Sbjct: 239 YQQSMPPNNYQTPPTSQGTKSPVQPHKYLPPPYYYNSPPPQHQHNY 284

[197][TOP]
>UniRef100_B5DR41 GA28343 n=1 Tax=Drosophila pseudoobscura pseudoobscura
           RepID=B5DR41_DROPS
          Length = 578

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 59/127 (46%), Positives = 68/127 (53%), Gaps = 21/127 (16%)
 Frame = +2

Query: 2   KSPPPPV--KHYSP-PPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYV 166
           K  PP V  K  +P PPVY  P PPK  Y+   PP PVK   Y+PPP   +PP P K  V
Sbjct: 435 KPAPPAVIKKVVTPAPPVYVKPAPPKVEYL---PPAPVKKVVYTPPP---TPPAPVKKVV 488

Query: 167 YKSPPPPVK-HYSPPPVYHSPPPPKKHYVYKSPPP----PVKH--YSPPP---------V 298
           Y  PPPPV    +PP V + PP P K  VY  PPP    PVK   Y+PPP         V
Sbjct: 489 YTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPPPAPVQKV 548

Query: 299 YHSPPPP 319
            ++PPPP
Sbjct: 549 VYTPPPP 555

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/115 (45%), Positives = 57/115 (49%), Gaps = 10/115 (8%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYHSPPPPKKHYVYKSP 178
           PP PVK   Y+PPP   +PP P K  VY  PPPPV    +PP V + PP P K  VY  P
Sbjct: 465 PPAPVKKVVYTPPP---TPPAPVKKVVYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPP 521

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPPVYHSPPPPK 322
           PPP            PP P K  VY  PPPP       V +  PPPVY  P  PK
Sbjct: 522 PPP------------PPAPVKKVVYTPPPPPPPAPVQKVVYTPPPPVYVQPEGPK 564

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 57/127 (44%), Positives = 61/127 (48%), Gaps = 23/127 (18%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYHSPPPPKKHYVYKSP 178
           PP PVK   Y+PPP    PP P K  VY  PPPPV    +PP V + PP P K  VY  P
Sbjct: 171 PPAPVKKVVYTPPP---PPPAPVKKVVYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPP 227

Query: 179 PP----PVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK----------HYSPPPV---- 298
           PP    PVK   Y+PPP    PP P K  VY  PPPP            HY  P V    
Sbjct: 228 PPPPPAPVKKVVYTPPP--PPPPAPVKKVVYTPPPPPPAPAGILKEDGYHYGQPSVKFET 285

Query: 299 YHSPPPP 319
           Y  P PP
Sbjct: 286 YEKPAPP 292

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 57/127 (44%), Positives = 61/127 (48%), Gaps = 23/127 (18%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYHSPPPPKKHYVYKSP 178
           PP PVK   Y+PPP    PP P K  VY  PPPPV    +PP V + PP P K  VY  P
Sbjct: 318 PPAPVKKVVYTPPP---PPPAPVKKVVYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPP 374

Query: 179 PP----PVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK----------HYSPPPV---- 298
           PP    PVK   Y+PPP    PP P K  VY  PPPP            HY  P V    
Sbjct: 375 PPPPPAPVKKVVYTPPP--PPPPAPVKKVVYTPPPPPPAPAGILKEDGYHYGQPSVKFET 432

Query: 299 YHSPPPP 319
           Y  P PP
Sbjct: 433 YEKPAPP 439

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 57/131 (43%), Positives = 65/131 (49%), Gaps = 21/131 (16%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPV------------YHSPPPPKKHYVYKSPPPPV---KHYSP-PPVY 133
           PP PVK   Y+PPP             YH   P  K   Y+ P PP    K  +P PPVY
Sbjct: 394 PPAPVKKVVYTPPPPPPAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVTPAPPVY 453

Query: 134 HSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYH 304
             P PPK  Y+   PP PVK   Y+PPP   +PP P K  VY  PPPPV    +PP V +
Sbjct: 454 VKPAPPKVEYL---PPAPVKKVVYTPPP---TPPAPVKKVVYTPPPPPVYVKPAPPKVEY 507

Query: 305 SPPPPKKHYVY 337
            PP P K  VY
Sbjct: 508 LPPAPVKKVVY 518

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 57/131 (43%), Positives = 64/131 (48%), Gaps = 21/131 (16%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPV------------YHSPPPPKKHYVYKSPPPPV---KHYSP-PPVY 133
           PP PVK   Y+PPP             YH   P  K   Y+ P PP    K  +P PPVY
Sbjct: 247 PPAPVKKVVYTPPPPPPAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVTPAPPVY 306

Query: 134 HSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYH 304
             P PPK  Y+   PP PVK   Y+PPP    PP P K  VY  PPPPV    +PP V +
Sbjct: 307 VKPAPPKVEYL---PPAPVKKVVYTPPP---PPPAPVKKVVYTPPPPPVYVKPAPPKVEY 360

Query: 305 SPPPPKKHYVY 337
            PP P K  VY
Sbjct: 361 LPPAPVKKVVY 371

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 60/124 (48%), Positives = 66/124 (53%), Gaps = 12/124 (9%)
 Frame = +2

Query: 2   KSPPPPV--KHYSP-PPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYV 166
           K  PP V  K  +P PPVY  P PPK  Y+   PP PVK   Y+PPP    PP P K  V
Sbjct: 288 KPAPPAVIKKVVTPAPPVYVKPAPPKVEYL---PPAPVKKVVYTPPP---PPPAPVKKVV 341

Query: 167 YKSPPPPVK-HYSPPPVYHSPPPPKKHYVYK-SPPP---PVKH--YSPPPVYHSPPPPKK 325
           Y  PPPPV    +PP V + PP P K  VY   PPP   PVK   Y+PPP    PP P K
Sbjct: 342 YTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPP--PPPPAPVK 399

Query: 326 HYVY 337
             VY
Sbjct: 400 KVVY 403

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 63/166 (37%), Positives = 71/166 (42%), Gaps = 56/166 (33%)
 Frame = +2

Query: 5   SPPPPVKHY--SPPPVYHSPPPPKKHYVYKSPPP----PVKH--YSPPP----------V 130
           +PPPP  +   +PP V + PP P K  VY  PPP    PVK   Y+PPP          V
Sbjct: 196 TPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPPPAPVKKVV 255

Query: 131 YHSPPPPKK----------HY--------VYKSPPPPV---KHYSP-PPVYHSPPPPKKH 244
           Y  PPPP            HY         Y+ P PP    K  +P PPVY  P PPK  
Sbjct: 256 YTPPPPPPAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVTPAPPVYVKPAPPKVE 315

Query: 245 Y---------VYKSPPPP-------VKHYSPPPVYHSPPPPKKHYV 334
           Y         VY  PPPP       V    PPPVY  P PPK  Y+
Sbjct: 316 YLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEYL 361

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 54/111 (48%), Positives = 60/111 (54%), Gaps = 9/111 (8%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK-HYS 202
           +P PVY  P PPK  Y+   PP PVK   Y+PPP    PP P K  VY  PPPPV    +
Sbjct: 154 APAPVYVKPAPPKVEYL---PPAPVKKVVYTPPP---PPPAPVKKVVYTPPPPPVYVKPA 207

Query: 203 PPPVYHSPPPPKKHYVYK-SPPP---PVKH--YSPPPVYHSPPPPKKHYVY 337
           PP V + PP P K  VY   PPP   PVK   Y+PPP    PP P K  VY
Sbjct: 208 PPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPP--PPPPAPVKKVVY 256

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 53/128 (41%), Positives = 59/128 (46%), Gaps = 19/128 (14%)
 Frame = +2

Query: 8   PPPPVK-HYSPPPVYHSPPPPKKHYVYKSPPPP-------VKHYSPPPVYHSPPPPKKHY 163
           PPPPV    +PP V + PP P K  VY  PPPP       V +  PPP    PP P K  
Sbjct: 345 PPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPP---PPPAPVKKV 401

Query: 164 VYKSPPPPVKHYSPPPV-------YHSPPPPKKHYVYKSPPPPV---KHYSP-PPVYHSP 310
           VY  PPPP     P P        YH   P  K   Y+ P PP    K  +P PPVY  P
Sbjct: 402 VYTPPPPP-----PAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVTPAPPVYVKP 456

Query: 311 PPPKKHYV 334
            PPK  Y+
Sbjct: 457 APPKVEYL 464

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 53/134 (39%), Positives = 64/134 (47%), Gaps = 23/134 (17%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK----HY----------------SPP 124
           +PP PV + +PP   ++P PP K Y    P   +K    HY                +P 
Sbjct: 98  TPPRPV-YTAPPAKVYTPAPPAKVYTPAVPAGALKEDGYHYGQPSVKFETYEKPVETAPA 156

Query: 125 PVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPP 295
           PVY  P PPK  Y+   PP PVK   Y+PPP    PP P K  VY  PPPPV    +PP 
Sbjct: 157 PVYVKPAPPKVEYL---PPAPVKKVVYTPPP---PPPAPVKKVVYTPPPPPVYVKPAPPK 210

Query: 296 VYHSPPPPKKHYVY 337
           V + PP P K  VY
Sbjct: 211 VEYLPPAPVKKVVY 224

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 57/137 (41%), Positives = 65/137 (47%), Gaps = 28/137 (20%)
 Frame = +2

Query: 8   PPPPVK---HYSPPPVYH-SPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVY 169
           PP PVK   +  PPP  +  P PPK  Y+   PP PVK   Y+PPP    PP P K  VY
Sbjct: 186 PPAPVKKVVYTPPPPPVYVKPAPPKVEYL---PPAPVKKVVYTPPP--PPPPAPVKKVVY 240

