AV543145 ( RZ195h07F )

[UP]


[1][TOP]
>UniRef100_Q84ME1 At5g19080/T16G12_120 n=1 Tax=Arabidopsis thaliana
           RepID=Q84ME1_ARATH
          Length = 378

 Score =  179 bits (453), Expect = 2e-43
 Identities = 83/83 (100%), Positives = 83/83 (100%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK
Sbjct: 296 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 355

Query: 390 CPICRQPIHELVKIKVESSDEQH 322
           CPICRQPIHELVKIKVESSDEQH
Sbjct: 356 CPICRQPIHELVKIKVESSDEQH 378

[2][TOP]
>UniRef100_Q8L7V9 AT5g19080/T16G12_120 n=1 Tax=Arabidopsis thaliana
           RepID=Q8L7V9_ARATH
          Length = 378

 Score =  175 bits (443), Expect = 3e-42
 Identities = 82/83 (98%), Positives = 82/83 (98%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHL LCSDCAEELRFQTNK
Sbjct: 296 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLSLCSDCAEELRFQTNK 355

Query: 390 CPICRQPIHELVKIKVESSDEQH 322
           CPICRQPIHELVKIKVESSDEQH
Sbjct: 356 CPICRQPIHELVKIKVESSDEQH 378

[3][TOP]
>UniRef100_Q9M8K4 Putative RING zinc finger protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9M8K4_ARATH
          Length = 546

 Score =  127 bits (320), Expect = 5e-28
 Identities = 62/84 (73%), Positives = 73/84 (86%), Gaps = 1/84 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTG-GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           ELYG   S TQG AASGL+++G G ECVIC+TE KDTAV+PCRHLC+CSDCA+ELR Q+N
Sbjct: 467 ELYG---STTQG-AASGLDESGSGTECVICMTEAKDTAVLPCRHLCMCSDCAKELRLQSN 522

Query: 393 KCPICRQPIHELVKIKVESSDEQH 322
           KCPICRQPI EL++IK+ SSDEQH
Sbjct: 523 KCPICRQPIEELLEIKMNSSDEQH 546

[4][TOP]
>UniRef100_Q8LA32 Putative RING zinc finger protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8LA32_ARATH
          Length = 359

 Score =  127 bits (320), Expect = 5e-28
 Identities = 62/84 (73%), Positives = 73/84 (86%), Gaps = 1/84 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTG-GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           ELYG   S TQG AASGL+++G G ECVIC+TE KDTAV+PCRHLC+CSDCA+ELR Q+N
Sbjct: 280 ELYG---STTQG-AASGLDESGSGTECVICMTEAKDTAVLPCRHLCMCSDCAKELRLQSN 335

Query: 393 KCPICRQPIHELVKIKVESSDEQH 322
           KCPICRQPI EL++IK+ SSDEQH
Sbjct: 336 KCPICRQPIEELLEIKMNSSDEQH 359

[5][TOP]
>UniRef100_C5YXL4 Putative uncharacterized protein Sb09g019560 n=1 Tax=Sorghum
           bicolor RepID=C5YXL4_SORBI
          Length = 340

 Score =  119 bits (297), Expect = 2e-25
 Identities = 53/80 (66%), Positives = 67/80 (83%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E++G+ NS     A +  +DTG KECVICLTEP+DTAVMPCRHLCLCS+CA+ LRFQ+NK
Sbjct: 261 EIFGMVNSTESDVADADADDTG-KECVICLTEPRDTAVMPCRHLCLCSECAKTLRFQSNK 319

Query: 390 CPICRQPIHELVKIKVESSD 331
           CPICRQP+ +L++IKV SS+
Sbjct: 320 CPICRQPVEKLMEIKVRSSE 339

[6][TOP]
>UniRef100_B9HY68 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HY68_POPTR
          Length = 375

 Score =  117 bits (294), Expect = 5e-25
 Identities = 53/82 (64%), Positives = 67/82 (81%), Gaps = 1/82 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTG-GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI +S     AA G +D+  GKECVIC+TEPKDTAV+PCRH+CLCS+CA+ELR Q+N
Sbjct: 299 EIYGIGSS-----AAEGFDDSDPGKECVICMTEPKDTAVLPCRHMCLCSECAKELRLQSN 353

Query: 393 KCPICRQPIHELVKIKVESSDE 328
           KCPICRQPI +L+ IK+ S D+
Sbjct: 354 KCPICRQPIEQLIGIKINSGDQ 375

[7][TOP]
>UniRef100_B9RTT7 Mahogunin, putative n=1 Tax=Ricinus communis RepID=B9RTT7_RICCO
          Length = 378

 Score =  115 bits (289), Expect = 2e-24
 Identities = 53/82 (64%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTG-GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           ELYGI +S     AA    D   GKECVIC+TEPKDTAV+PCRH+C+CSDCA+ELR Q+N
Sbjct: 302 ELYGIGSS-----AAEDFNDCDPGKECVICMTEPKDTAVLPCRHMCMCSDCAKELRLQSN 356

Query: 393 KCPICRQPIHELVKIKVESSDE 328
           KCPICRQPI EL++IK+ + D+
Sbjct: 357 KCPICRQPIDELIEIKINNGDQ 378

[8][TOP]
>UniRef100_UPI000198319F PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI000198319F
          Length = 563

 Score =  114 bits (285), Expect = 5e-24
 Identities = 48/78 (61%), Positives = 66/78 (84%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI +S ++G      ++  GKECVIC+TEPKDTAV+PCRH+C+CS+CA+ELR Q+NK
Sbjct: 488 EIYGIASSASEGFN----DNDSGKECVICMTEPKDTAVLPCRHMCMCSECAKELRLQSNK 543

Query: 390 CPICRQPIHELVKIKVES 337
           CPICRQPI EL++IK+++
Sbjct: 544 CPICRQPIEELIEIKIDN 561

[9][TOP]
>UniRef100_A7NWF8 Chromosome chr5 scaffold_2, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7NWF8_VITVI
          Length = 392

 Score =  114 bits (285), Expect = 5e-24
 Identities = 48/78 (61%), Positives = 66/78 (84%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI +S ++G      ++  GKECVIC+TEPKDTAV+PCRH+C+CS+CA+ELR Q+NK
Sbjct: 317 EIYGIASSASEGFN----DNDSGKECVICMTEPKDTAVLPCRHMCMCSECAKELRLQSNK 372

Query: 390 CPICRQPIHELVKIKVES 337
           CPICRQPI EL++IK+++
Sbjct: 373 CPICRQPIEELIEIKIDN 390

[10][TOP]
>UniRef100_Q75HV4 Putative uncharacterized protein OSJNBb0092G21.11 n=1 Tax=Oryza
           sativa Japonica Group RepID=Q75HV4_ORYSJ
          Length = 92

 Score =  112 bits (279), Expect = 3e-23
 Identities = 50/80 (62%), Positives = 63/80 (78%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS T+       +   GKECVICLTEP+DTAV PCRHLC+CS+CA+ LRFQT+K
Sbjct: 13  EIYGIVNS-TEADVPDADDSDMGKECVICLTEPRDTAVFPCRHLCMCSECAKTLRFQTDK 71

Query: 390 CPICRQPIHELVKIKVESSD 331
           CPICRQP+ +L++IKV S +
Sbjct: 72  CPICRQPVEKLMEIKVRSPE 91

[11][TOP]
>UniRef100_B9FPG8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FPG8_ORYSJ
          Length = 309

 Score =  112 bits (279), Expect = 3e-23
 Identities = 50/80 (62%), Positives = 63/80 (78%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS T+       +   GKECVICLTEP+DTAV PCRHLC+CS+CA+ LRFQT+K
Sbjct: 230 EIYGIVNS-TEADVPDADDSDMGKECVICLTEPRDTAVFPCRHLCMCSECAKTLRFQTDK 288

Query: 390 CPICRQPIHELVKIKVESSD 331
           CPICRQP+ +L++IKV S +
Sbjct: 289 CPICRQPVEKLMEIKVRSPE 308

[12][TOP]
>UniRef100_A2Y4E4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2Y4E4_ORYSI
          Length = 359

 Score =  110 bits (274), Expect = 1e-22
 Identities = 49/76 (64%), Positives = 61/76 (80%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS T+       +   GKECVICLTEP+DTAV PCRHLC+CS+CA+ LRFQT+K
Sbjct: 280 EIYGIVNS-TEADVPDADDSDMGKECVICLTEPRDTAVFPCRHLCMCSECAKTLRFQTDK 338

Query: 390 CPICRQPIHELVKIKV 343
           CPICRQP+ +L++IKV
Sbjct: 339 CPICRQPVEKLMEIKV 354

[13][TOP]
>UniRef100_Q8RUJ8 Os10g0204100 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q8RUJ8_ORYSJ
          Length = 425

 Score =  108 bits (271), Expect = 2e-22
 Identities = 46/82 (56%), Positives = 63/82 (76%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+   T  +      GKECVICL+EP+DT V+PCRH+C+CS+CA+ LR+QTN+
Sbjct: 322 EIYGIGNSVEGDTEGND----PGKECVICLSEPRDTTVLPCRHMCMCSECAKVLRYQTNR 377

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICRQP+  L++IKV +  E+
Sbjct: 378 CPICRQPVERLLEIKVNNKGEE 399

[14][TOP]
>UniRef100_B8BG37 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8BG37_ORYSI
          Length = 425

 Score =  108 bits (271), Expect = 2e-22
 Identities = 46/82 (56%), Positives = 63/82 (76%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+   T  +      GKECVICL+EP+DT V+PCRH+C+CS+CA+ LR+QTN+
Sbjct: 322 EIYGIGNSVEGDTEGND----PGKECVICLSEPRDTTVLPCRHMCMCSECAKVLRYQTNR 377

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICRQP+  L++IKV +  E+
Sbjct: 378 CPICRQPVERLLEIKVNNKGEE 399

[15][TOP]
>UniRef100_Q9S752 Putative uncharacterized protein F11F8.36 n=1 Tax=Arabidopsis
           thaliana RepID=Q9S752_ARATH
          Length = 388

 Score =  107 bits (267), Expect = 6e-22
 Identities = 44/80 (55%), Positives = 62/80 (77%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI N++     ++   +  GKECVICL+EP+DT V+PCRH+C+CS CA+ LRFQTN+
Sbjct: 294 EIYGIGNTVEGDDDSADDANDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNR 353

Query: 390 CPICRQPIHELVKIKVESSD 331
           CPICRQP+  L++IKV  ++
Sbjct: 354 CPICRQPVERLLEIKVHGNN 373

[16][TOP]
>UniRef100_B9MZT1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZT1_POPTR
          Length = 280

 Score =  107 bits (266), Expect = 8e-22
 Identities = 48/78 (61%), Positives = 63/78 (80%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E++GI NS   G    G  D+G KEC+IC+TEPKDTAV+PCRH+CLCS CA+ELR ++++
Sbjct: 202 EIFGIANS--DGAGVDGETDSG-KECIICMTEPKDTAVLPCRHMCLCSGCAKELRSRSDR 258

Query: 390 CPICRQPIHELVKIKVES 337
           CPICRQPI EL++IKV +
Sbjct: 259 CPICRQPIQELMEIKVNN 276

[17][TOP]
>UniRef100_B9HMD4 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9HMD4_POPTR
          Length = 312

 Score =  107 bits (266), Expect = 8e-22
 Identities = 48/79 (60%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTG-GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI +      AA G +D+  GKECVIC+ EPKDTAV+PCRH+C+C  CA+ELR Q+N
Sbjct: 239 EIYGIGS-----LAAEGFDDSDPGKECVICMIEPKDTAVLPCRHMCMCGKCAKELRLQSN 293

Query: 393 KCPICRQPIHELVKIKVES 337
           KCPICRQPI +L+ IK+ S
Sbjct: 294 KCPICRQPIEQLIGIKINS 312

[18][TOP]
>UniRef100_A5C7L8 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5C7L8_VITVI
          Length = 242

 Score =  106 bits (265), Expect = 1e-21
 Identities = 51/82 (62%), Positives = 63/82 (76%), Gaps = 2/82 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           ELYGI+NS  +G    G  DTG KECVIC+TEP DT V+PCRH+CLCS+CA++LR Q+NK
Sbjct: 161 ELYGIENSDERGI---GNNDTG-KECVICMTEPNDTVVLPCRHVCLCSECAKQLRLQSNK 216

Query: 390 CPICRQPIHELVKI--KVESSD 331
           CP+CR PI EL+ I  KV+  D
Sbjct: 217 CPVCRHPIQELIVIVHKVKKYD 238

[19][TOP]
>UniRef100_A7PSD8 Chromosome chr14 scaffold_27, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PSD8_VITVI
          Length = 249

 Score =  106 bits (264), Expect = 1e-21
 Identities = 48/74 (64%), Positives = 59/74 (79%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           ELYGI+NS  +G    G  DTG KECVIC+TEP DT V+PCRH+CLCS+CA++LR Q+NK
Sbjct: 174 ELYGIENSDERGI---GNNDTG-KECVICMTEPNDTVVLPCRHVCLCSECAKQLRLQSNK 229

Query: 390 CPICRQPIHELVKI 349
           CP+CR PI EL+ I
Sbjct: 230 CPVCRHPIQELIVI 243

[20][TOP]
>UniRef100_UPI0000E11FDF Os03g0254900 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E11FDF
          Length = 481