Query: 170 KSPPP----PVKH--YSPPPV------------YHSPPPPKKHYVYKSPPPPV---KHYS 286
             PPP    PVK   Y+PPP             YH   P  K   Y+ P PP    K  +
Sbjct: 241 TPPPPPPPAPVKKVVYTPPPPPPAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVT 300

Query: 287 P-PPVYHSPPPPKKHYV 334
           P PPVY  P PPK  Y+
Sbjct: 301 PAPPVYVKPAPPKVEYL 317

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 45/113 (39%), Positives = 50/113 (44%), Gaps = 20/113 (17%)
 Frame = +2

Query: 5   SPPPPVKHY----SPPPVYHSPPPPKKHYVYKSPPPPVKH--YSPPP----------VYH 136
           +PP PVK       PPPVY  P PPK  Y+   PP PVK   Y+PPP          VY 
Sbjct: 479 TPPAPVKKVVYTPPPPPVYVKPAPPKVEYL---PPAPVKKVVYTPPPPPPPAPVKKVVYT 535

Query: 137 SPPPPK----KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHY 283
            PPPP     +  VY           PPPVY  P  P K Y Y + P P   Y
Sbjct: 536 PPPPPPPAPVQKVVYT---------PPPPVYVQPEGP-KGYSYPNDPQPSFDY 578

[198][TOP]
>UniRef100_Q1PE26 Leucine-rich repeat family protein/extensin family protein n=1
           Tax=Arabidopsis thaliana RepID=Q1PE26_ARATH
          Length = 218

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 50/112 (44%), Positives = 55/112 (49%), Gaps = 7/112 (6%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV    PP   HSPPPP       SPPPP   YSPPP   SPPP +   V  SPPP
Sbjct: 107 SPPPPVHSPPPPAPVHSPPPP-----VHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPP 161

Query: 185 PVKHYSPPPVYHSPPPP---KKHYVYKSPPPPVKHYSPPPV----YHSPPPP 319
                + PPV   PP P   K+     +P P    +  PP     Y SPPPP
Sbjct: 162 RPPKINSPPVQSPPPAPVEKKETPPAHAPAPSDDEFIIPPFIGHQYASPPPP 213

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/105 (44%), Positives = 54/105 (51%), Gaps = 3/105 (2%)
 Frame = +2

Query: 29  YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 208
           +SPPP  HSPPPP   +   SPPPPV    PPP  +SPPPP       SPPP     SPP
Sbjct: 106 HSPPPPVHSPPPPAPVH---SPPPPVHSPPPPPPVYSPPPP-----VFSPPP---SQSPP 154

Query: 209 PVYHSPPPPKK---HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
            VY  PP P K     V   PP PV+    PP  H+P P    ++
Sbjct: 155 VVYSPPPRPPKINSPPVQSPPPAPVEKKETPPA-HAPAPSDDEFI 198

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 32/68 (47%), Positives = 35/68 (51%)
 Frame = +2

Query: 134 HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
           HSPPPP       SPPPP   +SPPP  HSPPPP          PPV +  PPPV+  PP
Sbjct: 106 HSPPPP-----VHSPPPPAPVHSPPPPVHSPPPP----------PPV-YSPPPPVFSPPP 149

Query: 314 PPKKHYVY 337
                 VY
Sbjct: 150 SQSPPVVY 157

[199][TOP]
>UniRef100_B9MVI9 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9MVI9_POPTR
          Length = 417

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 51/107 (47%), Positives = 57/107 (53%), Gaps = 5/107 (4%)
 Frame = +2

Query: 14  PPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
           P + H+  SPPP+  SPPPP               +SPPP  HSPPPP       SPPPP
Sbjct: 334 PSIDHFLSSPPPLIPSPPPPV--------------HSPPPPIHSPPPP-----VHSPPPP 374

Query: 188 VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV---YHSPPPP 319
           V  +SPPP  HSPPPP       SPPPP K   PP +   Y SPPPP
Sbjct: 375 V--HSPPPPIHSPPPPMV-----SPPPPPKVVVPPNLGFSYSSPPPP 414

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 46/80 (57%), Positives = 49/80 (61%), Gaps = 3/80 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPPV  +SPPP  HSPPPP       SPPPPV  +SPPP  HSPPPP       SPPP
Sbjct: 349 SPPPPV--HSPPPPIHSPPPP-----VHSPPPPV--HSPPPPIHSPPPP-----MVSPPP 394

Query: 185 PVKHYSPPPV---YHSPPPP 235
           P K   PP +   Y SPPPP
Sbjct: 395 PPKVVVPPNLGFSYSSPPPP 414

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/78 (52%), Positives = 48/78 (61%), Gaps = 2/78 (2%)
 Frame = +2

Query: 98  PPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 271
           P + H+  SPPP+  SPPPP       SPPPP+  +SPPP  HSPPPP       SPPPP
Sbjct: 334 PSIDHFLSSPPPLIPSPPPP-----VHSPPPPI--HSPPPPVHSPPPP-----VHSPPPP 381

Query: 272 VKHYSPPPVYHSPPPPKK 325
           +  +SPPP   SPPPP K
Sbjct: 382 I--HSPPPPMVSPPPPPK 397

[200][TOP]
>UniRef100_B4JC42 GH10704 n=1 Tax=Drosophila grimshawi RepID=B4JC42_DROGR
          Length = 3029

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 50/116 (43%), Positives = 62/116 (53%), Gaps = 11/116 (9%)
 Frame = +2

Query: 11   PPPVKHYSP--------PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 166
            PPPVK   P        P V  + PPP K        PPVK  +PPPV  + PPP K   
Sbjct: 1201 PPPVKEAIPSLVKEVTSPTVKQATPPPAKEAT-----PPVKEATPPPVKKTTPPPVK--- 1252

Query: 167  YKSPPPPVKHYSPPPVYHSPPPPKKH---YVYKSPPPPVKHYSPPPVYHSPPPPKK 325
             K+ PPPVK  +PPPV  + PP K+     V ++ PPPVK  +PPPV  + PP K+
Sbjct: 1253 -KATPPPVKEATPPPVKQTTPPVKQATPPLVKEATPPPVKEATPPPVKEATPPAKQ 1307

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 44/104 (42%), Positives = 57/104 (54%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            ++ PPP K  +PP    +PPP KK     + PPPVK  +PPPV  + PPP      K   
Sbjct: 1222 QATPPPAKEATPPVKEATPPPVKK-----TTPPPVKKATPPPVKEATPPP-----VKQTT 1271

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
            PPVK  +PP V  + PPP K    ++ PPPVK  +PP    +PP
Sbjct: 1272 PPVKQATPPLVKEATPPPVK----EATPPPVKEATPPAKQANPP 1311

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 44/108 (40%), Positives = 58/108 (53%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
            ++ PP V+  + PPV  + PPP K  +    P  VK  + P V  + PPP K        
Sbjct: 1182 EATPPRVEQVTSPPVKEAVPPPVKEAI----PSLVKEVTSPTVKQATPPPAKEAT----- 1232

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            PPVK  +PPPV  + PPP K    K+ PPPVK  +PPPV  + PP K+
Sbjct: 1233 PPVKEATPPPVKKTTPPPVK----KATPPPVKEATPPPVKQTTPPVKQ 1276

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 51/156 (32%), Positives = 65/156 (41%), Gaps = 50/156 (32%)
 Frame = +2

Query: 2    KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH---YVYK 172
            K   PPVK  +PPPV  + PPP K    K+ PPPVK  +PPPV  + PP K+     V +
Sbjct: 1229 KEATPPVKEATPPPVKKTTPPPVK----KATPPPVKEATPPPVKQTTPPVKQATPPLVKE 1284

Query: 173  SPPPPVKHYSPPPVYHSPPPPKKHY----------------------------------- 247
            + PPPVK  +PPPV  + PP K+                                     
Sbjct: 1285 ATPPPVKEATPPPVKEATPPAKQANPPAKRAPFPSIKQPRATPNEQSSAASVKQATPVRQ 1344

Query: 248  -----VYKSPPPPVKHYS-------PPPVYHSPPPP 319
                 V ++ PPP+K  S       PPP     PPP
Sbjct: 1345 AILPSVKQTTPPPIKQESQLVKQTTPPPAKEDTPPP 1380

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/107 (41%), Positives = 55/107 (51%), Gaps = 4/107 (3%)
 Frame = +2

Query: 17   PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY----VYKSPPP 184
            PVK  +PP V  + PP     V +   PPVK   PPPV  + P   K      V ++ PP
Sbjct: 1171 PVKQATPPRVKEATPPR----VEQVTSPPVKEAVPPPVKEAIPSLVKEVTSPTVKQATPP 1226

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
            P K  +PP    +PPP KK     + PPPVK  +PPPV  + PPP K
Sbjct: 1227 PAKEATPPVKEATPPPVKK-----TTPPPVKKATPPPVKEATPPPVK 1268

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 43/128 (33%), Positives = 53/128 (41%), Gaps = 23/128 (17%)
 Frame = +2

Query: 5    SPPPPVK--HYSPPPVYHSP--------PPPKKHYVYKSPPPPVKHYSP-------PPVY 133
            S PPP    +  PPP  H P        PP     VY S PPP +H SP       PP+Y
Sbjct: 2770 SAPPPGSGPNARPPPYLHGPEHHGGPPPPPGALSSVYGSGPPPARHASPHLNPYRAPPIY 2829

Query: 134  HSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPPP---PVKHYSPPP-- 295
             +P     +Y  +  PP   +  P  V Y +       Y Y  PPP   P  H S P   
Sbjct: 2830 GNP-----NYAPRVAPPGSANMRPGAVDYAAGARGYPPYGYYPPPPLTTPPAHASAPSSV 2884

Query: 296  VYHSPPPP 319
            +  +PPPP
Sbjct: 2885 IVSAPPPP 2892

[201][TOP]
>UniRef100_B5HN88 Putative uncharacterized protein n=1 Tax=Streptomyces sviceus ATCC
           29083 RepID=B5HN88_9ACTO
          Length = 265

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 44/109 (40%), Positives = 56/109 (51%), Gaps = 3/109 (2%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYV---YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           PPP  H++PPP  H  PPP   +        PPP   ++PPP  H+PPP   H      P
Sbjct: 133 PPPDDHHTPPPGGHHTPPPGGDHTPPPGDHTPPPGGDHTPPPGDHTPPPGGDH-----TP 187

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           PP   ++PPP  H+PPP   H    +PPP  +H  PP  +H PPP   H
Sbjct: 188 PPGGDHTPPPGDHTPPPGGDH----TPPPGGEHTPPPGGHHMPPPQLPH 232

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 41/100 (41%), Positives = 50/100 (50%)
 Frame = +2

Query: 29  YSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 208
           ++PPP  H  PPP  H+     PPP   ++PPP  H+PPP   H      PPP  H  PP
Sbjct: 131 HTPPPDDHHTPPPGGHHT----PPPGGDHTPPPGDHTPPPGGDH-----TPPPGDHTPPP 181

Query: 209 PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
              H+PPP   H      PPP  H  PP   H+PPP  +H
Sbjct: 182 GGDHTPPPGGDH-----TPPPGDHTPPPGGDHTPPPGGEH 216

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/99 (40%), Positives = 49/99 (49%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP   ++PPP  H+PPP   H      PPP  H  PP   H+PPP   H      PPP 
Sbjct: 149 PPPGGDHTPPPGDHTPPPGGDH-----TPPPGDHTPPPGGDHTPPPGGDH-----TPPPG 198

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 307
            H  PP   H+PPP  +H    +PPP   H  PP + H+
Sbjct: 199 DHTPPPGGDHTPPPGGEH----TPPPGGHHMPPPQLPHT 233

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 34/80 (42%), Positives = 43/80 (53%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           +PPP   H +PPP  H+PPP   H      PPP   ++PPP  H+PPP   H    +PPP
Sbjct: 163 TPPPGGDH-TPPPGDHTPPPGGDH-----TPPPGGDHTPPPGDHTPPPGGDH----TPPP 212

Query: 185 PVKHYSPPPVYHSPPPPKKH 244
             +H  PP  +H PPP   H
Sbjct: 213 GGEHTPPPGGHHMPPPQLPH 232

[202][TOP]
>UniRef100_Q6ZD62 Os08g0108300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6ZD62_ORYSJ
          Length = 342

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 44/109 (40%), Positives = 61/109 (55%), Gaps = 3/109 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKS-PPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           ++PPPP +  +PPP   +PPPP++     + PPPP +   PPP    PPPP+     ++P
Sbjct: 66  RAPPPPGR--APPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPR-----RAP 118

Query: 179 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPP 319
           PPP    +PPP     PPP    +   PPP  + Y+PPP  H  +PPPP
Sbjct: 119 PPPA---TPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP 164

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/111 (39%), Positives = 55/111 (49%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP---PPVKHYSPPPVYHSPPPPKKHYVYK 172
           K P  P +  +PPP    PPPP       SPP   PP    +PPP   +PPPP++     
Sbjct: 33  KPPVMPPRPQAPPPPQRFPPPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRR----- 87

Query: 173 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           +PPPP     PPP   +PPPP        PPPP    +PPP    PPPP++
Sbjct: 88  APPPPA--LPPPPPRRAPPPPSM------PPPPPPRRAPPPPATPPPPPRR 130

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 43/106 (40%), Positives = 55/106 (51%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           ++PPPP     PPP   +PPPP        PPPP    +PPP    PPPP+     ++PP
Sbjct: 87  RAPPPPAL--PPPPPRRAPPPP------SMPPPPPPRRAPPPPATPPPPPR-----RAPP 133

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP     PPP    PP P+ +    +PPPP    +PPP + SPP P
Sbjct: 134 PPSPPIRPPP----PPTPRPY----APPPPSHPLAPPPPHISPPAP 171

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 42/108 (38%), Positives = 51/108 (47%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP +   PPP    PPP +       PPPP    +PPP    PPPP++      P PP+
Sbjct: 82  PPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRR--APPPPSPPI 139

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
           +   PP      PPP  H +  +PPPP  H SPP     PP P  H V
Sbjct: 140 RPPPPPTPRPYAPPPPSHPL--APPPP--HISPPAPVPPPPSPPPHIV 183

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/108 (39%), Positives = 56/108 (51%), Gaps = 1/108 (0%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-PVYHSPPPPKKHYVYKSPP 181
           +P PPV     PP   +PPPP++      PPPP     PP P   +PPPP +     +PP
Sbjct: 31  APKPPVM----PPRPQAPPPPQRF-----PPPPAPPIRPPSPPGRAPPPPGR-----APP 76

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           PP +  +PPP   +PPPP        PPPP +   PPP    PPPP++
Sbjct: 77  PPSQ--APPPPRRAPPPP------ALPPPPPRRAPPPPSMPPPPPPRR 116

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 41/98 (41%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +2

Query: 8   PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS--PPPPKKHYVYKSPP 181
           PPPP +   PPP    PPPP++     + PPP    +PPP      PPPP     Y +PP
Sbjct: 95  PPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPY-APP 153

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 295
           PP    +PPP + SPP P        PPPP    SPPP
Sbjct: 154 PPSHPLAPPPPHISPPAP-------VPPPP----SPPP 180

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 37/96 (38%), Positives = 47/96 (48%), Gaps = 1/96 (1%)
 Frame = +2

Query: 35  PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP-P 211
           P P Y   P P       +P PPV     PP   +PPPP++      PPPP     PP P
Sbjct: 13  PFPFYPPNPNPYAPLNPNAPKPPVM----PPRPQAPPPPQRF-----PPPPAPPIRPPSP 63

Query: 212 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              +PPPP +     +PPPP +  +PPP   +PPPP
Sbjct: 64  PGRAPPPPGR-----APPPPSQ--APPPPRRAPPPP 92

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 30/72 (41%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP---VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           +PPPP +   PPP   +   PPP  + Y   +PPPP    +PPP + SPP P        
Sbjct: 123 TPPPPPRRAPPPPSPPIRPPPPPTPRPY---APPPPSHPLAPPPPHISPPAP-------V 172

Query: 176 PPPPVKHYSPPP 211
           PPPP    SPPP
Sbjct: 173 PPPP----SPPP 180

[203][TOP]
>UniRef100_Q1PDU7 Proline-rich extensin-like family protein n=1 Tax=Arabidopsis
           thaliana RepID=Q1PDU7_ARATH
          Length = 168

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 57/131 (43%), Positives = 65/131 (49%), Gaps = 20/131 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 178
           SPPPP    SPPP  V  SPPPP    +   PPPPV    PPP    PPPP    + +SP
Sbjct: 43  SPPPPPVLLSPPPPPVNLSPPPPP--VLLSPPPPPVLFSPPPPTVTRPPPPPT--ITRSP 98

Query: 179 PPP-------VKHYSPPPVYH-------SPPPPKKHYVYK-SPPPPVKHYSPPPVY---H 304
           PPP        K   PPP Y         PPPP+    YK SPPPP     PP  Y   +
Sbjct: 99  PPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPP-----PPSKYGRVY 153

Query: 305 SPPPPKKHYVY 337
           SPPPP K +++
Sbjct: 154 SPPPPGKSWLW 164

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 53/111 (47%), Positives = 58/111 (52%), Gaps = 10/111 (9%)
 Frame = +2

Query: 38  PPVYHSPPPPKKHYVYKSPPPPVKHYS--PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 211
           P V  SPPPP    V  SPPPP  + S  PPPV  SPPPP    V  SPPPP     PPP
Sbjct: 38  PLVDLSPPPPP---VLLSPPPPPVNLSPPPPPVLLSPPPPP---VLFSPPPPTVTRPPPP 91

Query: 212 --VYHSPPPPKKH---YVYKSPPPPVKHYS---PPPVYHSPPPPKKHYVYK 340
             +  SPPPP+     Y  K+PPPP   Y    PPP    PPPP+    YK
Sbjct: 92  PTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPP----PPPPQAARSYK 138

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 40/91 (43%), Positives = 47/91 (51%), Gaps = 7/91 (7%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS---PPPVYHSPPPPKKHYVYK 172
           + PPPP    SPPP    P P    Y  K+PPPP   Y    PPP    PPPP+    YK
Sbjct: 87  RPPPPPTITRSPPP----PRPQAAAYYKKTPPPPPYKYGRVYPPP----PPPPQAARSYK 138

Query: 173 -SPPPPVKHYSPPPVY---HSPPPPKKHYVY 253
            SPPPP     PP  Y   +SPPPP K +++
Sbjct: 139 RSPPPP-----PPSKYGRVYSPPPPGKSWLW 164

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/90 (44%), Positives = 44/90 (48%), Gaps = 9/90 (10%)
 Frame = +2

Query: 95  PPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYHSPPPPKKHYVYKSPP 265
           P P+   SPPP  V  SPPPP  +     PPPPV     PPPV  SPPPP    V + PP
Sbjct: 36  PAPLVDLSPPPPPVLLSPPPPPVNL--SPPPPPVLLSPPPPPVLFSPPPPT---VTRPPP 90