 Score =  105 bits (263), Expect = 2e-21
 Identities = 46/82 (56%), Positives = 65/82 (79%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+ +G A +   +  GKECVICL+EP+DT V+PCRH+C+CS+CA+ LR+QT +
Sbjct: 369 EIYGIGNSV-EGDADA---NDPGKECVICLSEPRDTTVLPCRHMCMCSECAKVLRYQTTR 424

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICRQP+  L++IKV +  E+
Sbjct: 425 CPICRQPVERLLEIKVNNKAEE 446

[21][TOP]
>UniRef100_Q10NY0 cDNA clone:J023020P04, full insert sequence n=1 Tax=Oryza sativa
           Japonica Group RepID=Q10NY0_ORYSJ
          Length = 430

 Score =  105 bits (263), Expect = 2e-21
 Identities = 46/82 (56%), Positives = 65/82 (79%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+ +G A +   +  GKECVICL+EP+DT V+PCRH+C+CS+CA+ LR+QT +
Sbjct: 318 EIYGIGNSV-EGDADA---NDPGKECVICLSEPRDTTVLPCRHMCMCSECAKVLRYQTTR 373

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICRQP+  L++IKV +  E+
Sbjct: 374 CPICRQPVERLLEIKVNNKAEE 395

[22][TOP]
>UniRef100_Q0DTD5 Os03g0254900 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q0DTD5_ORYSJ
          Length = 290

 Score =  105 bits (263), Expect = 2e-21
 Identities = 46/82 (56%), Positives = 65/82 (79%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+ +G A +   +  GKECVICL+EP+DT V+PCRH+C+CS+CA+ LR+QT +
Sbjct: 178 EIYGIGNSV-EGDADA---NDPGKECVICLSEPRDTTVLPCRHMCMCSECAKVLRYQTTR 233

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICRQP+  L++IKV +  E+
Sbjct: 234 CPICRQPVERLLEIKVNNKAEE 255

[23][TOP]
>UniRef100_C5WQU9 Putative uncharacterized protein Sb01g040770 n=1 Tax=Sorghum
           bicolor RepID=C5WQU9_SORBI
          Length = 402

 Score =  105 bits (263), Expect = 2e-21
 Identities = 46/82 (56%), Positives = 65/82 (79%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+ +G A +   +  GKECVICL+EP+DT V+PCRH+C+CS+CA+ LR+QT +
Sbjct: 305 EIYGIGNSM-EGDADA---NDPGKECVICLSEPRDTTVLPCRHMCMCSECAKVLRYQTTR 360

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICRQP+  L++IKV +  E+
Sbjct: 361 CPICRQPVERLLEIKVNNKSEE 382

[24][TOP]
>UniRef100_A9SWZ9 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SWZ9_PHYPA
          Length = 414

 Score =  105 bits (263), Expect = 2e-21
 Identities = 44/83 (53%), Positives = 62/83 (74%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+NS   G   +      GKECV+C++EP+DT V+PCRH+C+CS+CA+ LRFQTN+
Sbjct: 290 EIYGIENS---GGGGNFDGTDSGKECVVCMSEPRDTTVLPCRHMCMCSECAKVLRFQTNR 346

Query: 390 CPICRQPIHELVKIKVESSDEQH 322
           CPICR P+  L++IKV  +  +H
Sbjct: 347 CPICRTPVERLLEIKVPKTGAEH 369

[25][TOP]
>UniRef100_A2XEN7 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2XEN7_ORYSI
          Length = 240

 Score =  105 bits (263), Expect = 2e-21
 Identities = 46/82 (56%), Positives = 65/82 (79%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+ +G A +   +  GKECVICL+EP+DT V+PCRH+C+CS+CA+ LR+QT +
Sbjct: 128 EIYGIGNSV-EGDADA---NDPGKECVICLSEPRDTTVLPCRHMCMCSECAKVLRYQTTR 183

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICRQP+  L++IKV +  E+
Sbjct: 184 CPICRQPVERLLEIKVNNKAEE 205

[26][TOP]
>UniRef100_B9SWC1 Mahogunin, putative n=1 Tax=Ricinus communis RepID=B9SWC1_RICCO
          Length = 246

 Score =  105 bits (262), Expect = 2e-21
 Identities = 46/81 (56%), Positives = 62/81 (76%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+   + +S      GKECVICL+EP+DT V+PCRH+C+CS CA+ LRFQT++
Sbjct: 169 EIYGIGNSVEVESNSSD----SGKECVICLSEPRDTTVLPCRHMCMCSTCAKVLRFQTDR 224

Query: 390 CPICRQPIHELVKIKVESSDE 328
           CPICRQP+  L++IKV+   E
Sbjct: 225 CPICRQPVERLLEIKVKDGVE 245

[27][TOP]
>UniRef100_B9S0M4 Mahogunin, putative n=1 Tax=Ricinus communis RepID=B9S0M4_RICCO
          Length = 306

 Score =  105 bits (262), Expect = 2e-21
 Identities = 45/82 (54%), Positives = 62/82 (75%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+     A+      GKECVICL+EP+DT V+PCRH+C+CS CA+ LR+QTN+
Sbjct: 229 EIYGIGNSVEGEVDAND----PGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRYQTNR 284

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICRQP+  L++IKV +  ++
Sbjct: 285 CPICRQPVERLLEIKVNNGPDE 306

[28][TOP]
>UniRef100_Q94E82 Os01g0374900 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q94E82_ORYSJ
          Length = 313

 Score =  105 bits (261), Expect = 3e-21
 Identities = 44/78 (56%), Positives = 61/78 (78%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI N+  +       ED  GKECV+CL+EP+DTAV+PCRH+CLC +CA+ L++QTNK
Sbjct: 225 EIYGIGNTADKNAH----EDDSGKECVVCLSEPRDTAVLPCRHMCLCRECAQVLKYQTNK 280

Query: 390 CPICRQPIHELVKIKVES 337
           CPICRQP+  L +I+V++
Sbjct: 281 CPICRQPVEGLREIEVDN 298

[29][TOP]
>UniRef100_C0HFT1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0HFT1_MAIZE
          Length = 225

 Score =  105 bits (261), Expect = 3e-21
 Identities = 46/81 (56%), Positives = 64/81 (79%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+ +G A +   +  GKECVICL+EP+DT V+PCRH+C+CS+CA+ LR+QT +
Sbjct: 128 EIYGIGNSM-EGDADA---NDPGKECVICLSEPRDTTVLPCRHMCMCSECAKVLRYQTTR 183

Query: 390 CPICRQPIHELVKIKVESSDE 328
           CPICRQP+  L++IKV +  E
Sbjct: 184 CPICRQPVERLLEIKVNNKSE 204

[30][TOP]
>UniRef100_B9IFM5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IFM5_POPTR
          Length = 283

 Score =  105 bits (261), Expect = 3e-21
 Identities = 45/82 (54%), Positives = 62/82 (75%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+     A+      GKECVICL+EP+DT V+PCRH+C+CS CA+ LRFQTN+
Sbjct: 206 EIYGIGNSVEGDVDAND----PGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNR 261

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICR P+  L++IKV ++ ++
Sbjct: 262 CPICRHPVDRLLEIKVNNAPDE 283

[31][TOP]
>UniRef100_B8A897 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A897_ORYSI
          Length = 314

 Score =  105 bits (261), Expect = 3e-21
 Identities = 44/78 (56%), Positives = 61/78 (78%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI N+  +       ED  GKECV+CL+EP+DTAV+PCRH+CLC +CA+ L++QTNK
Sbjct: 226 EIYGIGNTADKNAH----EDDSGKECVVCLSEPRDTAVLPCRHMCLCRECAQVLKYQTNK 281

Query: 390 CPICRQPIHELVKIKVES 337
           CPICRQP+  L +I+V++
Sbjct: 282 CPICRQPVEGLREIEVDN 299

[32][TOP]
>UniRef100_B3U2B1 Zinc finger RING-type protein n=1 Tax=Cucumis sativus
           RepID=B3U2B1_CUCSA
          Length = 300

 Score =  105 bits (261), Expect = 3e-21
 Identities = 45/82 (54%), Positives = 61/82 (74%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+      +      GKECVICL+EP+DT V+PCRH+C+CS CA+ LRFQTN+
Sbjct: 222 EIYGIGNSVEGDVDGND----PGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNR 277

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICRQP+  L++I+V +  E+
Sbjct: 278 CPICRQPVDRLLEIRVSNGPEE 299

[33][TOP]
>UniRef100_A2ZTA9 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A2ZTA9_ORYSJ
          Length = 313

 Score =  105 bits (261), Expect = 3e-21
 Identities = 44/78 (56%), Positives = 61/78 (78%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI N+  +       ED  GKECV+CL+EP+DTAV+PCRH+CLC +CA+ L++QTNK
Sbjct: 225 EIYGIGNTADKNAH----EDDSGKECVVCLSEPRDTAVLPCRHMCLCRECAQVLKYQTNK 280

Query: 390 CPICRQPIHELVKIKVES 337
           CPICRQP+  L +I+V++
Sbjct: 281 CPICRQPVEGLREIEVDN 298

[34][TOP]
>UniRef100_A2WQ54 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2WQ54_ORYSI
          Length = 143

 Score =  105 bits (261), Expect = 3e-21
 Identities = 44/78 (56%), Positives = 61/78 (78%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI N+  +       ED  GKECV+CL+EP+DTAV+PCRH+CLC +CA+ L++QTNK
Sbjct: 55  EIYGIGNTADKNAH----EDDSGKECVVCLSEPRDTAVLPCRHMCLCRECAQVLKYQTNK 110

Query: 390 CPICRQPIHELVKIKVES 337
           CPICRQP+  L +I+V++
Sbjct: 111 CPICRQPVEGLREIEVDN 128

[35][TOP]
>UniRef100_B9MTB3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MTB3_POPTR
          Length = 284

 Score =  104 bits (260), Expect = 4e-21
 Identities = 45/82 (54%), Positives = 62/82 (75%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI +S+     A+      GKECVICL+EP+DT V+PCRH+C+CS CA+ LRFQTN+
Sbjct: 207 EIYGIGDSVDGDVDAND----PGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNR 262

Query: 390 CPICRQPIHELVKIKVESSDEQ 325
           CPICRQP+  L++IKV +  ++
Sbjct: 263 CPICRQPVDRLLEIKVNNGPDE 284

[36][TOP]
>UniRef100_Q2HV40 Zinc finger, RING-type n=1 Tax=Medicago truncatula
           RepID=Q2HV40_MEDTR
          Length = 352

 Score =  103 bits (258), Expect = 7e-21
 Identities = 45/80 (56%), Positives = 60/80 (75%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+         ++  GKECVICL+EP+DT V PCRH+C+CS CA+ LRFQTN+
Sbjct: 277 EIYGIGNSVESDVD----DNEQGKECVICLSEPRDTIVHPCRHMCMCSGCAKVLRFQTNR 332

Query: 390 CPICRQPIHELVKIKVESSD 331
           CPICRQP+  L++IKV + +
Sbjct: 333 CPICRQPVERLLEIKVGTEE 352

[37][TOP]
>UniRef100_A7NZI3 Chromosome chr6 scaffold_3, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7NZI3_VITVI
          Length = 349

 Score =  103 bits (256), Expect = 1e-20
 Identities = 44/81 (54%), Positives = 61/81 (75%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E++GI NS+     A G +   GKECVICL+EP+DT V+PCRH+C+C  CA+ LRFQ N+
Sbjct: 272 EIFGIGNSVDDN--ADGTDS--GKECVICLSEPRDTTVLPCRHMCMCGGCAKVLRFQMNR 327

Query: 390 CPICRQPIHELVKIKVESSDE 328
           CPICRQP+ +L++IKV +  +
Sbjct: 328 CPICRQPVEQLLEIKVNNKSD 348

[38][TOP]
>UniRef100_A9SCV6 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp.
           patens RepID=A9SCV6_PHYPA
          Length = 257

 Score =  102 bits (255), Expect = 2e-20
 Identities = 42/76 (55%), Positives = 59/76 (77%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGIDNS   G   +      GK CV+C++EP+DT V+PCRH+C+CS+CA+ LRFQTN+
Sbjct: 185 EIYGIDNS---GIGGNFDGTVAGKACVVCMSEPRDTTVLPCRHMCMCSECAKVLRFQTNR 241

Query: 390 CPICRQPIHELVKIKV 343
           CP+CR P+ +L++IKV
Sbjct: 242 CPVCRTPVEKLLEIKV 257

[39][TOP]
>UniRef100_Q9LFH6 Putative uncharacterized protein F4P12_110 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LFH6_ARATH
          Length = 299

 Score =  102 bits (253), Expect = 3e-20
 Identities = 44/80 (55%), Positives = 60/80 (75%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI N++      +   +  GKECVICL+EP+DT V+PCRH+C+CS CA+ LRFQTN 
Sbjct: 221 EIYGIGNTVDDNGEDA---NERGKECVICLSEPRDTTVLPCRHMCMCSGCAKLLRFQTNL 277

Query: 390 CPICRQPIHELVKIKVESSD 331
           CPICRQP+  L++I V ++D
Sbjct: 278 CPICRQPVDRLLEITVNNND 297

[40][TOP]
>UniRef100_C1N7T8 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545
           RepID=C1N7T8_9CHLO
          Length = 285

 Score =  101 bits (252), Expect = 4e-20
 Identities = 42/82 (51%), Positives = 57/82 (69%), Gaps = 2/82 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTG--GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E++GI+N  T      G    G  GKECV+CL+EP+DT V+PCRH+C+C  CA ELR Q+
Sbjct: 198 EIFGIENCATGNPMGGGGGGGGDEGKECVVCLSEPRDTTVLPCRHMCMCGGCARELRHQS 257