Query: 266 PPVKHYSPPP------VYHSPPPPKKHYVY 337
           PP    SPPP       Y+   PP   Y Y
Sbjct: 91  PPTITRSPPPPRPQAAAYYKKTPPPPPYKY 120

[204][TOP]
>UniRef100_Q1EP18 Protein kinase family protein n=1 Tax=Musa balbisiana
           RepID=Q1EP18_MUSBA
          Length = 637

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 51/117 (43%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP---------PKKHYVYKSPPP---PVKHYSPPPVYHSPPP 148
           SPPPP    SPPP  +SPPP         P       SPPP   P     PPPV  SPPP
Sbjct: 16  SPPPP-SSLSPPPASNSPPPAPNAPPPPTPPSPPPASSPPPTPPPPADVPPPPVVTSPPP 74

Query: 149 PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P       SPPPP    SPPP    PPPP       + PPP    +PPP    PPPP
Sbjct: 75  PDPPPPSVSPPPPA--LSPPPASTPPPPPSASPPPAAAPPPPPFATPPPTNSPPPPP 129

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 44/101 (43%), Positives = 48/101 (47%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP     PPPV  SPPPP       SPPPP    SPPP    PPPP       + PPP 
Sbjct: 57  PPPPADVPPPPVVTSPPPPDPPPPSVSPPPPA--LSPPPASTPPPPPSASPPPAAAPPPP 114

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
              +PPP    PPPP       +PPP +    PPP   SPP
Sbjct: 115 PFATPPPTNSPPPPPS-----ATPPPTIS--PPPPGSQSPP 148

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 47/110 (42%), Positives = 49/110 (44%), Gaps = 5/110 (4%)
 Frame = +2

Query: 5   SPPP-----PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 169
           SPPP     P     PPP   SPPP        + PPP  +  PPP   SPPP       
Sbjct: 3   SPPPSPSATPPSTSPPPPSSLSPPPAS------NSPPPAPNAPPPPTPPSPPPASSP--- 53

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              PPP     PPPV  SPPPP       SPPPP    SPPP    PPPP
Sbjct: 54  PPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPA--LSPPPASTPPPPP 101

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 47/117 (40%), Positives = 51/117 (43%), Gaps = 9/117 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP     PPP   SPPPP       S PPP    SPPP    PPPP       + PP
Sbjct: 71  SPPPP----DPPPPSVSPPPPALSPPPASTPPPPPSASPPPAAAPPPPPFATPPPTNSPP 126

Query: 185 PVKHYSPPPVYHSPPPP---------KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
           P    +PPP   SPPPP           +    +PP P K  SPP    SP P   H
Sbjct: 127 PPPSATPPPTI-SPPPPGSQSPPARAPSNSTGGTPPAPPKPPSPP----SPSPSASH 178

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 39/101 (38%), Positives = 42/101 (41%), Gaps = 6/101 (5%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           SPPPP    SPPP    PPPP       + PPP    +PPP    PPPP         PP
Sbjct: 83  SPPPPA--LSPPPASTPPPPPSASPPPAAAPPPPPFATPPPTNSPPPPPSATPPPTISPP 140

Query: 185 PVKHYSPPPVYHS------PPPPKKHYVYKSPPPPVKHYSP 289
           P    SPP    S      PP P K     SP P   H +P
Sbjct: 141 PPGSQSPPARAPSNSTGGTPPAPPKPPSPPSPSPSASHRAP 181

[205][TOP]
>UniRef100_UPI000198347E PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vinifera
           RepID=UPI000198347E
          Length = 207

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/120 (45%), Positives = 61/120 (50%), Gaps = 16/120 (13%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPP---PPKKHY----VYKSPP------PPVKHYSPPPVYHSPPPP 151
           PPP +H  P PVY SPP   PP ++     VYK PP      PP ++  P PVY  PP  
Sbjct: 27  PPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPSPPVEKPPPEYKPPTPVYRPPPVE 86

Query: 152 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS---PPPVYHSPPPPK 322
           K    YK PP PV  Y PPPV   PPP  K      PPPP KH +   PP V   PP PK
Sbjct: 87  KPPPEYK-PPTPV--YKPPPV-EKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPK 142

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 54/118 (45%), Positives = 59/118 (50%), Gaps = 12/118 (10%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPP---PPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           P     + PPP  H PP P    VYKSPP   PP ++  P PVY  PP P    V K PP
Sbjct: 19  PSLANDHKPPPYEHKPPLP----VYKSPPLGKPPPEYKPPTPVYKPPPSPP---VEKPPP 71

Query: 182 ---PPVKHYSPPPVYHSPP---PPKKHYVYKSPP---PPVKHYSPPPVYHSPPPPKKH 328
              PP   Y PPPV   PP   PP    VYK PP   PP ++  P PV   PPPP KH
Sbjct: 72  EYKPPTPVYRPPPVEKPPPEYKPPTP--VYKPPPVEKPPPEYKPPTPV--KPPPPPKH 125

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 53/133 (39%), Positives = 64/133 (48%), Gaps = 23/133 (17%)
 Frame = +2

Query: 2   KSPP---PPVKHYSPPPVYHSPP------PPKKHY----VYKSPP---PPVKHYSPPPVY 133
           KSPP   PP ++  P PVY  PP      PP ++     VY+ PP   PP ++  P PVY
Sbjct: 40  KSPPLGKPPPEYKPPTPVYKPPPSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVY 99

Query: 134 HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHS 307
             PP  K    YK PP PVK   PPP  H  P  PP+   V + PP P     PP +   
Sbjct: 100 KPPPVEKPPPEYK-PPTPVK--PPPPPKHKTPTLPPR---VVRPPPTPKPPTLPPIIVRP 153

Query: 308 PP-----PPKKHY 331
           PP     PP+ HY
Sbjct: 154 PPTKEPSPPQGHY 166

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 40/93 (43%), Positives = 44/93 (47%), Gaps = 9/93 (9%)
 Frame = +2

Query: 80  VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP---PPVKHYSPPPVYHSPPPPKKHYV 250
           V  + P     + PPP  H PP P    VYKSPP   PP ++  P PVY  PP P    V
Sbjct: 14  VVLTTPSLANDHKPPPYEHKPPLP----VYKSPPLGKPPPEYKPPTPVYKPPPSPP---V 66

Query: 251 YKSPP---PPVKHYSPPPVYHSPP---PPKKHY 331
            K PP   PP   Y PPPV   PP   PP   Y
Sbjct: 67  EKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVY 99

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 42/115 (36%), Positives = 47/115 (40%), Gaps = 9/115 (7%)
 Frame = +2

Query: 11  PPPVKHYSP---PPVYHSPPPPKKHYV------YKSPPPPVKHYSPPPVYHSPPPPKKHY 163
           PPPV+   P   PP    PPPP KH           PPP  K  + PP+   PPP K+  
Sbjct: 101 PPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTKE-- 158

Query: 164 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKH 328
               P PP  HY   P   +PP       YK PP P K    P   H   PP  H
Sbjct: 159 ----PSPPQGHYPGHPPVETPPSTP----YKKPPTPEKKPWAPHHKHFKAPPPIH 205

[206][TOP]
>UniRef100_Q4LB97 Putative extensin (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q4LB97_TOBAC
          Length = 57

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/82 (59%), Positives = 50/82 (60%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           KSPPPP      PPVY SPPPP   Y YKSPPP      PPPVY SPPPP    VYKSPP
Sbjct: 1   KSPPPP------PPVYKSPPPPV--YKYKSPPP------PPPVYKSPPPP----VYKSPP 42

Query: 182 PPVKHYSPPPVYHSPPPPKKHY 247
           PP  +Y     Y SPPPP  HY
Sbjct: 43  PPYHYY-----YTSPPPP--HY 57

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/82 (59%), Positives = 50/82 (60%)
 Frame = +2

Query: 86  KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 265
           KSPPPP      PPVY SPPPP   Y YKSPPP      PPPVY SPPPP    VYKSPP
Sbjct: 1   KSPPPP------PPVYKSPPPPV--YKYKSPPP------PPPVYKSPPPP----VYKSPP 42

Query: 266 PPVKHYSPPPVYHSPPPPKKHY 331
           PP  +Y     Y SPPPP  HY
Sbjct: 43  PPYHYY-----YTSPPPP--HY 57

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 33/57 (57%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +2

Query: 170 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYHSPPPPKKHYVY 337
           KSPPPP      PPVY SPPPP   Y YKSPPPP   + SPPP  +  PPP  HY Y
Sbjct: 1   KSPPPP------PPVYKSPPPPV--YKYKSPPPPPPVYKSPPPPVYKSPPPPYHYYY 49

[207][TOP]
>UniRef100_Q41402 Nodulin n=1 Tax=Sesbania rostrata RepID=Q41402_SESRO
          Length = 330

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/126 (40%), Positives = 63/126 (50%), Gaps = 22/126 (17%)
 Frame = +2

Query: 11  PPPVKH---YSPPPVYHSPPPPKKHYVYKSP---PPPV---KHYSPPPVYHSP---PPPK 154
           PPP++    Y PPP Y  PPP  K  ++  P   PPPV    +  PPPVY  P   PPP 
Sbjct: 30  PPPIEKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPYEKPPPV 89

Query: 155 KHYVYKSPPPPVK--HYSPPPVYHSP---PPPKKHYVYKSPPPPVK--HYSPPPVY---H 304
               Y+ PPP  +  H  PPP Y  P   PPP+    ++ PPP  +  H  PPP Y   H
Sbjct: 90  YPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPH 149

Query: 305 SPPPPK 322
             PPP+
Sbjct: 150 EKPPPE 155

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 51/133 (38%), Positives = 65/133 (48%), Gaps = 26/133 (19%)
 Frame = +2