Query: 396 NKCPICRQPIHELVKIKVESSD 331
           NKCP+CR P+  L++IK+   D
Sbjct: 258 NKCPVCRSPVESLLEIKIADRD 279

[41][TOP]
>UniRef100_B9I7Y3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I7Y3_POPTR
          Length = 279

 Score =  100 bits (248), Expect = 1e-19
 Identities = 46/76 (60%), Positives = 61/76 (80%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS + G    G++   G ECVIC++EP+DTAV+PCRH+CLCS CA+ELR +++ 
Sbjct: 201 EIYGIANSDSAGF--DGIDS--GTECVICMSEPQDTAVLPCRHMCLCSGCAKELRSRSDT 256

Query: 390 CPICRQPIHELVKIKV 343
           CPICRQPI EL++IKV
Sbjct: 257 CPICRQPIQELMEIKV 272

[42][TOP]
>UniRef100_A9NRJ5 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NRJ5_PICSI
          Length = 342

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 41/81 (50%), Positives = 60/81 (74%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+         ++  GKECVIC++EP+DT ++PCRH+CLCS CA+ LRFQT +
Sbjct: 266 EIYGIGNSV----GTDFYDNDPGKECVICMSEPRDTMILPCRHMCLCSGCAKVLRFQTKR 321

Query: 390 CPICRQPIHELVKIKVESSDE 328
           CPICRQ +  L+++KV  +++
Sbjct: 322 CPICRQSVERLLEMKVNRNED 342

[43][TOP]
>UniRef100_A7PT26 Chromosome chr8 scaffold_29, whole genome shotgun sequence n=3
           Tax=Vitis vinifera RepID=A7PT26_VITVI
          Length = 272

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 45/81 (55%), Positives = 61/81 (75%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI NS+  G   S   +  GKECVICL+EP+DT V+PCRH+C+CS CA+ LRFQT++
Sbjct: 195 EIYGIGNSV-DGDFDS---NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTDR 250

Query: 390 CPICRQPIHELVKIKVESSDE 328
           CPICRQ +  L++IKV +  +
Sbjct: 251 CPICRQLVERLLEIKVSNGSD 271

[44][TOP]
>UniRef100_A9NUZ8 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NUZ8_PICSI
          Length = 380

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 42/81 (51%), Positives = 61/81 (75%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI +S      A+      GKECVIC++EP+DT V+PCRH+C+CS+CA+ LR QTN+
Sbjct: 304 EIYGIGSSAGTDFDAND----PGKECVICMSEPRDTTVLPCRHMCMCSECAKLLRLQTNR 359

Query: 390 CPICRQPIHELVKIKVESSDE 328
           CPICR+P+  L++IK+  ++E
Sbjct: 360 CPICRRPVERLMEIKLNKTEE 380

[45][TOP]
>UniRef100_Q9LYW5 Putative uncharacterized protein F15A17_230 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LYW5_ARATH
          Length = 337

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 41/74 (55%), Positives = 58/74 (78%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N++       G ++  GKECV+CL+EP+DT V+PCRH+C+CS CA+ LRFQTN 
Sbjct: 268 EIYGIENTV------DGSDE--GKECVVCLSEPRDTTVLPCRHMCMCSGCAKALRFQTNL 319

Query: 390 CPICRQPIHELVKI 349
           CP+CRQP+  L++I
Sbjct: 320 CPVCRQPVEMLLEI 333

[46][TOP]
>UniRef100_Q8L8P7 Putative RING zinc finger protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8L8P7_ARATH
          Length = 337

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 41/74 (55%), Positives = 58/74 (78%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N++       G ++  GKECV+CL+EP+DT V+PCRH+C+CS CA+ LRFQTN 
Sbjct: 268 EIYGIENTV------DGSDE--GKECVVCLSEPRDTTVLPCRHMCMCSGCAKALRFQTNL 319

Query: 390 CPICRQPIHELVKI 349
           CP+CRQP+  L++I
Sbjct: 320 CPVCRQPVEMLLEI 333

[47][TOP]
>UniRef100_Q8GZ27 Putative uncharacterized protein At5g03200/F15A17_230 n=1
           Tax=Arabidopsis thaliana RepID=Q8GZ27_ARATH
          Length = 337

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 41/74 (55%), Positives = 58/74 (78%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N++       G ++  GKECV+CL+EP+DT V+PCRH+C+CS CA+ LRFQTN 
Sbjct: 268 EIYGIENTV------DGSDE--GKECVVCLSEPRDTTVLPCRHMCMCSGCAKALRFQTNL 319

Query: 390 CPICRQPIHELVKI 349
           CP+CRQP+  L++I
Sbjct: 320 CPVCRQPVEMLLEI 333

[48][TOP]
>UniRef100_C1FHM9 Putative uncharacterized protein n=1 Tax=Micromonas sp. RCC299
           RepID=C1FHM9_9CHLO
          Length = 342

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 42/81 (51%), Positives = 56/81 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E++GI+N    G   +   D G KECV+CL+EP+DT V+PCRH+C+CS CA  LR Q NK
Sbjct: 258 EIFGIENCGASGMPGAEAGDDG-KECVVCLSEPRDTTVLPCRHMCMCSGCARMLRHQNNK 316

Query: 390 CPICRQPIHELVKIKVESSDE 328
           CPICR  +  L++IKV +  E
Sbjct: 317 CPICRTVVESLLEIKVATKAE 337

[49][TOP]
>UniRef100_Q9VY98 CG9941 n=1 Tax=Drosophila melanogaster RepID=Q9VY98_DROME
          Length = 789

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     T+     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 294 EIYGIENKAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 353

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 354 CPICRAPFRALLQIR 368

[50][TOP]
>UniRef100_Q86NN7 LD34250p n=1 Tax=Drosophila melanogaster RepID=Q86NN7_DROME
          Length = 771

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     T+     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 276 EIYGIENKAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 335

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 336 CPICRAPFRALLQIR 350

[51][TOP]
>UniRef100_B4Q2F1 GE16144 n=1 Tax=Drosophila yakuba RepID=B4Q2F1_DROYA
          Length = 791

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     T+     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 295 EIYGIENKAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 354

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 355 CPICRAPFRALLQIR 369

[52][TOP]
>UniRef100_B4NUE5 GD24519 n=1 Tax=Drosophila simulans RepID=B4NUE5_DROSI
          Length = 564

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     T+     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 69  EIYGIENKAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 128

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 129 CPICRAPFRALLQIR 143

[53][TOP]
>UniRef100_B4M2U2 GJ19082 n=1 Tax=Drosophila virilis RepID=B4M2U2_DROVI
          Length = 782

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     T+     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 293 EIYGIENKAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 352

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 353 CPICRAPFRALLQIR 367

[54][TOP]
>UniRef100_B4L7J2 Moj152 n=1 Tax=Drosophila mojavensis RepID=B4L7J2_DROMO
          Length = 778

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     T+     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 288 EIYGIENKAVNKTSMDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 347

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 348 CPICRAPFRALLQIR 362

[55][TOP]
>UniRef100_B3NW00 GG19492 n=1 Tax=Drosophila erecta RepID=B3NW00_DROER
          Length = 790

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     T+     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 294 EIYGIENKAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 353

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 354 CPICRAPFRALLQIR 368

[56][TOP]
>UniRef100_B4JL40 GH11938 n=1 Tax=Drosophila grimshawi RepID=B4JL40_DROGR
          Length = 802

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     T+     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 291 EIYGIENKAVNKTSLDEDIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 350

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 351 CPICRAPFRALLQIR 365

[57][TOP]
>UniRef100_Q7PFA9 AGAP005287-PA n=1 Tax=Anopheles gambiae RepID=Q7PFA9_ANOGA
          Length = 859

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 36/75 (48%), Positives = 51/75 (68%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N +   T      +  G ECVIC+ + +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 310 EIYGIENKLANKTVTDEETEDNGSECVICMCDTRDTLILPCRHLCLCNSCADSLRYQANN 369

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 370 CPICRAPFRALLQIR 384

[58][TOP]
>UniRef100_UPI00015B4C3F PREDICTED: similar to mahogunin n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B4C3F
          Length = 554

 Score = 93.6 bits (231), Expect = 1e-17
 Identities = 41/78 (52%), Positives = 55/78 (70%), Gaps = 3/78 (3%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGL-EDT--GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQ 400
           E+YGI+N  T+ +   G  EDT   G ECVIC+ + +DT ++PCRHLCLC+ CA+ LR+Q
Sbjct: 259 EIYGIENKNTENSKQQGSDEDTEDNGAECVICMCDVRDTLILPCRHLCLCNGCADSLRYQ 318

Query: 399 TNKCPICRQPIHELVKIK 346
            N CPICR P   L++IK
Sbjct: 319 ANNCPICRAPFRALLQIK 336

[59][TOP]
>UniRef100_A8IE95 Zinc finger protein, RING-type n=1 Tax=Chlamydomonas reinhardtii
           RepID=A8IE95_CHLRE
          Length = 368

 Score = 93.6 bits (231), Expect = 1e-17
 Identities = 38/78 (48%), Positives = 53/78 (67%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YG++ +   G +  G ED  G ECVIC++ P+DT  +PCRH+C+C  CA  L+ QTNK
Sbjct: 279 EIYGMEQN-KAGGSGEGYEDVDGNECVICMSAPRDTTALPCRHMCMCHGCASALKTQTNK 337

Query: 390 CPICRQPIHELVKIKVES 337
           CPICR  I  L+ IK+ +
Sbjct: 338 CPICRNEIESLLHIKINN 355

[60][TOP]
>UniRef100_Q17FY8 Mahogunin n=1 Tax=Aedes aegypti RepID=Q17FY8_AEDAE
          Length = 415

 Score = 93.6 bits (231), Expect = 1e-17
 Identities = 36/75 (48%), Positives = 51/75 (68%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N +   +      D  G ECVIC+ + +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 249 EIYGIENKLVNKSIGDEDTDDNGSECVICMCDTRDTLILPCRHLCLCNSCADSLRYQANN 308

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 309 CPICRAPFRALLQIR 323

[61][TOP]
>UniRef100_Q29HV8 GA22141 n=1 Tax=Drosophila pseudoobscura pseudoobscura
           RepID=Q29HV8_DROPS
          Length = 809

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 37/75 (49%), Positives = 52/75 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     ++     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 297 EIYGIENKAVNKSSIDEDIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 356

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 357 CPICRAPFRALLQIR 371

[62][TOP]
>UniRef100_B7PGD7 Mahogunin, putative n=1 Tax=Ixodes scapularis RepID=B7PGD7_IXOSC
          Length = 349

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 40/78 (51%), Positives = 56/78 (71%), Gaps = 3/78 (3%)
 Frame = -2

Query: 570 ELYGIDN-SITQGTAASGLEDT--GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQ 400
           E+YGI+N ++ Q    +G E+T   G ECVIC+ E +DT ++PCRHLCLCS CA+ LR+Q
Sbjct: 233 EIYGIENKNVAQAKPPNGDEETEDSGAECVICMCESRDTLILPCRHLCLCSCCADSLRYQ 292

Query: 399 TNKCPICRQPIHELVKIK 346
            N CPICR P   L++++
Sbjct: 293 ANNCPICRAPFRALLQVR 310

[63][TOP]
>UniRef100_B4GY75 GL19851 n=1 Tax=Drosophila persimilis RepID=B4GY75_DROPE
          Length = 809

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 37/75 (49%), Positives = 52/75 (69%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     ++     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 297 EIYGIENKAVNKSSIDEDIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 356

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 357 CPICRAPFRALLQIR 371

[64][TOP]
>UniRef100_B3MW05 GF22349 n=1 Tax=Drosophila ananassae RepID=B3MW05_DROAN
          Length = 793

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 37/75 (49%), Positives = 51/75 (68%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N      +     D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 292 EIYGIENKAVNKNSMDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANN 351

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 352 CPICRAPFRALLQIR 366

[65][TOP]
>UniRef100_B6KLD8 Zinc finger (C3HC4 RING finger) protein, putative n=2
           Tax=Toxoplasma gondii RepID=B6KLD8_TOXGO
          Length = 384

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 38/78 (48%), Positives = 58/78 (74%)
 Frame = -2

Query: 561 GIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPI 382
           G D S ++ +    +++  G+ECVICL E ++TAV+PCRH+CLCS CA  +R Q+NKCPI
Sbjct: 307 GGDESDSRNSGDCQVDNLAGRECVICLAEERNTAVLPCRHMCLCSGCANIMRMQSNKCPI 366

Query: 381 CRQPIHELVKIKVESSDE 328
           CRQP+  L++I ++++ E
Sbjct: 367 CRQPVTSLLQITMKTNPE 384

[66][TOP]
>UniRef100_B0W223 Mahogunin n=1 Tax=Culex quinquefasciatus RepID=B0W223_CULQU
          Length = 680

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 36/75 (48%), Positives = 50/75 (66%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N +          D  G ECVIC+ + +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 250 EIYGIENKLVSKPIGDEDTDDNGSECVICMCDTRDTLILPCRHLCLCNSCADSLRYQANN 309

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 310 CPICRAPFRALLQIR 324

[67][TOP]
>UniRef100_B4NC93 GK25125 n=1 Tax=Drosophila willistoni RepID=B4NC93_DROWI
          Length = 782

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 38/76 (50%), Positives = 53/76 (69%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N      ++   E D  G ECVIC++E +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 292 EIYGIENKAVNKASSMDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQAN 351