Query: 2   KSPP---PPVKHYSPPPVYHSP--------PPPKKHYVYKSPPP--PVKHYSPPPVYHSP 142
           + PP   PP  +  PPPVY  P        PPP     Y+ PPP  P  +  PPPVY  P
Sbjct: 34  EKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPYEKPPPVYPPP 93

Query: 143 ---PPPKKHYVYKSPPPPVK--HYSPPPVY---HSPPPPKKHYVYKSPPPPVK--HYSPP 292
              PPP+    ++ PPP  +  H +PPP Y   H  PPP+    ++ PPP  +  H  PP
Sbjct: 94  YEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPP 153

Query: 293 PVY---HSPPPPK 322
           P Y   H  PPP+
Sbjct: 154 PEYQPPHEKPPPE 166

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/124 (40%), Positives = 62/124 (50%), Gaps = 15/124 (12%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSP---PPPKKHYVYKSPPP--PVKHYSPPPVY---HSPPPPKKHYV 166
           PPP +   PPPVY  P   PPP     Y+ PPP  P  +  PPP Y   H  PPP+    
Sbjct: 58  PPPYE--KPPPVYSPPYEKPPPVYPPPYEKPPPVYPPPYEKPPPEYQPPHEKPPPEYQPP 115

Query: 167 YKSPPPPVK--HYSPPPVY---HSPPPPKKHYVYKSPPPPVK--HYSPPPVYHSPPPPKK 325
           +++PPP  +  H  PPP Y   H  PPP+    ++ PPP  +  H  PPP Y  PP  K 
Sbjct: 116 HENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQ-PPQEKP 174

Query: 326 HYVY 337
             VY
Sbjct: 175 PPVY 178

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 49/128 (38%), Positives = 61/128 (47%), Gaps = 18/128 (14%)
 Frame = +2

Query: 2   KSPPP--PVKHYSPPPVY---HSPPPPKKHYVYKSPPPPVK--HYSPPPVY---HSPPPP 151
           + PPP  P  +  PPP Y   H  PPP+    +++PPP  +  H  PPP Y   H  PPP
Sbjct: 84  EKPPPVYPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPP 143

Query: 152 KKHYVYKSPPPPVK--HYSPPPVYHSP---PPPKKHYVYKSPP---PPVKHYSPPPVYHS 307
           +    ++ PPP  +  H  PPP Y  P   PPP     Y+ PP   PP   Y  PP Y  
Sbjct: 144 EYQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPPVYPPPYEKPPHEKPP--SYEKPPPYEK 201

Query: 308 PPPPKKHY 331
           PP  K  Y
Sbjct: 202 PPHEKPPY 209

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 49/123 (39%), Positives = 60/123 (48%), Gaps = 19/123 (15%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSP---PPP---KKHYVYKSPPPPVKHYSPPPVYHSP---PPPKKHY 163
           P    +Y PPP+   P   PPP   K   VYK P  P  +  PPPVY  P   PPP    
Sbjct: 22  PVLANYYEPPPIEKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPP 81

Query: 164 VYKSPPP--PVKHYSPPPVY---HSPPPPKKHYVYKSPPPPVK--HYSPPPVY---HSPP 313
            Y+ PPP  P  +  PPP Y   H  PPP+    +++PPP  +  H  PPP Y   H  P
Sbjct: 82  PYEKPPPVYPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKP 141

Query: 314 PPK 322
           PP+
Sbjct: 142 PPE 144

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 48/130 (36%), Positives = 65/130 (50%), Gaps = 17/130 (13%)
 Frame = +2

Query: 2   KSPPP--PVKHYSPPPVYHSP---PPPKKHYVYKSPPPPVK--HYSPPPVY---HSPPPP 151
           + PPP  P  +  PPPVY  P   PPP+    ++ PPP  +  H +PPP Y   H  PPP
Sbjct: 73  EKPPPVYPPPYEKPPPVYPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPP 132

Query: 152 KKHYVYKSPPPPVK--HYSPPPVYHSP--PPPKKHYVYKSPPPPVKHYSPP---PVYHSP 310
           +    ++ PPP  +  H  PPP Y  P   PP ++   +  PPPV  Y PP   P +  P
Sbjct: 133 EYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPPV--YPPPYEKPPHEKP 190

Query: 311 PPPKKHYVYK 340
           P  +K   Y+
Sbjct: 191 PSYEKPPPYE 200

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 50/136 (36%), Positives = 59/136 (43%), Gaps = 29/136 (21%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPP---PPKKHYVYKSPP--------PPVK---HYSPPPVY-- 133
           + PPP  K     P Y  PP   PP +   Y  PP        PP +   H  PPP Y  
Sbjct: 194 EKPPPYEKPPHEKPPYEKPPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKP 253

Query: 134 -HSPPPPKKHYVYKSPPPPVK--HYSPPPVY---HSPPPPKKHYVYKSPPPPVKH----- 280
            H  PPP+    ++ PPP  K  H  PPP Y   H  PPP ++  Y  PPP  K      
Sbjct: 254 PHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHEKPPPPEYPPYVKPPPEYKPPHEKP 313

Query: 281 --YSPPPVYHSPPPPK 322
             Y+PPP  H PP  K
Sbjct: 314 PGYNPPPYGHYPPSKK 329

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 46/123 (37%), Positives = 57/123 (46%), Gaps = 16/123 (13%)
 Frame = +2

Query: 2   KSPPPPVK--HYSPPPVY---HSPPPPKKHYVYKSPPPPVK--HYSPPPVYHSP---PPP 151
           ++PPP  +  H  PPP Y   H  PPP+    ++ PPP  +  H  PPP Y  P   PPP
Sbjct: 117 ENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPP 176

Query: 152 KKHYVYKSPP---PPVKHYSPPPVYHSPP---PPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
                Y+ PP   PP   Y  PP Y  PP   PP +   ++ PP     Y  PP Y  PP
Sbjct: 177 VYPPPYEKPPHEKPP--SYEKPPPYEKPPHEKPPYEKPPHEKPPHEKPPYDKPP-YEKPP 233

Query: 314 PPK 322
             K
Sbjct: 234 HEK 236

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 51/148 (34%), Positives = 62/148 (41%), Gaps = 41/148 (27%)
 Frame = +2

Query: 11  PPPVKH--YSPPPVYHSPPP----PKKHYVYKSPP---PPVKHYSPP---PVYHSPP--- 145
           PPP +   +  PP Y  PPP    P +   Y+ PP   PP  H  PP   P Y  PP   
Sbjct: 179 PPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPPHEKPP--HEKPPYDKPPYEKPPHEK 236

Query: 146 PPKKHYVYKSPPPPVK--HYSPPPVY--------------HSPPPPKKHYVYKSPPPP-- 271
           PP +   ++ PPP  K  H  PPP Y              H  PPP+    ++ PPPP  
Sbjct: 237 PPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHEKPPPPEY 296

Query: 272 VKHYSPPPVYHSP--------PPPKKHY 331
             +  PPP Y  P        PPP  HY
Sbjct: 297 PPYVKPPPEYKPPHEKPPGYNPPPYGHY 324

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 45/123 (36%), Positives = 57/123 (46%), Gaps = 16/123 (13%)
 Frame = +2

Query: 2   KSPPPPVK--HYSPPPVYHSP---PPPKKHYVYKSPPPPVK--HYSPPPVY---HSPPPP 151
           + PPP  +  H  PPP Y  P   PPP+    ++ PPP  +  H  PPP Y   H  PPP
Sbjct: 95  EKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPP 154

Query: 152 KKHYVYKSPPPPVK--HYSPPPVY----HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 313
           +    ++ PPP  +     PPPVY       PP +K   Y+ PPP  K     P Y  PP
Sbjct: 155 EYQPPHEKPPPEYQPPQEKPPPVYPPPYEK-PPHEKPPSYEKPPPYEKPPHEKPPYEKPP 213

Query: 314 PPK 322
             K
Sbjct: 214 HEK 216

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 49/129 (37%), Positives = 58/129 (44%), Gaps = 16/129 (12%)
 Frame = +2

Query: 2   KSPPPPVK--HYSPPPVYHSP---PPPKKHYVYKSPPPPVKHYSPPPVYHSPP---PPKK 157
           + PPP  +     PPPVY  P   PP +K   Y+ PPP  K     P Y  PP   PP +
Sbjct: 161 EKPPPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPPHEKPPHE 220

Query: 158 HYVYKSPP---PPVK---HYSPPPVYHSPPPPKKHYVYKSPPPPVK--HYSPPPVYHSPP 313
              Y  PP   PP +   H  PP   H  PPP+    ++ PPP  K  H  PPP Y  PP
Sbjct: 221 KPPYDKPPYEKPPHEKPPHEKPP---HEKPPPEYKPPHEKPPPEYKPPHEKPPP-YEKPP 276

Query: 314 PPKKHYVYK 340
             K    YK
Sbjct: 277 HEKPPPEYK 285

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 49/131 (37%), Positives = 58/131 (44%), Gaps = 22/131 (16%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP---PPKKHYVYKSPP 181
           PPPV     PP Y   PP +K   Y+ PPP  K     P Y  PP   PP +   Y  PP
Sbjct: 174 PPPVY----PPPYEK-PPHEKPPSYEKPPPYEKPPHEKPPYEKPPHEKPPHEKPPYDKPP 228

Query: 182 ---PPVK--------HYSPPPVY---HSPPPPKKHYVYKSPPPPVK--HYSPPPVY---H 304
              PP +        H  PPP Y   H  PPP+    ++ PPP  K  H  PPP Y   H
Sbjct: 229 YEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPH 288

Query: 305 SPPPPKKHYVY 337
             PPP ++  Y
Sbjct: 289 EKPPPPEYPPY 299

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 40/146 (27%)
 Frame = +2

Query: 2   KSPPPPVK--HYSPPPVY---HSPPPPKKHYVYKSPPPPVK--HYSPPPVY----HSPP- 145
           + PPP  +  H  PPP Y   H  PPP+    ++ PPP  +     PPPVY      PP 
Sbjct: 128 EKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPPVYPPPYEKPPH 187

Query: 146 --------------PPKKHYVYKSPP---PPVKHYSPP---PVYHSPP---PPKKHYVYK 256
                         PP +   Y+ PP   PP  H  PP   P Y  PP   PP +   ++
Sbjct: 188 EKPPSYEKPPPYEKPPHEKPPYEKPPHEKPP--HEKPPYDKPPYEKPPHEKPPHEKPPHE 245

Query: 257 SPPPPVK--HYSPPPVY---HSPPPP 319
            PPP  K  H  PPP Y   H  PPP
Sbjct: 246 KPPPEYKPPHEKPPPEYKPPHEKPPP 271

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 38/96 (39%), Positives = 45/96 (46%), Gaps = 15/96 (15%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVY---HSPPPPKKHYVYKSPPPPVK--HYSPPPVY---HSPPPPKK 157
           K P     H  PPP Y   H  PPP+    ++ PPP  K  H  PPP Y   H  PPP +
Sbjct: 236 KPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHEKPPPPE 295

Query: 158 HYVYKSPPPPVKH-------YSPPPVYHSPPPPKKH 244
           +  Y  PPP  K        Y+PPP  H  PP KK+
Sbjct: 296 YPPYVKPPPEYKPPHEKPPGYNPPPYGH-YPPSKKN 330

[208][TOP]
>UniRef100_B9SMV7 Vegetative cell wall protein gp1, putative n=1 Tax=Ricinus communis
           RepID=B9SMV7_RICCO
          Length = 479

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/110 (45%), Positives = 58/110 (52%), Gaps = 4/110 (3%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPP---PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
           SPPPP+   SPPP+  SPPP           SPPPPV   SPPP   SPPPP        
Sbjct: 155 SPPPPIVQPSPPPIIPSPPPLVTSPPPVTVPSPPPPVIVPSPPPP--SPPPPCPPPPSPP 212

Query: 176 PP-PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 322
           PP PP     PPP+  SPPPP      + PPP +  +  PP+  SPPPP+
Sbjct: 213 PPSPPPPSPPPPPLVPSPPPPLFPSTPEIPPPII--FPAPPLVPSPPPPE 260

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 51/107 (47%), Positives = 56/107 (52%), Gaps = 4/107 (3%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP---PKKHYVYKSPP 181
           PPP    SPPP+  SPPP     +  SPPPP+   SPPP+  SPPP           SPP
Sbjct: 136 PPP----SPPPIVPSPPPIP---LVPSPPPPIVQPSPPPIIPSPPPLVTSPPPVTVPSPP 188

Query: 182 PPVKHYSPPPVYHSPP-PPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PPV   SPPP    PP PP       SPPPP     PPP+  SPPPP
Sbjct: 189 PPVIVPSPPPPSPPPPCPPPPSPPPPSPPPPSP--PPPPLVPSPPPP 233

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 46/106 (43%), Positives = 54/106 (50%), Gaps = 3/106 (2%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           P P   ++P P     PPP++       PPP    SPPP+  SPPP     +  SPPPP+
Sbjct: 116 PSPDNPFNPTP--RPSPPPRRR------PPP----SPPPIVPSPPPIP---LVPSPPPPI 160

Query: 191 KHYSPPPVYHSPPP---PKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
              SPPP+  SPPP           SPPPPV   SPPP   SPPPP
Sbjct: 161 VQPSPPPIIPSPPPLVTSPPPVTVPSPPPPVIVPSPPP--PSPPPP 204

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 37/94 (39%), Positives = 43/94 (45%)
 Frame = +2

Query: 35  PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 214
           P P Y SP  P     +   P P    SPPP    PP         SPPP V    P P+
Sbjct: 111 PFPTYPSPDNP-----FNPTPRP----SPPPRRRPPP---------SPPPIVPSPPPIPL 152

Query: 215 YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 316
             SPPPP    + +  PPP+   SPPP+  SPPP
Sbjct: 153 VPSPPPP----IVQPSPPPIIP-SPPPLVTSPPP 181

[209][TOP]
>UniRef100_Q8LJ87 Os01g0356900 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q8LJ87_ORYSJ
          Length = 503

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/108 (45%), Positives = 54/108 (50%), Gaps = 5/108 (4%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           P P K  +P    HSPPPP      +SPPPP    SPP    SPPP        SPPPP 
Sbjct: 400 PAPAKKPAPESSKHSPPPPPPPAPVQSPPPPAPVVSPPSPVFSPPPA------FSPPPPP 453

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKH-YSPPPV----YHSPPPP 319
           K   PPPV   PPPP       SPPPP++     PP+    Y SPPPP
Sbjct: 454 KTSPPPPVSSPPPPPPP---TMSPPPPIQEPVILPPILSAKYQSPPPP 498

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 43/92 (46%), Positives = 46/92 (50%), Gaps = 2/92 (2%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           +SPPPP    SPP    SPPP        SPPPP K  SPPP   SPPPP        PP
Sbjct: 425 QSPPPPAPVVSPPSPVFSPPPA------FSPPPPPK-TSPPPPVSSPPPP--------PP 469

Query: 182 PPVKHYSPPPVYHSPP--PPKKHYVYKSPPPP 271
           P +   SPPP    P   PP     Y+SPPPP
Sbjct: 470 PTM---SPPPPIQEPVILPPILSAKYQSPPPP 498

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 35/72 (48%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV-YHSPPPPKKHYVYKSPP 181
           SPP PV  +SPPP +  PPPPK      SPPPPV    PPP    SPPPP +  V   P 
Sbjct: 435 SPPSPV--FSPPPAFSPPPPPKT-----SPPPPVSSPPPPPPPTMSPPPPIQEPVILPPI 487

Query: 182 PPVKHYSPPPVY 217
              K+ SPPP +
Sbjct: 488 LSAKYQSPPPPF 499

[210][TOP]
>UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1
            Tax=Ostreococcus tauri RepID=Q010M7_OSTTA
          Length = 1449

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 50/105 (47%), Positives = 50/105 (47%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP     PPP    PPPP        PPPP    SPPP   SPPPP       SPPP
Sbjct: 798  SPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPP----SPPPPPSSPPPPS-----PSPPP 848

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                 SPPP    PPPP        PPPP    SPPP   SPPPP
Sbjct: 849  -----SPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPP---SPPPP 885

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 52/105 (49%), Positives = 52/105 (49%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP    SPPP   SPPPP       SPPP     SPPP    PPPP        PPP
Sbjct: 825  SPPPPP---SPPPPPSSPPPPS-----PSPPP-----SPPPAPSPPPPPNPPPAPTPPPP 871

Query: 185  PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P    SPPP   SPPPP       SPPPP    SPPP   SP PP
Sbjct: 872  PSPPPSPPP---SPPPP------PSPPPPP---SPPP---SPSPP 901

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 49/104 (47%), Positives = 51/104 (49%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PP P    SPPP    PPPP        PPPP    SPPP    PPPP       SPPPP
Sbjct: 841  PPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPP--SPPPPP-------SPPPP 891

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
                SPPP   SP PP       S PPP+   SPPP+  SPPPP
Sbjct: 892  P---SPPP---SPSPPPSSNPPLSSPPPLS--SPPPL-SSPPPP 926

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 46/96 (47%), Positives = 47/96 (48%)
 Frame = +2

Query: 32   SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 211
            SPPP   SPPPP    +  SPPPP     PPP    PPPP        PPPP    SPPP
Sbjct: 786  SPPP---SPPPP----LPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPP----SPPP 834

Query: 212  VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
               SPPPP       SPPP     SPPP    PPPP
Sbjct: 835  PPSSPPPPS-----PSPPP-----SPPPAPSPPPPP 860

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 50/105 (47%), Positives = 54/105 (51%), Gaps = 1/105 (0%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP    SPPP    PPPP       SPPPP    SPPP   SP PP       S PPP
Sbjct: 869  PPPPSPPPSPPP--SPPPPP-------SPPPPP---SPPP---SPSPPPSSNPPLSSPPP 913

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP-PPVYHSPPPP 319
            +   SPPP+  SPPPP       SPPPP     P PP+  +PPPP
Sbjct: 914  LS--SPPPL-SSPPPP------SSPPPPSPPLPPSPPLPPNPPPP 949

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/106 (41%), Positives = 49/106 (46%), Gaps = 1/106 (0%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPPPP     PP    SP PP       S PPP+   SPPP+  SPPPP       SPPP
Sbjct: 881  SPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLS--SPPPL-SSPPPP------SSPPP 931

Query: 185  PVKHYSP-PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            P     P PP+  +PPPP       SP P       PP   +P PP
Sbjct: 932  PSPPLPPSPPLPPNPPPP------PSPSPXXXXXXXPPRLPTPSPP 971

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 41/108 (37%), Positives = 44/108 (40%), Gaps = 4/108 (3%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYH----SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 175
            PP P    SPPP  +    SPPP        SPPPP    SPPP    P PP        
Sbjct: 891  PPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPS---SPPP----PSPP-------L 936

Query: 176  PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
            PP P    +PPP    PP P         PP +   SPPP     PPP
Sbjct: 937  PPSPPLPPNPPP----PPSPSPXXXXXXXPPRLPTPSPPPPSPPLPPP 980