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 352 NCPICRAPFRALLQIR 367

[68][TOP]
>UniRef100_UPI000051AAEE PREDICTED: similar to CG9941-PA n=1 Tax=Apis mellifera
           RepID=UPI000051AAEE
          Length = 555

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   +    S  + D  G ECVIC+ + +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 260 EIYGIENKNAENQQGSDEDTDDNGSECVICMCDVRDTLILPCRHLCLCNSCADSLRYQAN 319

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++IK
Sbjct: 320 NCPICRAPFRALLQIK 335

[69][TOP]
>UniRef100_UPI000179392D PREDICTED: similar to mahogunin n=1 Tax=Acyrthosiphon pisum
           RepID=UPI000179392D
          Length = 566

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 43/87 (49%), Positives = 57/87 (65%), Gaps = 4/87 (4%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT--GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N  T     SG ED   G  ECVIC+++ +DT ++PCRHLCLC  CA+ LR+Q 
Sbjct: 239 EIYGIENK-TPDLKDSGDEDLEDGSSECVICMSDMRDTLILPCRHLCLCQSCADSLRYQA 297

Query: 396 NKCPICRQPIHELVKIKV--ESSDEQH 322
           N CPICR P   L++IK   ++ D  H
Sbjct: 298 NNCPICRVPFRALLQIKALQKTLDNNH 324

[70][TOP]
>UniRef100_A4S8Y8 Predicted protein (Fragment) n=1 Tax=Ostreococcus lucimarinus
           CCE9901 RepID=A4S8Y8_OSTLU
          Length = 91

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 41/78 (52%), Positives = 57/78 (73%), Gaps = 2/78 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT-- 397
           E+YGI++    G +++ +    G+ECVICLTEP+DT V+PCRHLC+C++CA  LR Q   
Sbjct: 12  EIYGIESCDNVGLSSADV----GEECVICLTEPRDTTVLPCRHLCMCAECAHALRSQLTG 67

Query: 396 NKCPICRQPIHELVKIKV 343
           N CPICR P+  L++IKV
Sbjct: 68  NVCPICRNPVESLLEIKV 85

[71][TOP]
>UniRef100_UPI0000509BD5 mahogunin, ring finger 1 n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI0000509BD5
          Length = 508

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 250 EIYGIENKNNQDTKQSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 309

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 310 NCPICRLPFRALLQIR 325

[72][TOP]
>UniRef100_UPI00006A10AB Probable E3 ubiquitin-protein ligase MGRN1 (EC 6.3.2.-) (Mahogunin
           RING finger protein 1) (RING finger protein 156). n=1
           Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A10AB
          Length = 510

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQDTKQSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[73][TOP]
>UniRef100_Q6P7J2 MGC68621 protein n=1 Tax=Xenopus laevis RepID=Q6P7J2_XENLA
          Length = 473

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 212 EIYGIENKNNQDTKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 271

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 272 NCPICRLPFRALLQIR 287

[74][TOP]
>UniRef100_UPI000194D56F PREDICTED: mahogunin, ring finger 1, partial n=1 Tax=Taeniopygia
           guttata RepID=UPI000194D56F
          Length = 488

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 192 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 251

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 252 NCPICRLPFRALLQIR 267

[75][TOP]
>UniRef100_UPI000185BDB4 mahogunin, ring finger 1 isoform 2 n=1 Tax=Homo sapiens
           RepID=UPI000185BDB4
          Length = 555

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 253 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 312

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 313 NCPICRLPFRALLQIR 328

[76][TOP]
>UniRef100_UPI0001555658 PREDICTED: hypothetical protein, partial n=1 Tax=Ornithorhynchus
           anatinus RepID=UPI0001555658
          Length = 503

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 222 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 281

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 282 NCPICRLPFRALLQIR 297

[77][TOP]
>UniRef100_UPI0000F2DC5B PREDICTED: similar to Probable E3 ubiquitin-protein ligase MGRN1
           (Mahogunin RING finger protein 1) (RING finger protein
           156) isoform 2 n=1 Tax=Monodelphis domestica
           RepID=UPI0000F2DC5B
          Length = 556

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[78][TOP]
>UniRef100_UPI0000F2DC5A PREDICTED: similar to Probable E3 ubiquitin-protein ligase MGRN1
           (Mahogunin RING finger protein 1) (RING finger protein
           156) isoform 1 n=1 Tax=Monodelphis domestica
           RepID=UPI0000F2DC5A
          Length = 534

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[79][TOP]
>UniRef100_UPI0000E81038 PREDICTED: similar to Mahogunin, ring finger 1 n=1 Tax=Gallus
           gallus RepID=UPI0000E81038
          Length = 536

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 207 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 266

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 267 NCPICRLPFRALLQIR 282

[80][TOP]
>UniRef100_UPI0000D56F81 PREDICTED: similar to mahogunin n=1 Tax=Tribolium castaneum
           RepID=UPI0000D56F81
          Length = 614

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 35/75 (46%), Positives = 50/75 (66%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N      +     +  G ECVIC+ + +DT ++PCRHLCLC+ CA+ LR+Q N 
Sbjct: 258 EIYGIENKNNDKQSGDDETEDNGSECVICMCDVRDTLILPCRHLCLCNSCADSLRYQANN 317

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++I+
Sbjct: 318 CPICRAPFRALLQIR 332

[81][TOP]
>UniRef100_UPI0001A2D9DF arylalkylamine N-acetyltransferase n=1 Tax=Danio rerio
           RepID=UPI0001A2D9DF
          Length = 468

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 193 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 252

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 253 NCPICRLPFRALLQIR 268

[82][TOP]
>UniRef100_UPI00015A7947 arylalkylamine N-acetyltransferase n=1 Tax=Danio rerio
           RepID=UPI00015A7947
          Length = 549

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 250 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 309

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 310 NCPICRLPFRALLQIR 325

[83][TOP]
>UniRef100_UPI00017B3A49 UPI00017B3A49 related cluster n=1 Tax=Tetraodon nigroviridis
           RepID=UPI00017B3A49
          Length = 539

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 250 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 309

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 310 NCPICRLPFRALLQIR 325

[84][TOP]
>UniRef100_UPI0001B7A082 Probable E3 ubiquitin-protein ligase MGRN1 (EC 6.3.2.-) (Mahogunin
           RING finger protein 1). n=1 Tax=Rattus norvegicus
           RepID=UPI0001B7A082
          Length = 554

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[85][TOP]
>UniRef100_UPI00005075F3 Probable E3 ubiquitin-protein ligase MGRN1 (EC 6.3.2.-) (Mahogunin
           RING finger protein 1). n=1 Tax=Rattus norvegicus
           RepID=UPI00005075F3
          Length = 555

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[86][TOP]
>UniRef100_UPI000185BDB5 mahogunin, ring finger 1 isoform 4 n=1 Tax=Homo sapiens
           RepID=UPI000185BDB5
          Length = 531

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 253 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 312

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 313 NCPICRLPFRALLQIR 328

[87][TOP]
>UniRef100_UPI00016E90F2 UPI00016E90F2 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E90F2
          Length = 485

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 212 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 271

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 272 NCPICRLPFRALLQIR 287

[88][TOP]
>UniRef100_UPI00016E90F1 UPI00016E90F1 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E90F1
          Length = 545

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 250 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 309

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 310 NCPICRLPFRALLQIR 325

[89][TOP]
>UniRef100_UPI00016E90F0 UPI00016E90F0 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E90F0
          Length = 529

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 250 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 309

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 310 NCPICRLPFRALLQIR 325

[90][TOP]
>UniRef100_UPI0000ECAABB Probable E3 ubiquitin-protein ligase MGRN1 (EC 6.3.2.-) (Mahogunin
           RING finger protein 1) (RING finger protein 156). n=1
           Tax=Gallus gallus RepID=UPI0000ECAABB
          Length = 536

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 253 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 312

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 313 NCPICRLPFRALLQIR 328

[91][TOP]
>UniRef100_Q5BLF4 LOC553327 protein (Fragment) n=1 Tax=Danio rerio RepID=Q5BLF4_DANRE
          Length = 442

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 167 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 226

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 227 NCPICRLPFRALLQIR 242

[92][TOP]
>UniRef100_Q4RHC4 Chromosome 3 SCAF15050, whole genome shotgun sequence. (Fragment)
           n=1 Tax=Tetraodon nigroviridis RepID=Q4RHC4_TETNG
          Length = 496

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 295 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 354

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 355 NCPICRLPFRALLQIR 370

[93][TOP]
>UniRef100_B0R0J5 Novel protein similar to mahogunin, ring finger 1 (Mgrn1) n=1
           Tax=Danio rerio RepID=B0R0J5_DANRE
          Length = 549

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 250 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAN 309

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 310 NCPICRLPFRALLQIR 325

[94][TOP]
>UniRef100_Q5XIQ4 Probable E3 ubiquitin-protein ligase MGRN1 n=1 Tax=Rattus
           norvegicus RepID=MGRN1_RAT
          Length = 533

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 253 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 312

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 313 NCPICRLPFRALLQIR 328

[95][TOP]
>UniRef100_Q9D074-2 Isoform 2 of Probable E3 ubiquitin-protein ligase MGRN1 n=1 Tax=Mus
           musculus RepID=Q9D074-2
          Length = 533

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 253 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 312

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 313 NCPICRLPFRALLQIR 328

[96][TOP]
>UniRef100_Q9D074-3 Isoform 3 of Probable E3 ubiquitin-protein ligase MGRN1 n=1 Tax=Mus
           musculus RepID=Q9D074-3
          Length = 556

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[97][TOP]
>UniRef100_Q9D074-4 Isoform 4 of Probable E3 ubiquitin-protein ligase MGRN1 n=1 Tax=Mus
           musculus RepID=Q9D074-4
          Length = 554

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[98][TOP]
>UniRef100_Q9D074 Probable E3 ubiquitin-protein ligase MGRN1 n=1 Tax=Mus musculus
           RepID=MGRN1_MOUSE
          Length = 532

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[99][TOP]
>UniRef100_O60291-2 Isoform 2 of Probable E3 ubiquitin-protein ligase MGRN1 n=1
           Tax=Homo sapiens RepID=O60291-2
          Length = 576

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[100][TOP]
>UniRef100_O60291-3 Isoform 3 of Probable E3 ubiquitin-protein ligase MGRN1 n=1
           Tax=Homo sapiens RepID=O60291-3
          Length = 554

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[101][TOP]
>UniRef100_O60291-4 Isoform 4 of Probable E3 ubiquitin-protein ligase MGRN1 n=1
           Tax=Homo sapiens RepID=O60291-4
          Length = 530

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[102][TOP]
>UniRef100_O60291 Probable E3 ubiquitin-protein ligase MGRN1 n=1 Tax=Homo sapiens
           RepID=MGRN1_HUMAN
          Length = 552

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[103][TOP]
>UniRef100_A7SE55 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A7SE55_NEMVE
          Length = 389

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 37/78 (47%), Positives = 53/78 (67%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N     T     +D    ECVIC+++ +DT ++PCRHLCLC  CA+ LR+Q++ 
Sbjct: 242 EIYGIENKAETDTDNEVDDDDNVLECVICMSDFRDTLILPCRHLCLCKACADSLRYQSST 301

Query: 390 CPICRQPIHELVKIKVES 337
           CPICR P H L++I+  S
Sbjct: 302 CPICRSPFHALLQIRAYS 319

[104][TOP]
>UniRef100_UPI0001796FB0 PREDICTED: similar to mahogunin, ring finger 1 n=1 Tax=Equus
           caballus RepID=UPI0001796FB0
          Length = 627

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 37/76 (48%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q +
Sbjct: 303 EIYGIENKNNQETKPSDEENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAS 362

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 363 NCPICRLPFRALLQIR 378

[105][TOP]
>UniRef100_UPI0000612E58 mahogunin, ring finger 1 n=1 Tax=Bos taurus RepID=UPI0000612E58
          Length = 575

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 37/76 (48%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q +
Sbjct: 252 EIYGIENKNNQETKPSDEENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAS 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[106][TOP]
>UniRef100_UPI00005A113C PREDICTED: similar to mahogunin, ring finger 1 n=1 Tax=Canis lupus
           familiaris RepID=UPI00005A113C
          Length = 551

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 37/76 (48%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q +
Sbjct: 226 EIYGIENKNNQETKPSDEENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAS 285

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 286 NCPICRLPFRALLQIR 301

[107][TOP]
>UniRef100_UPI0000EB350D Probable E3 ubiquitin-protein ligase MGRN1 (EC 6.3.2.-) (Mahogunin
           RING finger protein 1) (RING finger protein 156). n=1
           Tax=Canis lupus familiaris RepID=UPI0000EB350D
          Length = 502

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 37/76 (48%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q +
Sbjct: 223 EIYGIENKNNQETKPSDEENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAS 282

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 283 NCPICRLPFRALLQIR 298

[108][TOP]
>UniRef100_UPI0000EB350C Probable E3 ubiquitin-protein ligase MGRN1 (EC 6.3.2.-) (Mahogunin
           RING finger protein 1) (RING finger protein 156). n=1
           Tax=Canis lupus familiaris RepID=UPI0000EB350C
          Length = 524

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 37/76 (48%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q +
Sbjct: 223 EIYGIENKNNQETKPSDEENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAS 282

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 283 NCPICRLPFRALLQIR 298

[109][TOP]
>UniRef100_UPI00004C07A4 Probable E3 ubiquitin-protein ligase MGRN1 (EC 6.3.2.-) (Mahogunin
           RING finger protein 1) (RING finger protein 156). n=1
           Tax=Canis lupus familiaris RepID=UPI00004C07A4
          Length = 548

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 37/76 (48%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q +
Sbjct: 223 EIYGIENKNNQETKPSDEENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAS 282

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 283 NCPICRLPFRALLQIR 298

[110][TOP]
>UniRef100_UPI000179CCAA hypothetical protein LOC616130 n=1 Tax=Bos taurus
           RepID=UPI000179CCAA
          Length = 551

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 37/76 (48%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q +
Sbjct: 252 EIYGIENKNNQETKPSDEENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAS 311

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 312 NCPICRLPFRALLQIR 327

[111][TOP]
>UniRef100_A5A786 Mahogunin ring finger protein 1 (Fragment) n=1 Tax=Sus scrofa
           RepID=A5A786_PIG
          Length = 488

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 37/76 (48%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q +
Sbjct: 215 EIYGIENKNNQETKPSDEENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQAS 274

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 275 NCPICRLPFRALLQIR 290

[112][TOP]
>UniRef100_B7ZVH3 Mgrn1 protein n=1 Tax=Danio rerio RepID=B7ZVH3_DANRE
          Length = 554

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 37/76 (48%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T ++  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 250 EIYGIENRNNQETKSTEDENSDNSSECVVCLSDLRDTLILPCRHLCLCNACADTLRYQAN 309

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 310 NCPICRLPFRALLQIR 325

[113][TOP]
>UniRef100_B0JZJ6 Mgrn1 protein n=1 Tax=Danio rerio RepID=B0JZJ6_DANRE
          Length = 529

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 37/76 (48%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T ++  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 250 EIYGIENRNNQETKSTEDENSDNSSECVVCLSDLRDTLILPCRHLCLCNACADTLRYQAN 309

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 310 NCPICRLPFRALLQIR 325

[114][TOP]
>UniRef100_Q17911 Protein C11H1.3, partially confirmed by transcript evidence n=1
           Tax=Caenorhabditis elegans RepID=Q17911_CAEEL
          Length = 529

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 33/75 (44%), Positives = 54/75 (72%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E++GI+N      +   ++D  G EC+ICL++ +DT ++PCRHLC+CS+CA+ LR++ N 
Sbjct: 249 EIFGIENK-----SVETMDDDSGLECIICLSDIRDTVILPCRHLCVCSNCADSLRYKHNN 303

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++++
Sbjct: 304 CPICRSPFRALIRLR 318

[115][TOP]
>UniRef100_Q7ZUL9 Probable E3 ubiquitin-protein ligase MGRN1 n=1 Tax=Danio rerio
           RepID=MGRN1_DANRE
          Length = 529

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 37/76 (48%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T ++  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 250 EIYGIENRNNQETKSTEDENSDNSSECVVCLSDLRDTLILPCRHLCLCNACADTLRYQAN 309

Query: 393 KCPICRQPIHELVKIK 346
            CPICR P   L++I+
Sbjct: 310 NCPICRLPFRALLQIR 325

[116][TOP]
>UniRef100_A8X547 Putative uncharacterized protein n=1 Tax=Caenorhabditis briggsae
           RepID=A8X547_CAEBR
          Length = 531

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 33/75 (44%), Positives = 54/75 (72%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E++GI+N   +      ++D  G EC+ICL++ +DT ++PCRHLC+CS+CA+ LR++ N 
Sbjct: 249 EIFGIENKGNES-----MDDDNGLECIICLSDIRDTVILPCRHLCVCSNCADSLRYKHNN 303

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L++++
Sbjct: 304 CPICRSPFRALIRLR 318

[117][TOP]
>UniRef100_Q00TM5 Putative RING zinc finger protein (ISS) n=1 Tax=Ostreococcus tauri
           RepID=Q00TM5_OSTTA
          Length = 389

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 39/83 (46%), Positives = 54/83 (65%), Gaps = 3/83 (3%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQ--- 400
           E+YGI + +  G   +G  +     CVICLTEP++T V+PCRHLC+C++CA  LR Q   
Sbjct: 300 EIYGIVDDVHNGLNGAGGGNPDDDLCVICLTEPRNTTVLPCRHLCMCAECAHHLRLQGST 359

Query: 399 TNKCPICRQPIHELVKIKVESSD 331
            N CPICR P+  L++I+V   D
Sbjct: 360 GNVCPICRNPVESLLEIQVSEVD 382

[118][TOP]
>UniRef100_A8NJ75 Putative uncharacterized protein n=1 Tax=Brugia malayi
           RepID=A8NJ75_BRUMA
          Length = 502

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 35/75 (46%), Positives = 51/75 (68%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YGI+N          L D  G EC+IC+++ +DT ++PCRHLC+C+ CAE LR++ N 
Sbjct: 251 EIYGIENK------EHDLGDENGSECIICMSDIRDTVILPCRHLCICNGCAETLRYKLNN 304

Query: 390 CPICRQPIHELVKIK 346
           CPICR P   L+++K
Sbjct: 305 CPICRSPFRALLQLK 319

[119][TOP]
>UniRef100_UPI000186E6D3 mahogunin, putative n=1 Tax=Pediculus humanus corporis
           RepID=UPI000186E6D3
          Length = 626

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT--GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N           E+T   G +CVIC+ + +DT ++PC+HLCLC+ CA+ LR+Q 
Sbjct: 252 EIYGIENKNNDNAKVLSDEETEDNGSDCVICMCDMRDTLILPCKHLCLCNSCADSLRYQA 311

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 312 NNCPICRAPFRALLQIR 328

[120][TOP]
>UniRef100_B3L0K0 RING zinc finger protein, putative n=1 Tax=Plasmodium knowlesi
           strain H RepID=B3L0K0_PLAKH
          Length = 305

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 39/79 (49%), Positives = 55/79 (69%), Gaps = 1/79 (1%)
 Frame = -2

Query: 570 ELYGIDNS-ITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E++GI+ S   Q  A S      G+ECVICLTE +DTA++PCRH+CLC+ CA  +R Q  
Sbjct: 217 EIFGIEKSKAPQPDAVSNF--LSGRECVICLTEERDTAILPCRHMCLCNVCANVVRMQNT 274

Query: 393 KCPICRQPIHELVKIKVES 337
           KCPICRQ +  L++I +++
Sbjct: 275 KCPICRQDVRGLLQINIDN 293

[121][TOP]
>UniRef100_A5KBX2 RING zinc finger protein, putative n=1 Tax=Plasmodium vivax
           RepID=A5KBX2_PLAVI
          Length = 305

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 39/79 (49%), Positives = 55/79 (69%), Gaps = 1/79 (1%)
 Frame = -2

Query: 570 ELYGIDNS-ITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E++GI+ S   Q  A S      G+ECVICLTE +DTA++PCRH+CLC+ CA  +R Q  
Sbjct: 217 EIFGIEKSKAPQPDAVSSF--LSGRECVICLTEERDTAILPCRHMCLCNVCANVVRMQNT 274

Query: 393 KCPICRQPIHELVKIKVES 337
           KCPICRQ +  L++I +++
Sbjct: 275 KCPICRQDVRGLLQINIDN 293

[122][TOP]
>UniRef100_D0A5B8 Putative uncharacterized protein (Predicted zinc finger protein)
           n=2 Tax=Trypanosoma brucei RepID=D0A5B8_TRYBG
          Length = 324

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 38/69 (55%), Positives = 47/69 (68%)
 Frame = -2

Query: 561 GIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPI 382
           G    +  G++ASG  D     CVICLT PKDTAV+PCRH+CLC +CAEEL   T KCP+
Sbjct: 245 GAQPEVVVGSSASGQGDDDDGLCVICLTLPKDTAVIPCRHMCLCKNCAEELVRHTPKCPV 304

Query: 381 CRQPIHELV 355
           CR P+  L+
Sbjct: 305 CRGPVSTLL 313

[123][TOP]
>UniRef100_UPI0000DA3651 PREDICTED: similar to ring finger protein 157 n=1 Tax=Rattus
           norvegicus RepID=UPI0000DA3651
          Length = 657

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N      +    +D      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 226 EIYGIENKYNTQDSKVAEDDVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 285

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 286 NNCPICRLPFRALLQIR 302

[124][TOP]
>UniRef100_Q8CAR4 Putative uncharacterized protein (Fragment) n=1 Tax=Mus musculus
           RepID=Q8CAR4_MOUSE
          Length = 506

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N      +    +D      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 75  EIYGIENKYNTQDSKVAEDDVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 134

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 135 NNCPICRLPFRALLQIR 151

[125][TOP]
>UniRef100_A2AAP0 Ring finger protein 157 n=1 Tax=Mus musculus RepID=A2AAP0_MOUSE
          Length = 659

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N      +    +D      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNTQDSKVAEDDVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 310 NNCPICRLPFRALLQIR 326

[126][TOP]
>UniRef100_A2AAN9 Ring finger protein 157 n=1 Tax=Mus musculus RepID=A2AAN9_MOUSE
          Length = 681

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N      +    +D      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNTQDSKVAEDDVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 310 NNCPICRLPFRALLQIR 326

[127][TOP]
>UniRef100_A2AAN8 Ring finger protein 157 (Fragment) n=1 Tax=Mus musculus
           RepID=A2AAN8_MOUSE
          Length = 505

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N      +    +D      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 74  EIYGIENKYNTQDSKVAEDDVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 133

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 134 NNCPICRLPFRALLQIR 150

[128][TOP]
>UniRef100_Q8I660 RING zinc finger protein, putative n=1 Tax=Plasmodium falciparum
           3D7 RepID=Q8I660_PLAF7
          Length = 298

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 39/83 (46%), Positives = 56/83 (67%), Gaps = 2/83 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGT--AASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E++GI+ S    T    + L D   +ECVICLT+ KDTA++PCRH+CLC+ CA  +R Q 
Sbjct: 215 EIFGIEKSPETKTDPVNNYLSD---RECVICLTDEKDTAILPCRHMCLCNVCANVVRMQN 271

Query: 396 NKCPICRQPIHELVKIKVESSDE 328
            KCPICRQ +  L++I ++  D+
Sbjct: 272 TKCPICRQEVQGLLQISIDKKDK 294

[129][TOP]
>UniRef100_Q3TEL6-2 Isoform 2 of RING finger protein 157 n=1 Tax=Mus musculus
           RepID=Q3TEL6-2
          Length = 681

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N      +    +D      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNTQDSKVAEDDVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 310 NNCPICRLPFRALLQIR 326

[130][TOP]
>UniRef100_Q3TEL6 RING finger protein 157 n=1 Tax=Mus musculus RepID=RN157_MOUSE
          Length = 685

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N      +    +D      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNTQDSKVAEDDVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 310 NNCPICRLPFRALLQIR 326

[131][TOP]
>UniRef100_UPI0000F2BEFD PREDICTED: similar to ring finger protein 157, n=1 Tax=Monodelphis
           domestica RepID=UPI0000F2BEFD
          Length = 687

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E +    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNTQDSKVAEDEVNDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 310 NNCPICRLPFRALLQIR 326

[132][TOP]
>UniRef100_UPI0000EBDED0 PREDICTED: similar to ring finger protein 157 n=1 Tax=Bos taurus
           RepID=UPI0000EBDED0
          Length = 686

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 35/77 (45%), Positives = 50/77 (64%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSIT--QGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N     +   A         ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNTQESKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 310 NNCPICRLPFRALLQIR 326

[133][TOP]
>UniRef100_UPI000179696E PREDICTED: similar to ring finger protein 157 n=1 Tax=Equus
           caballus RepID=UPI000179696E
          Length = 697

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 37/77 (48%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 263 EIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 322

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 323 NNCPICRLPFRALLQIR 339

[134][TOP]
>UniRef100_UPI0000E8128D PREDICTED: similar to KIAA1917 protein n=1 Tax=Gallus gallus
           RepID=UPI0000E8128D
          Length = 1229

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 37/77 (48%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 769 EIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 828

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 829 NNCPICRLPFRALLQIR 845

[135][TOP]
>UniRef100_UPI0000D9E513 PREDICTED: similar to ring finger protein 157 n=1 Tax=Macaca
           mulatta RepID=UPI0000D9E513
          Length = 797

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 37/77 (48%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 367 EIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 426

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 427 NNCPICRLPFRALLQIR 443

[136][TOP]
>UniRef100_UPI00005A1A70 PREDICTED: similar to ring finger protein 157 n=1 Tax=Canis lupus
           familiaris RepID=UPI00005A1A70
          Length = 716

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 37/77 (48%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 280 EIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 339

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 340 NNCPICRLPFRALLQIR 356

[137][TOP]
>UniRef100_UPI00015DFBCC RING finger protein 157. n=1 Tax=Homo sapiens RepID=UPI00015DFBCC
          Length = 380

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 37/77 (48%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 212 EIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 271

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 272 NNCPICRLPFRALLQIR 288

[138][TOP]
>UniRef100_UPI0000EB1F6D RING finger protein 157. n=1 Tax=Canis lupus familiaris
           RepID=UPI0000EB1F6D
          Length = 660

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 37/77 (48%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 224 EIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 283

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 284 NNCPICRLPFRALLQIR 300

[139][TOP]
>UniRef100_UPI0000ECA497 RING finger protein 157. n=1 Tax=Gallus gallus RepID=UPI0000ECA497
          Length = 632

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 37/77 (48%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 223 EIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 282

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 283 NNCPICRLPFRALLQIR 299

[140][TOP]
>UniRef100_Q9BTC5 RNF157 protein (Fragment) n=1 Tax=Homo sapiens RepID=Q9BTC5_HUMAN
          Length = 265