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/98 (39%), Positives = 44/98 (44%), Gaps = 1/98 (1%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP-PPVYHSPPPPKKHYVYKSPP 181
            S PPP+   SPPP+  SPPPP       SPPPP     P PP+  +PPPP       SP 
Sbjct: 909  SSPPPLS--SPPPL-SSPPPP------SSPPPPSPPLPPSPPLPPNPPPP------PSPS 953

Query: 182  PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 295
            P       PP   +P          SPPPP     PPP
Sbjct: 954  PXXXXXXXPPRLPTP----------SPPPPSPPLPPPP 981

[211][TOP]
>UniRef100_C0P2F3 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0P2F3_MAIZE
          Length = 326

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 41/106 (38%), Positives = 57/106 (53%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           ++PPPP    +PPP    PPPP++     + PPP    +PPP    PPPP+     ++PP
Sbjct: 49  RAPPPPA--LAPPPPTMPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPPPR-----RAPP 101

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP +   PPP   +PPPP    +   PPP  +  +PPP +   PPP
Sbjct: 102 PPTQ--PPPPPRRAPPPPPSPPIRPPPPPTPRPQAPPPPHLPMPPP 145

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 43/108 (39%), Positives = 59/108 (54%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           + P PP +   PPP    PPPP++     +PPPP    +PPP    PPPP++     +PP
Sbjct: 26  QQPFPPPRRAPPPPTLPQPPPPRR-----APPPPA--LAPPPPTMPPPPPRR-----APP 73

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           PP +   PPP   +PPPP +      PPPP +  +PPP    PPPP++
Sbjct: 74  PPTQ--PPPPPRRAPPPPTQ------PPPPPRR-APPPPTQPPPPPRR 112

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 41/106 (38%), Positives = 53/106 (50%)
 Frame = +2

Query: 2   KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 181
           ++PPPP     PPP   +PPPP       + PPP    +PPP    PPPP++     + P
Sbjct: 34  RAPPPPTLPQPPPP-RRAPPPPALAPPPPTMPPPPPRRAPPPPTQPPPPPRRAPPPPTQP 92

Query: 182 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           PP    +PPP    PPPP+     ++PPPP     P P    PPPP
Sbjct: 93  PPPPRRAPPPPTQPPPPPR-----RAPPPP-----PSPPIRPPPPP 128

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 42/108 (38%), Positives = 54/108 (50%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP    +PPP    PPPP++     +PPPP +   PPP   +PPPP      + PPPP 
Sbjct: 64  PPPPPRRAPPPPTQPPPPPRR-----APPPPTQ--PPPPPRRAPPPPT-----QPPPPPR 111

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 334
           +   PPP     PPP      ++PPPP     PPP    PPP   H++
Sbjct: 112 RAPPPPPSPPIRPPPPPTPRPQAPPPPHLPMPPPPAPVPPPPSPPHHI 159

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 40/105 (38%), Positives = 52/105 (49%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           +PP     Y PP  Y   PP       + P PP +   PPP    PPPP++     +PPP
Sbjct: 6   TPPGLGFPYLPPNPYLPRPP-------QQPFPPPRRAPPPPTLPQPPPPRR-----APPP 53

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P    +PPP    PPPP++     +PPPP +   PPP   +PPPP
Sbjct: 54  PA--LAPPPPTMPPPPPRR-----APPPPTQ--PPPPPRRAPPPP 89

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 33/91 (36%), Positives = 43/91 (47%)
 Frame = +2

Query: 53  SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPP 232
           +P PP   + Y  P P    Y P P     PPP++     +PPPP     PPP   +PPP
Sbjct: 4   NPTPPGLGFPYLPPNP----YLPRPPQQPFPPPRR-----APPPPTLPQPPPP-RRAPPP 53

Query: 233 PKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
           P       + PPP    +PPP    PPPP++
Sbjct: 54  PALAPPPPTMPPPPPRRAPPPPTQPPPPPRR 84

[212][TOP]
>UniRef100_UPI00015B42DB PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B42DB
          Length = 454

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/124 (38%), Positives = 60/124 (48%), Gaps = 16/124 (12%)
 Frame = +2

Query: 8   PPPPVK--HYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYHSPPPPKKHYVYK 172
           P PPV+  +  P P Y +PPPP     Y +   PPPP  + +PPP    PPPP   Y   
Sbjct: 141 PSPPVRPAYAVPQPSYGAPPPPAHPAAYGAPPPPPPPASYAAPPP----PPPPPASYAAP 196

Query: 173 SPPPPVKHYSPPPV-------YHSPPPPKKHYVYKSPPPPVKH-YSPPPVYHSPP---PP 319
            P PP  + +PPP        Y+ PPPP     Y  P PP  +  SPPP  ++PP   PP
Sbjct: 197 PPAPPASYAAPPPARPSPPASYNQPPPPA---TYSQPSPPASYNQSPPPASYNPPSLTPP 253

Query: 320 KKHY 331
              Y
Sbjct: 254 PASY 257

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 47/121 (38%), Positives = 57/121 (47%), Gaps = 17/121 (14%)
 Frame = +2

Query: 8   PPPPVKHYS---PPPVYHSPPPPKKHY----VYKSPPPPVKHYSPPPVYHSPPPPKKHYV 166
           P PP   YS   PPP Y +PPP    +     Y SPP    +  P P Y +PPPP     
Sbjct: 108 PRPPSPLYSVAQPPPSYSAPPPAAYAHQPAAAYPSPPVRPAYAVPQPSYGAPPPPAHPAA 167

Query: 167 YKS---PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV-------YHSPPP 316
           Y +   PPPP  + +PPP    PPPP   Y    P PP  + +PPP        Y+ PPP
Sbjct: 168 YGAPPPPPPPASYAAPPP----PPPPPASYAAPPPAPPASYAAPPPARPSPPASYNQPPP 223

Query: 317 P 319
           P
Sbjct: 224 P 224

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/113 (39%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV----YHSPPP--PKKHYV 166
           +PPPP     PP  Y +PPPP        PPPP  + +PPP     Y +PPP  P     
Sbjct: 170 APPPP----PPPASYAAPPPP--------PPPPASYAAPPPAPPASYAAPPPARPSPPAS 217

Query: 167 YKSPPPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           Y  PPPP  +   SPP  Y+  PPP  +      PPP   Y+PP     PPPP
Sbjct: 218 YNQPPPPATYSQPSPPASYNQSPPPASYNPPSLTPPPAS-YNPPSRPPPPPPP 269

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 49/135 (36%), Positives = 57/135 (42%), Gaps = 31/135 (22%)
 Frame = +2

Query: 8   PPPPVKHYSPPPV----YHSPPP--PKKHYVYKSPPPPVKHY--SPPPVYHSPPPPKKHY 163
           PPPP  + +PPP     Y +PPP  P     Y  PPPP  +   SPP  Y+  PPP  + 
Sbjct: 187 PPPPASYAAPPPAPPASYAAPPPARPSPPASYNQPPPPATYSQPSPPASYNQSPPPASYN 246

Query: 164 VYKSPPPPVKHY--------SPPPVYHSP---------PPP--KKHYVYKSPPPPVKHYS 286
                PPP  +          PPPV   P         PPP  K  Y  K PPPP     
Sbjct: 247 PPSLTPPPASYNPPSRPPPPPPPPVTEKPLKITLSRPSPPPSTKSSYPNKLPPPPAIPNE 306

Query: 287 PP----PVYHSPPPP 319
           PP    P +  PPPP
Sbjct: 307 PPLSDKPCFKQPPPP 321

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 42/123 (34%), Positives = 52/123 (42%), Gaps = 14/123 (11%)
 Frame = +2

Query: 8   PPPPVKHY--SPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP-------KKH 160
           PPPP  +   SPP  Y+  PPP  +      PPP   Y+PP     PPPP       K  
Sbjct: 221 PPPPATYSQPSPPASYNQSPPPASYNPPSLTPPPAS-YNPPSRPPPPPPPPVTEKPLKIT 279

Query: 161 YVYKSPPPPVK-----HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
               SPPP  K        PPP   + PP      +K PPPP    S P  Y   P P+ 
Sbjct: 280 LSRPSPPPSTKSSYPNKLPPPPAIPNEPPLSDKPCFKQPPPPP---SKPKTYDPLPMPRY 336

Query: 326 HYV 334
           +++
Sbjct: 337 NHL 339

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 45/131 (34%), Positives = 52/131 (39%), Gaps = 20/131 (15%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSP---PPPKKHYVYKSPPPPVKHYSPPPVYHSP---------PP 148
           SPP       PP  Y+ P   PPP  +     PPPP     PPPV   P         PP
Sbjct: 231 SPPASYNQSPPPASYNPPSLTPPPASYNPPSRPPPP----PPPPVTEKPLKITLSRPSPP 286

Query: 149 P--KKHYVYKSPPPPVKHYSPP----PVY-HSPPPPKKHYVYKS-PPPPVKHYSPPPVYH 304
           P  K  Y  K PPPP     PP    P +   PPPP K   Y   P P   H + P    
Sbjct: 287 PSTKSSYPNKLPPPPAIPNEPPLSDKPCFKQPPPPPSKPKTYDPLPMPRYNHLTNPWAPI 346

Query: 305 SPPPPKKHYVY 337
           +PP   + + Y
Sbjct: 347 APPAQYRSFGY 357

[213][TOP]
>UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PES6_VITVI
          Length = 486

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/93 (52%), Positives = 52/93 (55%)
 Frame = +2

Query: 41  PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 220
           P   +PPPP        PP PV  YSPPPV+ SPPPP    V  SPPPP    SPPP   
Sbjct: 405 PSLPTPPPPSPPVFPSPPPTPV--YSPPPVF-SPPPP----VLSSPPPP----SPPPPSP 453