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 37/77 (48%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 98  EIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 157

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 158 NNCPICRLPFRALLQIR 174

[141][TOP]
>UniRef100_Q96PX1-2 Isoform 2 of RING finger protein 157 n=1 Tax=Homo sapiens
           RepID=Q96PX1-2
          Length = 657

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 37/77 (48%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 310 NNCPICRLPFRALLQIR 326

[142][TOP]
>UniRef100_Q96PX1 RING finger protein 157 n=1 Tax=Homo sapiens RepID=RN157_HUMAN
          Length = 679

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 37/77 (48%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSI-TQGTAASGLE-DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N   TQ +  +  E      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 310 NNCPICRLPFRALLQIR 326

[143][TOP]
>UniRef100_B4DR12 cDNA FLJ60814, highly similar to Probable E3 ubiquitin-protein
           ligase MGRN1(EC 6.3.2.-) n=1 Tax=Homo sapiens
           RepID=B4DR12_HUMAN
          Length = 320

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 35/66 (53%), Positives = 48/66 (72%), Gaps = 1/66 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           E+YGI+N   Q T  S  E++    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N
Sbjct: 252 EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQAN 311

Query: 393 KCPICR 376
            CPICR
Sbjct: 312 NCPICR 317

[144][TOP]
>UniRef100_A4HXY9 Putative uncharacterized protein n=1 Tax=Leishmania infantum
           RepID=A4HXY9_LEIIN
          Length = 366

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 39/80 (48%), Positives = 48/80 (60%), Gaps = 9/80 (11%)
 Frame = -2

Query: 567 LYGIDNSITQGTAASG---------LEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAE 415
           LYG+DN  T   + +G         +ED     CVICLT PKDTAVMPCRH+C+C DC E
Sbjct: 273 LYGVDNDGTAPASGNGGGAVMIGSTIEDEEDGLCVICLTNPKDTAVMPCRHMCMCKDCGE 332

Query: 414 ELRFQTNKCPICRQPIHELV 355
           +L      CP+CR PI  L+
Sbjct: 333 QLLKHKPVCPVCRAPISTLL 352

[145][TOP]
>UniRef100_UPI000176007C PREDICTED: similar to RING finger protein 157 n=1 Tax=Danio rerio
           RepID=UPI000176007C
          Length = 654

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 35/77 (45%), Positives = 50/77 (64%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSIT--QGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N     +   A         ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNSQESKVAEDEISDNSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 310 NCCPICRLPFRALLQIR 326

[146][TOP]
>UniRef100_UPI0001A2C404 UPI0001A2C404 related cluster n=1 Tax=Danio rerio
           RepID=UPI0001A2C404
          Length = 605

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 35/77 (45%), Positives = 50/77 (64%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSIT--QGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N     +   A         ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNSQESKVAEDEISDNSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 310 NCCPICRLPFRALLQIR 326

[147][TOP]
>UniRef100_UPI00017B3A0B UPI00017B3A0B related cluster n=1 Tax=Tetraodon nigroviridis
           RepID=UPI00017B3A0B
          Length = 506

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 35/77 (45%), Positives = 50/77 (64%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSIT--QGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N     +   A         ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 251 EIYGIENKYNSQESKVADDEISDNSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQA 310

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 311 NCCPICRLPFRALLQIR 327

[148][TOP]
>UniRef100_UPI00016E13AB UPI00016E13AB related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E13AB
          Length = 497

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 35/77 (45%), Positives = 50/77 (64%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSIT--QGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N     +   A         ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 251 EIYGIENKYNSQESKVADDEISDNSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQA 310

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 311 NCCPICRLPFRALLQIR 327

[149][TOP]
>UniRef100_UPI00016E13AA UPI00016E13AA related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E13AA
          Length = 607

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 35/77 (45%), Positives = 50/77 (64%), Gaps = 2/77 (2%)
 Frame = -2

Query: 570 ELYGIDNSIT--QGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N     +   A         ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 251 EIYGIENKYNSQESKVADDEISDNSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQA 310

Query: 396 NKCPICRQPIHELVKIK 346
           N CPICR P   L++I+
Sbjct: 311 NCCPICRLPFRALLQIR 327

[150][TOP]
>UniRef100_Q6INH1 RING finger protein 157 n=1 Tax=Xenopus laevis RepID=RN157_XENLA
          Length = 674

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 41/94 (43%), Positives = 57/94 (60%), Gaps = 4/94 (4%)
 Frame = -2

Query: 570 ELYGIDN---SITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQ 400
           E+YGI+N   S     A   L D    ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q
Sbjct: 250 EIYGIENKYNSQDSKVAEDELSDNSA-ECVVCLSDVRDTLILPCRHLCLCNACADTLRYQ 308

Query: 399 TNKCPICRQPIHELVKIK-VESSDEQH*KRGFFP 301
            + CPICR P   L++I+ +      H   GF P
Sbjct: 309 ASNCPICRLPFRALLQIRAMRKVPGPHSPGGFSP 342

[151][TOP]
>UniRef100_UPI0001863A52 hypothetical protein BRAFLDRAFT_82470 n=1 Tax=Branchiostoma
           floridae RepID=UPI0001863A52
          Length = 885

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 30/56 (53%), Positives = 44/56 (78%)
 Frame = -2

Query: 513 DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIK 346
           D  G ECVIC+++ +DT ++PCRHLCLC+ CA+ LR+Q + CPICRQP   L++++
Sbjct: 236 DDSGSECVICMSDIRDTLILPCRHLCLCNGCADSLRYQASNCPICRQPFRALLQMR 291

[152][TOP]
>UniRef100_Q0V9Q3 Mahogunin ring finger 1, possibly N-myristoylated (XO930) n=1
           Tax=Xenopus (Silurana) tropicalis RepID=Q0V9Q3_XENTR
          Length = 492

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 37/93 (39%), Positives = 56/93 (60%), Gaps = 3/93 (3%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N      +    ++      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 250 EIYGIENKYNSQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQA 309

Query: 396 NKCPICRQPIHELVKIK-VESSDEQH*KRGFFP 301
           + CPICR P   L++I+ +      H   GF P
Sbjct: 310 SNCPICRLPFRALLQIRAMRKVPGPHSPAGFSP 342

[153][TOP]
>UniRef100_Q4QDS7 Putative uncharacterized protein n=1 Tax=Leishmania major
           RepID=Q4QDS7_LEIMA
          Length = 360

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 41/87 (47%), Positives = 50/87 (57%), Gaps = 9/87 (10%)
 Frame = -2

Query: 567 LYGIDNSITQGTA---------ASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAE 415
           LYG+DN  T   +          S +ED     CVICLT PKDTAVMPCRH+C+C DC E
Sbjct: 267 LYGVDNDGTAPASDNAGGAVMIGSTIEDEEDGLCVICLTNPKDTAVMPCRHMCMCKDCGE 326

Query: 414 ELRFQTNKCPICRQPIHELVKIKVESS 334
           +L      CP+CR PI  L+ +   SS
Sbjct: 327 QLLKHKPVCPVCRAPISTLLHMPSLSS 353

[154][TOP]
>UniRef100_C3Y9B4 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae
           RepID=C3Y9B4_BRAFL
          Length = 1001

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 30/56 (53%), Positives = 44/56 (78%)
 Frame = -2

Query: 513 DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIK 346
           D  G ECVIC+++ +DT ++PCRHLCLC+ CA+ LR+Q + CPICRQP   L++++
Sbjct: 490 DDSGSECVICMSDIRDTLILPCRHLCLCNGCADSLRYQASNCPICRQPFRALLQMR 545

[155][TOP]
>UniRef100_A4H9M5 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis
           RepID=A4H9M5_LEIBR
          Length = 333

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 40/80 (50%), Positives = 46/80 (57%), Gaps = 9/80 (11%)
 Frame = -2

Query: 567 LYGIDNSITQGTAASG---------LEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAE 415
           LYG DN  T     SG         +ED     CVICLT PKDTAVMPCRH+C+C DC E
Sbjct: 240 LYGADNDGTTPATRSGGGAVMIGSTIEDDEDGLCVICLTNPKDTAVMPCRHMCMCKDCGE 299

Query: 414 ELRFQTNKCPICRQPIHELV 355
           +L      CP+CR PI  L+
Sbjct: 300 QLLKHKPVCPVCRAPISTLL 319

[156][TOP]
>UniRef100_UPI000180B1CE PREDICTED: similar to RING finger protein 157, partial n=1
           Tax=Ciona intestinalis RepID=UPI000180B1CE
          Length = 521

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 8/83 (9%)
 Frame = -2

Query: 570 ELYGIDNSITQG--TAASGLEDT------GGKECVICLTEPKDTAVMPCRHLCLCSDCAE 415
           E+YGI+N    G     +G+ D          ECV+CL++ +DT ++PC+HLCLCS CA 
Sbjct: 266 EIYGIENKHDAGGPDGDAGVPDNEDDDYDDSSECVVCLSDSRDTLILPCKHLCLCSTCAN 325

Query: 414 ELRFQTNKCPICRQPIHELVKIK 346
           +LRFQ + CPICRQ    L++I+
Sbjct: 326 QLRFQQSGCPICRQSFRALLQIR 348

[157][TOP]
>UniRef100_Q23MB1 Putative uncharacterized protein n=1 Tax=Tetrahymena thermophila
            SB210 RepID=Q23MB1_TETTH
          Length = 969

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 32/63 (50%), Positives = 44/63 (69%)
 Frame = -2

Query: 537  GTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHEL 358
            G A SGL     K+C ICL+E  DT ++PCRH+CLC DC ++L+ + NKCPICRQ +   
Sbjct: 840  GIAESGLNQNSDKDCSICLSEKIDTIILPCRHMCLCYDCCQDLKTKANKCPICRQSMSNF 899

Query: 357  VKI 349
            +K+
Sbjct: 900  LKL 902

[158][TOP]
>UniRef100_Q7RT04 Putative uncharacterized protein PY00197 n=1 Tax=Plasmodium yoelii
           yoelii RepID=Q7RT04_PLAYO
          Length = 360

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 2/68 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTG--GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E++GI+ S    T      DT   GKECVICLTE ++TA++PCRH+CLC+ CA  +R Q 
Sbjct: 239 EIFGIEKS---NTPQPNPVDTSFSGKECVICLTEERNTAILPCRHMCLCNTCANIVRMQN 295

Query: 396 NKCPICRQ 373
            KCPICRQ
Sbjct: 296 TKCPICRQ 303

[159][TOP]
>UniRef100_UPI0000E24091 PREDICTED: mahogunin, ring finger 1 n=1 Tax=Pan troglodytes
           RepID=UPI0000E24091
          Length = 756

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 29/51 (56%), Positives = 41/51 (80%)
 Frame = -2

Query: 498 ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIK 346
           ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q N CPICR P   L++I+
Sbjct: 457 ECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLPFRALLQIR 507

[160][TOP]
>UniRef100_Q4E000 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi
           RepID=Q4E000_TRYCR
          Length = 357

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 35/49 (71%), Positives = 37/49 (75%)
 Frame = -2

Query: 522 GLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICR 376
           G ED  G  CVICLT PKDTAVMPCRH+CLC  CAEEL   T KCP+CR
Sbjct: 292 GEEDEDGL-CVICLTVPKDTAVMPCRHMCLCKGCAEELMRHTPKCPVCR 339

[161][TOP]
>UniRef100_Q4DLJ9 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi
           RepID=Q4DLJ9_TRYCR
          Length = 359

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 35/49 (71%), Positives = 37/49 (75%)
 Frame = -2

Query: 522 GLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICR 376
           G ED  G  CVICLT PKDTAVMPCRH+CLC  CAEEL   T KCP+CR
Sbjct: 294 GEEDEDGL-CVICLTVPKDTAVMPCRHMCLCKGCAEELMRHTPKCPVCR 341

[162][TOP]
>UniRef100_Q4T6Z4 Chromosome 2 SCAF8472, whole genome shotgun sequence. (Fragment)
           n=1 Tax=Tetraodon nigroviridis RepID=Q4T6Z4_TETNG
          Length = 577

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 2/67 (2%)
 Frame = -2

Query: 570 ELYGIDNSIT--QGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N     +   A         ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 274 EIYGIENKYNSQESKVADDEISDNSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQA 333

Query: 396 NKCPICR 376
           N CPICR
Sbjct: 334 NCCPICR 340

[163][TOP]
>UniRef100_UPI000069F6F6 RING finger protein 157. n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI000069F6F6
          Length = 644

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 2/67 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YGI+N      +    ++      ECV+CL++ +DT ++PCRHLCLC+ CA+ LR+Q 
Sbjct: 221 EIYGIENKYNSQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQA 280

Query: 396 NKCPICR 376
           + CPICR
Sbjct: 281 SNCPICR 287

[164][TOP]
>UniRef100_Q57UZ4 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei
           RepID=Q57UZ4_9TRYP
          Length = 334

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAAS--GLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQ- 400
           E+Y +D+    G  +     ED   K CV+CLT  +DT ++PCRH+CLC +CA  LR Q 
Sbjct: 258 EVYELDDVFDLGANSDDENAEDDDDKLCVVCLTNERDTMLLPCRHMCLCYECASMLRIQR 317

Query: 399 TNKCPICRQPIHELV 355
            N CPICR PI  L+
Sbjct: 318 NNACPICRVPIERLM 332

[165][TOP]
>UniRef100_Q55DC5 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
           RepID=Q55DC5_DICDI
          Length = 423

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 32/55 (58%), Positives = 39/55 (70%)
 Frame = -2

Query: 513 DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKI 349
           D+   ECV CL+EPK+   +PCRH CLCS CAE +R  + KCPICR PI  L+KI
Sbjct: 354 DSISDECVACLSEPKEVLAIPCRHFCLCSKCAEIMRNVSLKCPICRTPIRALLKI 408

[166][TOP]
>UniRef100_C9ZVQ7 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei
           gambiense DAL972 RepID=C9ZVQ7_TRYBG
          Length = 334

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAAS--GLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQ- 400
           E+Y +D+    G  +     ED   K CV+CLT  +DT ++PCRH+CLC +CA  LR Q 
Sbjct: 258 EVYELDDVFDLGANSDDENAEDDDDKLCVVCLTNERDTMLLPCRHMCLCYECASMLRIQR 317

Query: 399 TNKCPICRQPIHELV 355
            N CPICR PI  L+
Sbjct: 318 NNACPICRVPIERLM 332

[167][TOP]
>UniRef100_A4H6A2 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis
           RepID=A4H6A2_LEIBR
          Length = 355

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 5/79 (6%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKE-----CVICLTEPKDTAVMPCRHLCLCSDCAEELR 406
           E+Y +++    G      +  G +E     CVICLT  KDT ++PCRH+CLC+ CA  LR
Sbjct: 277 EVYDLEDIFDDGRGDDVRDAAGDEEDMEGLCVICLTNQKDTTILPCRHMCLCNTCAAHLR 336

Query: 405 FQTNKCPICRQPIHELVKI 349
              N+CP+CR  I  ++ +
Sbjct: 337 LSNNRCPLCRGNIDRVMTL 355

[168][TOP]
>UniRef100_Q4QHA0 Putative uncharacterized protein n=1 Tax=Leishmania major
           RepID=Q4QHA0_LEIMA
          Length = 360

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 32/80 (40%), Positives = 47/80 (58%), Gaps = 6/80 (7%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKE------CVICLTEPKDTAVMPCRHLCLCSDCAEEL 409
           E+Y +++    G     + D G  E      CVICLT  KDT ++PCRH+CLC++CA  L
Sbjct: 282 EVYDLEDVFDDGRE-DAVRDPGADEEDEEGLCVICLTNQKDTTILPCRHMCLCNECAAHL 340

Query: 408 RFQTNKCPICRQPIHELVKI 349
           R   N+CP+CR  I  ++ +
Sbjct: 341 RLSDNRCPLCRGYIDRVMTL 360

[169][TOP]
>UniRef100_A4HUM6 Putative uncharacterized protein n=1 Tax=Leishmania infantum
           RepID=A4HUM6_LEIIN
          Length = 360

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 32/80 (40%), Positives = 47/80 (58%), Gaps = 6/80 (7%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKE------CVICLTEPKDTAVMPCRHLCLCSDCAEEL 409
           E+Y +++    G     + D G  E      CVICLT  KDT ++PCRH+CLC++CA  L
Sbjct: 282 EVYDLEDVFDDGRE-DAVRDPGADEESEEGLCVICLTNQKDTTILPCRHMCLCNECAAHL 340

Query: 408 RFQTNKCPICRQPIHELVKI 349
           R   N+CP+CR  I  ++ +
Sbjct: 341 RLSDNRCPLCRGYIDRVMTL 360

[170][TOP]
>UniRef100_UPI000150A28B zinc finger protein n=1 Tax=Tetrahymena thermophila
           RepID=UPI000150A28B
          Length = 346

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 33/89 (37%), Positives = 54/89 (60%), Gaps = 8/89 (8%)
 Frame = -2

Query: 570 ELYGIDNS-ITQGTAASGLE---DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRF 403
           E+YG++N+ +  G AA   +   D   KEC+IC+T+  DT +MPC+H+C+C +CA+   F
Sbjct: 253 EIYGVENTDLVHGEAAEQKQANMDDCNKECIICMTDLIDTVIMPCKHMCICVECAK--TF 310

Query: 402 QTNK----CPICRQPIHELVKIKVESSDE 328
           Q  K    CP+CR+ I   ++I  +   +
Sbjct: 311 QQKKSNRLCPVCRKEIESFLRISKQQQSQ 339

[171][TOP]
>UniRef100_Q4D2A5 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi
           RepID=Q4D2A5_TRYCR
          Length = 363

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 8/82 (9%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKE-------CVICLTEPKDTAVMPCRHLCLCSDCAEE 412
           ++Y +D+    G   S     G  E       CVICL  PKDT ++PCRH+CLC +CA  
Sbjct: 282 QVYELDDVFDLGGDGSDNNLDGNDEEEEEIDLCVICLLNPKDTTLLPCRHMCLCYECASI 341

Query: 411 LRF-QTNKCPICRQPIHELVKI 349
           LRF Q N+CP+CR  I  ++ +
Sbjct: 342 LRFQQNNRCPVCRSNIDRVMTL 363

[172][TOP]
>UniRef100_A7ASN3 Putative uncharacterized protein n=1 Tax=Babesia bovis
           RepID=A7ASN3_BABBO
          Length = 301

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 2/73 (2%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKE--CVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           E+YG++ S    +A    ++  G++  CV+CLT  KDT VMPCRH+CLC +CA  +  + 
Sbjct: 220 EVYGLNTSALNSSAPGDSDEDIGRQRRCVVCLTNMKDTVVMPCRHMCLCHECASYMVSEH 279

Query: 396 NKCPICRQPIHEL 358
             CP+CR  I  +
Sbjct: 280 QFCPMCRSAISHI 292

[173][TOP]
>UniRef100_Q4D0Q6 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi
           RepID=Q4D0Q6_TRYCR
          Length = 363

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -2

Query: 495 CVICLTEPKDTAVMPCRHLCLCSDCAEELRF-QTNKCPICRQPIHELVKI 349
           CVICL  PKDT ++PCRH+CLC +CA  LRF Q N+CP+CR  I  ++ +
Sbjct: 314 CVICLLNPKDTTLLPCRHMCLCYECASILRFQQNNRCPVCRSNIDRVMTL 363

[174][TOP]
>UniRef100_C5LN27 Mahogunin, putative n=1 Tax=Perkinsus marinus ATCC 50983
           RepID=C5LN27_9ALVE
          Length = 469

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 5/65 (7%)
 Frame = -2

Query: 513 DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELR-----FQTNKCPICRQPIHELVKI 349
           D    ECVICL+E + T V+PCRH+CLC+DCA  ++       + KCPICRQP+  +++I
Sbjct: 397 DAMASECVICLSEARTTVVLPCRHMCLCNDCAVRVQEANPGHVSAKCPICRQPVTSMLQI 456

Query: 348 KVESS 334
               S
Sbjct: 457 AASPS 461

[175][TOP]
>UniRef100_C5LN26 Mahogunin, putative n=1 Tax=Perkinsus marinus ATCC 50983
           RepID=C5LN26_9ALVE
          Length = 434

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 5/65 (7%)
 Frame = -2

Query: 513 DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELR-----FQTNKCPICRQPIHELVKI 349
           D    ECVICL+E + T V+PCRH+CLC+DCA  ++       + KCPICRQP+  +++I
Sbjct: 362 DAMASECVICLSEARTTVVLPCRHMCLCNDCAVRVQEANPGHVSAKCPICRQPVTSMLQI 421

Query: 348 KVESS 334
               S
Sbjct: 422 AASPS 426

[176][TOP]
>UniRef100_B0ENK6 Putative uncharacterized protein n=1 Tax=Entamoeba dispar SAW760
           RepID=B0ENK6_ENTDI
          Length = 240

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 28/78 (35%), Positives = 48/78 (61%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           +++G+DN+   GT            CVIC T+P++  ++PCRH+ +C+ C EE++ +T++
Sbjct: 156 DVFGVDNNDVTGT---------DNLCVICTTDPREILLLPCRHITMCAGCYEEVKERTHQ 206

Query: 390 CPICRQPIHELVKIKVES 337
           CPICR PI   +    +S
Sbjct: 207 CPICRTPITAAINFSRKS 224

[177][TOP]
>UniRef100_B6AAH4 Zinc finger, C3HC4 type domain-containing protein n=1
           Tax=Cryptosporidium muris RN66 RepID=B6AAH4_9CRYT
          Length = 305

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 32/83 (38%), Positives = 48/83 (57%), Gaps = 2/83 (2%)
 Frame = -2

Query: 570 ELYGID--NSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT 397
           +LYG++  NS       S  + +    CVICLT PK T ++PCRH CLC +C   L  + 
Sbjct: 223 DLYGLNITNSSINEQNKSNDKYSQDDLCVICLTNPKQTILLPCRHACLCIECTSNLLARK 282

Query: 396 NKCPICRQPIHELVKIKVESSDE 328
             CP+CRQ +  LV I+  ++++
Sbjct: 283 ISCPVCRQCVSGLVNIENNTNNQ 305

[178][TOP]
>UniRef100_Q4UIV4 Putative uncharacterized protein n=1 Tax=Theileria annulata
           RepID=Q4UIV4_THEAN
          Length = 289

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YG++ S  +       +D   + C ICL  P +T ++PC H+CLCSDC++ +  Q   
Sbjct: 214 EVYGLNES--EYGIKKDQKDERIRNCAICLETPSNTILLPCSHICLCSDCSKTVSIQFGA 271

Query: 390 CPICRQPIHELVKIKVES 337
           CP+CR  +++++ I  +S
Sbjct: 272 CPMCRSVVNQILHINQQS 289

[179][TOP]
>UniRef100_C4M9D6 Putative uncharacterized protein n=1 Tax=Entamoeba histolytica
           HM-1:IMSS RepID=C4M9D6_ENTHI
          Length = 240

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           +++G+D+    GT            CVIC T+P++  ++PCRH+ +C+ C EE++ +T++
Sbjct: 156 DVFGVDSDDVTGT---------DNLCVICTTDPREILLLPCRHITMCAGCYEEVKERTHQ 206

Query: 390 CPICRQPIHELVKIKVES 337
           CPICR PI   +    +S
Sbjct: 207 CPICRTPITAAINFSRKS 224

[180][TOP]
>UniRef100_C6LN18 Zinc finger domain-containing protein n=1 Tax=Giardia intestinalis
           ATCC 50581 RepID=C6LN18_GIALA
          Length = 277

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 28/73 (38%), Positives = 41/73 (56%)
 Frame = -2

Query: 549 SITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQP 370
           S T G+A S         CVIC+ +   + ++PCRH+CLC  CA E R +  +CP+CR  
Sbjct: 181 SETPGSATSTAAPNANAPCVICMGKRCSSILLPCRHMCLCRSCALEFRRKATQCPLCRAE 240

Query: 369 IHELVKIKVESSD 331
           +  L+ I   SS+
Sbjct: 241 VSSLIDISDISSE 253

[181][TOP]
>UniRef100_B3NLZ0 GG21247 n=1 Tax=Drosophila erecta RepID=B3NLZ0_DROER
          Length = 274

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 23/54 (42%), Positives = 39/54 (72%), Gaps = 1/54 (1%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEEL-RFQTNKCPICRQPIHELVKIKV 343
           + CV+C+T+ ++  VMPCRHLCLC +C+++L R   ++CP+CR  I   +++ V
Sbjct: 221 ERCVVCMTQSRNVVVMPCRHLCLCKECSQQLQRLLDDRCPVCRHNITSFLQVYV 274

[182][TOP]
>UniRef100_Q5CUW2 RING domain protein n=1 Tax=Cryptosporidium parvum Iowa II
           RepID=Q5CUW2_CRYPV
          Length = 266

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 27/74 (36%), Positives = 43/74 (58%)
 Frame = -2

Query: 567 LYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKC 388
           ++G+ N  ++ +      D   ++CVICLT  ++T ++PCRH CLC  C+  L   T  C
Sbjct: 194 IFGLSNKSSKASK----NDEDSEKCVICLTNNRETILLPCRHACLCKICSNTLFKNTQDC 249

Query: 387 PICRQPIHELVKIK 346
           PICR  +  +V I+
Sbjct: 250 PICRNSVLGVVNIE 263

[183][TOP]
>UniRef100_Q5CL02 B1045D11.20 n=1 Tax=Cryptosporidium hominis RepID=Q5CL02_CRYHO
          Length = 266

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 27/74 (36%), Positives = 43/74 (58%)
 Frame = -2

Query: 567 LYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKC 388
           ++G+ N  ++ +      D   ++CVICLT  ++T ++PCRH CLC  C+  L   T  C
Sbjct: 194 IFGLSNKSSKASK----NDEDSEKCVICLTNNRETILLPCRHACLCKICSNTLFKNTRDC 249

Query: 387 PICRQPIHELVKIK 346
           PICR  +  +V I+
Sbjct: 250 PICRNSVLGVVNIE 263

[184][TOP]
>UniRef100_A0DHV7 Chromosome undetermined scaffold_504, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0DHV7_PARTE
          Length = 315

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 34/92 (36%), Positives = 50/92 (54%), Gaps = 17/92 (18%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCA-------EE 412
           E+YGI++S   G+     +D    EC+ICL+E  +T +MPCRH+CLC +CA       E+
Sbjct: 224 EIYGINDSNLIGSMKHDQDDG---ECIICLSEKINTIIMPCRHMCLCGNCAKQIMDKKEQ 280

Query: 411 LRFQT----------NKCPICRQPIHELVKIK 346
           LR +           N CP CR  I   +K++
Sbjct: 281 LRHEPAERQQHAPDYNLCPQCRMEIDSFIKLQ 312