Query: 221 SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           SPPPP  +    SPPPP   YSPPP    PPPP
Sbjct: 454 SPPPPPVY----SPPPPPPVYSPPPPPPPPPPP 482

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 51/105 (48%), Positives = 54/105 (51%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
           +PPPP      PPV+ SPPP   +    SPPP      PPPV  SPPPP       SPPP
Sbjct: 409 TPPPP-----SPPVFPSPPPTPVY----SPPPVFS--PPPPVLSSPPPP-------SPPP 450

Query: 185 PVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 319
           P     PPPVY  PPPP    VY  PPPP     PPP    PPPP
Sbjct: 451 PSPSPPPPPVYSPPPPPP---VYSPPPPP-----PPP----PPPP 483

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 51/96 (53%), Positives = 53/96 (55%)
 Frame = +2

Query: 11  PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 190
           PPP   YSPPPV+ SPPPP    V  SPPPP    SPPP   SPPPP  +    SPPPP 
Sbjct: 421 PPPTPVYSPPPVF-SPPPP----VLSSPPPP----SPPPPSPSPPPPPVY----SPPPP- 466

Query: 191 KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPV 298
                PPVY SPPPP        PPPP     PPPV
Sbjct: 467 -----PPVY-SPPPP-------PPPPP----PPPPV 485

[214][TOP]
>UniRef100_C3Y8Z5 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae
            RepID=C3Y8Z5_BRAFL
          Length = 1332

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/106 (46%), Positives = 51/106 (48%)
 Frame = +2

Query: 8    PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 187
            PPPP K  +PPP       P K     SP PP     P P   SPP P K     SPPPP
Sbjct: 1226 PPPPRKQTTPPPPKIEKLKPPKPTPSPSPKPPPTPSPPSPPKPSPPAPPK----PSPPPP 1281

Query: 188  VKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKK 325
             K   PPP   SPP P K     SPPPP K   PPP   SPPPP +
Sbjct: 1282 PKPSPPPPPKPSPPAPPK----PSPPPPPKPSPPPPPKPSPPPPPR 1323

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 39/79 (49%), Positives = 40/79 (50%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SP PP     P P   SPP P K     SPPPP K   PPP   SPP P K     SPPP
Sbjct: 1253 SPKPPPTPSPPSPPKPSPPAPPK----PSPPPPPKPSPPPPPKPSPPAPPK----PSPPP 1304

Query: 185  PVKHYSPPPVYHSPPPPKK 241
            P K   PPP   SPPPP +
Sbjct: 1305 PPKPSPPPPPKPSPPPPPR 1323

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/78 (52%), Positives = 41/78 (52%)
 Frame = +2

Query: 5    SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 184
            SPP P K   P P   SPPPP K     SPPPP K   P P   SPPPP K     SPPP
Sbjct: 1261 SPPSPPKPSPPAPPKPSPPPPPK----PSPPPPPKPSPPAPPKPSPPPPPK----PSPPP 1312

Query: 185  PVKHYSPPPVYHSPPPPK 238
            P K  SPPP    PP PK
Sbjct: 1313 PPKP-SPPP----PPRPK 1325

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 35/84 (41%), Positives = 38/84 (45%), Gaps = 2/84 (2%)
 Frame = +2

Query: 80   VYKSPPPPVKHYSPPPVYH--SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 253
            + K PPPP      PP     +PPPPK   +    P P     PPP    P PPK     
Sbjct: 1219 IQKKPPPP------PPPRKQTTPPPPKIEKLKPPKPTPSPSPKPPPTPSPPSPPK----- 1267

Query: 254  KSPPPPVKHYSPPPVYHSPPPPKK 325
             SPP P K   PPP   SPPPP K
Sbjct: 1268 PSPPAPPKPSPPPPPKPSPPPPPK 1291

[215][TOP]
>UniRef100_B4H1U4 GL17948 n=1 Tax=Drosophila persimilis RepID=B4H1U4_DROPE
          Length = 415

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 57/127 (44%), Positives = 61/127 (48%), Gaps = 23/127 (18%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPPVYHSPPPPKKHYVYKSP 178
           PP PVK   Y+PPP    PP P K  VY  PPPPV    +PP V + PP P K  VY  P
Sbjct: 171 PPAPVKKVVYTPPP---PPPAPVKKVVYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPP 227

Query: 179 PP----PVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK----------HYSPPPV---- 298
           PP    PVK   Y+PPP    PP P K  VY  PPPP            HY  P V    
Sbjct: 228 PPPPPAPVKKVVYTPPP--PPPPAPVKKVVYTPPPPPPAPAGILKEDGYHYGQPSVKFET 285

Query: 299 YHSPPPP 319
           Y  P PP
Sbjct: 286 YEKPAPP 292

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 63/166 (37%), Positives = 71/166 (42%), Gaps = 56/166 (33%)
 Frame = +2

Query: 5   SPPPPVKHY--SPPPVYHSPPPPKKHYVYKSPPP----PVKH--YSPPP----------V 130
           +PPPP  +   +PP V + PP P K  VY  PPP    PVK   Y+PPP          V
Sbjct: 196 TPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPPPAPVKKVV 255

Query: 131 YHSPPPPKK----------HY--------VYKSPPPPV---KHYSP-PPVYHSPPPPKKH 244
           Y  PPPP            HY         Y+ P PP    K  +P PPVY  P PPK  
Sbjct: 256 YTPPPPPPAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVTPAPPVYVKPAPPKVE 315

Query: 245 Y---------VYKSPPPP-------VKHYSPPPVYHSPPPPKKHYV 334
           Y         VY  PPPP       V    PPPVY  P PPK  Y+
Sbjct: 316 YLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEYL 361

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 54/111 (48%), Positives = 60/111 (54%), Gaps = 9/111 (8%)
 Frame = +2

Query: 32  SPPPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK-HYS 202
           +P PVY  P PPK  Y+   PP PVK   Y+PPP    PP P K  VY  PPPPV    +
Sbjct: 154 APAPVYVKPAPPKVEYL---PPAPVKKVVYTPPP---PPPAPVKKVVYTPPPPPVYVKPA 207

Query: 203 PPPVYHSPPPPKKHYVYK-SPPP---PVKH--YSPPPVYHSPPPPKKHYVY 337
           PP V + PP P K  VY   PPP   PVK   Y+PPP    PP P K  VY
Sbjct: 208 PPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPP--PPPPAPVKKVVY 256

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 56/122 (45%), Positives = 63/122 (51%), Gaps = 13/122 (10%)
 Frame = +2

Query: 2   KSPPPPV--KHYSP-PPVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYV 166
           K  PP V  K  +P PPVY  P PPK  Y+   PP PVK   Y+PPP    PP P K  V
Sbjct: 288 KPAPPAVIKKVVTPAPPVYVKPAPPKVEYL---PPAPVKKVVYTPPP---PPPAPVKKVV 341

Query: 167 YKSPPPPVK-HYSPPPVYHSPPPPKKHYVYK-SPPPP------VKHYSPPPVYHSPPPPK 322
           Y  PPPPV    +PP V + PP P K  VY   PPPP      V +  PPPVY     PK
Sbjct: 342 YTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVQKVGYTPPPPVYVQHEGPK 401

Query: 323 KH 328
            +
Sbjct: 402 SY 403

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 59/145 (40%), Positives = 64/145 (44%), Gaps = 34/145 (23%)
 Frame = +2

Query: 8   PPPPVKH--YSPPPV------------YHSPPPPKKHYVYKSPPPPV---KHYSP-PPVY 133
           PP PVK   Y+PPP             YH   P  K   Y+ P PP    K  +P PPVY
Sbjct: 247 PPAPVKKVVYTPPPPPPAPAGILKEDGYHYGQPSVKFETYEKPAPPAVIKKVVTPAPPVY 306

Query: 134 HSPPPPKKHYVYKSPPPPVKH--YSPPP---------VYHSPPPPKKHYVYKSPPPPVKH 280
             P PPK  Y+   PP PVK   Y+PPP         VY  PPPP    VY  P PP   
Sbjct: 307 VKPAPPKVEYL---PPAPVKKVVYTPPPPPPAPVKKVVYTPPPPP----VYVKPAPPKVE 359

Query: 281 YSPPP-----VYHSPPPPKKHYVYK 340
           Y PP      VY  PPPP    V K
Sbjct: 360 YLPPAPVKKVVYTPPPPPPPAPVQK 384

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 53/134 (39%), Positives = 64/134 (47%), Gaps = 23/134 (17%)
 Frame = +2

Query: 5   SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK----HY----------------SPP 124
           +PP PV + +PP   ++P PP K Y    P   +K    HY                +P 
Sbjct: 98  TPPRPV-YTAPPAKVYTPAPPAKVYTPAVPAGALKEDGYHYGQPSVKFETYEKPVETAPA 156

Query: 125 PVYHSPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVK-HYSPPP 295
           PVY  P PPK  Y+   PP PVK   Y+PPP    PP P K  VY  PPPPV    +PP 
Sbjct: 157 PVYVKPAPPKVEYL---PPAPVKKVVYTPPP---PPPAPVKKVVYTPPPPPVYVKPAPPK 210

Query: 296 VYHSPPPPKKHYVY 337
           V + PP P K  VY
Sbjct: 211 VEYLPPAPVKKVVY 224

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 57/137 (41%), Positives = 65/137 (47%), Gaps = 28/137 (20%)
 Frame = +2

Query: 8   PPPPVK---HYSPPPVYH-SPPPPKKHYVYKSPPPPVKH--YSPPPVYHSPPPPKKHYVY 169
           PP PVK