[185][TOP]
>UniRef100_A0C478 Chromosome undetermined scaffold_149, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0C478_PARTE
          Length = 306

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKE-CVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN 394
           ++YG+++S+       G +D   KE C ICLT   DT + PC+H+ LC +C + LR    
Sbjct: 234 DVYGMNDSVL------GKKDDNEKEPCRICLTNIIDTMIQPCQHVILCQECCQNLRMTGQ 287

Query: 393 KCPICRQPIHELVKI 349
           +CPICR  I E + I
Sbjct: 288 RCPICRSEIKEFIII 302

[186][TOP]
>UniRef100_UPI0001A2C9E5 hypothetical protein LOC767739 n=1 Tax=Danio rerio
           RepID=UPI0001A2C9E5
          Length = 498

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 1/53 (1%)
 Frame = -2

Query: 504 GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN-KCPICRQPIHELVKI 349
           G+EC+IC   P D+ +  C H+C+CSDC  +L   +N  CP+CR PI +++KI
Sbjct: 442 GEECLICCDRPVDSVLYACGHMCVCSDCGVKLTETSNPSCPVCRSPIRDIIKI 494

[187][TOP]
>UniRef100_Q08CE8 Zgc:153175 n=1 Tax=Danio rerio RepID=Q08CE8_DANRE
          Length = 498

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 1/53 (1%)
 Frame = -2

Query: 504 GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN-KCPICRQPIHELVKI 349
           G+EC+IC   P D+ +  C H+C+CSDC  +L   +N  CP+CR PI +++KI
Sbjct: 442 GEECLICCDRPVDSVLYACGHMCVCSDCGVKLTETSNPSCPVCRSPIRDIIKI 494

[188][TOP]
>UniRef100_Q4N6R0 Putative uncharacterized protein n=1 Tax=Theileria parva
           RepID=Q4N6R0_THEPA
          Length = 157

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 26/74 (35%), Positives = 44/74 (59%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK 391
           E+YG++ S  +       +D   K C ICL  P +T ++PC H+CLCS+C++ +  Q   
Sbjct: 82  EVYGLNES--EYGIKKDQKDERIKNCAICLETPSNTILLPCSHICLCSECSKTVSIQFGA 139

Query: 390 CPICRQPIHELVKI 349
           CP+CR  + +++ I
Sbjct: 140 CPMCRTVVSQILHI 153

[189][TOP]
>UniRef100_B4KIZ8 GI18251 n=1 Tax=Drosophila mojavensis RepID=B4KIZ8_DROMO
          Length = 290

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%), Gaps = 2/51 (3%)
 Frame = -2

Query: 495 CVICLTEPKDTAVMPCRHLCLCSDCAEEL-RFQT-NKCPICRQPIHELVKI 349
           CV+CL   K+  ++PCRHLCLC +CA++L R ++ ++CP+CR  +H L+ +
Sbjct: 238 CVVCLERNKNIVILPCRHLCLCKECAQQLHRLESGHRCPVCRNDVHTLLPV 288

[190][TOP]
>UniRef100_UPI0001861CF2 hypothetical protein BRAFLDRAFT_214077 n=1 Tax=Branchiostoma
           floridae RepID=UPI0001861CF2
          Length = 62

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 1/59 (1%)
 Frame = -2

Query: 522 GLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT-NKCPICRQPIHELVKI 349
           G    G  +C IC   P D+AV PC H+CLC+ C + L+ Q    CPICR  I +++KI
Sbjct: 1   GTHTAGRSDCTICYDRPTDSAVYPCGHMCLCNKCGQLLKRQRGGMCPICRGAIRDIIKI 59

[191][TOP]
>UniRef100_UPI000186182A hypothetical protein BRAFLDRAFT_214688 n=1 Tax=Branchiostoma
           floridae RepID=UPI000186182A
          Length = 508

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 29/67 (43%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = -2

Query: 546 ITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT-NKCPICRQP 370
           +T GT   G  D     C IC   P D+AV PC H+CLC+ C + L+ Q    CPICR  
Sbjct: 444 VTVGTRTGGRSD-----CTICYDRPTDSAVYPCGHMCLCNKCGQLLKRQRGGMCPICRGA 498

Query: 369 IHELVKI 349
           I +++KI
Sbjct: 499 IRDIIKI 505

[192][TOP]
>UniRef100_C3YRC2 Putative uncharacterized protein (Fragment) n=1 Tax=Branchiostoma
           floridae RepID=C3YRC2_BRAFL
          Length = 508

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 29/67 (43%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = -2

Query: 546 ITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT-NKCPICRQP 370
           +T GT   G  D     C IC   P D+AV PC H+CLC+ C + L+ Q    CPICR  
Sbjct: 444 VTVGTRTGGRSD-----CTICYDRPTDSAVYPCGHMCLCNKCGQLLKRQRGGMCPICRGA 498

Query: 369 IHELVKI 349
           I +++KI
Sbjct: 499 IRDIIKI 505

[193][TOP]
>UniRef100_B3S6I8 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens
           RepID=B3S6I8_TRIAD
          Length = 236

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 22/55 (40%), Positives = 38/55 (69%)
 Frame = -2

Query: 513 DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKI 349
           D   KEC IC+ +P++    PC H+C C DCA+ ++ +++ CPICR+ I E++++
Sbjct: 179 DVKEKECAICMDKPRNCVFRPCNHMCSCIDCAKIVKKRSDGCPICRKRITEVLRV 233

[194][TOP]
>UniRef100_A7S4Z9 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S4Z9_NEMVE
          Length = 310

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 21/50 (42%), Positives = 31/50 (62%)
 Frame = -2

Query: 498 ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKI 349
           ECV+C+   +DT + PC HLC+C  CA  L+     CPICRQ +  ++ +
Sbjct: 258 ECVVCMDNRRDTVLCPCHHLCVCGQCAAALQLNEEPCPICRQAVASVIHV 307

[195][TOP]
>UniRef100_UPI00016E55C1 UPI00016E55C1 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E55C1
          Length = 509

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = -2

Query: 546 ITQGTAASGLEDTGGK-ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK-CPICRQ 373
           I+   + S L   G   EC IC  +  DT +  C H+CLC+DC  +L+ Q N  CPICR+
Sbjct: 439 ISPSVSGSELPPAGKNGECTICFDQEVDTVIYTCGHMCLCNDCGLKLKRQINACCPICRR 498

Query: 372 PIHELVK 352
           PI +++K
Sbjct: 499 PIKDVIK 505

[196][TOP]
>UniRef100_UPI00016E55C0 UPI00016E55C0 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E55C0
          Length = 511

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = -2

Query: 546 ITQGTAASGLEDTGGK-ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK-CPICRQ 373
           I+   + S L   G   EC IC  +  DT +  C H+CLC+DC  +L+ Q N  CPICR+
Sbjct: 441 ISPSVSGSELPPAGKNGECTICFDQEVDTVIYTCGHMCLCNDCGLKLKRQINACCPICRR 500

Query: 372 PIHELVK 352
           PI +++K
Sbjct: 501 PIKDVIK 507

[197][TOP]
>UniRef100_UPI00016E55BF UPI00016E55BF related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E55BF
          Length = 536

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = -2

Query: 546 ITQGTAASGLEDTGGK-ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK-CPICRQ 373
           I+   + S L   G   EC IC  +  DT +  C H+CLC+DC  +L+ Q N  CPICR+
Sbjct: 466 ISPSVSGSELPPAGKNGECTICFDQEVDTVIYTCGHMCLCNDCGLKLKRQINACCPICRR 525

Query: 372 PIHELVK 352
           PI +++K
Sbjct: 526 PIKDVIK 532

[198][TOP]
>UniRef100_UPI00016E55A3 UPI00016E55A3 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E55A3
          Length = 532

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = -2

Query: 546 ITQGTAASGLEDTGGK-ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK-CPICRQ 373
           I+   + S L   G   EC IC  +  DT +  C H+CLC+DC  +L+ Q N  CPICR+
Sbjct: 462 ISPSVSGSELPPAGKNGECTICFDQEVDTVIYTCGHMCLCNDCGLKLKRQINACCPICRR 521

Query: 372 PIHELVK 352
           PI +++K
Sbjct: 522 PIKDVIK 528

[199][TOP]
>UniRef100_C1BQT4 Cell growth regulator with RING finger domain protein 1 n=1
           Tax=Caligus rogercresseyi RepID=C1BQT4_9MAXI
          Length = 288

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 26/62 (41%), Positives = 39/62 (62%)
 Frame = -2

Query: 516 EDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKVES 337
           +D+G  ECV+C  +P   A +PCRH C CSDC + ++   NKCP+CR  IH    ++ E+
Sbjct: 224 QDSG--ECVVCQEKPVSRAFLPCRHACSCSDCFQRIK---NKCPMCRTFIHSFFLVEDEA 278

Query: 336 SD 331
            +
Sbjct: 279 GE 280

[200][TOP]
>UniRef100_A8B1R0 Zinc finger domain n=1 Tax=Giardia lamblia ATCC 50803
           RepID=A8B1R0_GIALA
          Length = 278

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 28/71 (39%), Positives = 41/71 (57%)
 Frame = -2

Query: 543 TQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIH 364
           T  TAAS +       CVIC+ +   + ++PCRH+CLC  CA E R +  +CP+CR  + 
Sbjct: 188 TSTTAASNIN----APCVICMGKRCSSILLPCRHMCLCRSCALEFRRKATQCPLCRAEVS 243

Query: 363 ELVKIKVESSD 331
            L+ I   SS+
Sbjct: 244 SLIDISDISSE 254

[201][TOP]
>UniRef100_A5K7Q7 Putative uncharacterized protein n=1 Tax=Plasmodium vivax
           RepID=A5K7Q7_PLAVI
          Length = 516

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 27/58 (46%), Positives = 36/58 (62%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKVESSDE 328
           KEC+IC+T  KDT +MPCRH   C DC + LR    KCPICR      +K  +++ D+
Sbjct: 456 KECLICMTSYKDTLLMPCRHSSFCYDCMKSLR--QEKCPICRCLFTSFIKFPLKNVDK 511

[202][TOP]
>UniRef100_UPI00017B3FA2 UPI00017B3FA2 related cluster n=1 Tax=Tetraodon nigroviridis
           RepID=UPI00017B3FA2
          Length = 529

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query: 498 ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK-CPICRQPIHELVK 352
           EC IC  +  DT +  C H+CLC+DC  +L+ Q N  CPICR+PI +++K
Sbjct: 476 ECTICFDQEVDTVIYTCGHMCLCNDCGLKLKRQINACCPICRRPIKDVIK 525

[203][TOP]
>UniRef100_UPI00016E55A2 UPI00016E55A2 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E55A2
          Length = 507

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query: 498 ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK-CPICRQPIHELVK 352
           EC IC  +  DT +  C H+CLC+DC  +L+ Q N  CPICR+PI +++K
Sbjct: 454 ECTICFDQEVDTVIYTCGHMCLCNDCGLKLKRQINACCPICRRPIKDVIK 503

[204][TOP]
>UniRef100_B3L442 Binding protein, putative n=1 Tax=Plasmodium knowlesi strain H
           RepID=B3L442_PLAKH
          Length = 514

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 27/57 (47%), Positives = 35/57 (61%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKVESSD 331
           KEC+IC+T  KDT +MPCRH   C DC + LR    KCPICR      +K  +++ D
Sbjct: 454 KECLICMTSYKDTLLMPCRHSSFCYDCMKSLR--QEKCPICRCLFTSFIKFPLKNID 508

[205][TOP]
>UniRef100_UPI0000514E5A PREDICTED: similar to CG1134-PA n=1 Tax=Apis mellifera
           RepID=UPI0000514E5A
          Length = 340

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 21/45 (46%), Positives = 33/45 (73%)
 Frame = -2

Query: 495 CVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHE 361
           CV+C T P++  ++PC H+CLC DC+E++   T+ CP+CR PI +
Sbjct: 292 CVVCRTNPREIILLPCGHVCLCEDCSEDI---TSDCPVCRAPISQ 333

[206][TOP]
>UniRef100_C1BV65 Cell growth regulator with RING finger domain protein 1 n=1
           Tax=Lepeophtheirus salmonis RepID=C1BV65_9MAXI
          Length = 281

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 28/64 (43%), Positives = 37/64 (57%)
 Frame = -2

Query: 516 EDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKVES 337
           +D G  ECV+C   P   A +PCRH C CSDC + ++   NKCP+CR  IH    +  E+
Sbjct: 222 QDNG--ECVVCQENPITRAFLPCRHACSCSDCFKRIK---NKCPMCRTFIHSYFLVGDEA 276

Query: 336 SDEQ 325
           S  Q
Sbjct: 277 SQSQ 280

[207][TOP]
>UniRef100_B4P6L3 GE12341 n=1 Tax=Drosophila yakuba RepID=B4P6L3_DROYA
          Length = 276

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 22/54 (40%), Positives = 38/54 (70%), Gaps = 1/54 (1%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEE-LRFQTNKCPICRQPIHELVKIKV 343
           + CV+C+T+ ++  VMPCRHLCLC +C+++ L    ++CP+CR+ I   + + V
Sbjct: 223 ESCVVCMTQSRNVVVMPCRHLCLCKECSQQLLLLLDDRCPVCRRNITSFLLVYV 276

[208][TOP]
>UniRef100_A7RWB7 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RWB7_NEMVE
          Length = 542

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = -2

Query: 495 CVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK--CPICRQPIHELVK 352
           CVIC  +PK   +MPCRH+CLCS CA+ L    N+  CP+CR  I  L++
Sbjct: 456 CVICAEQPKQILIMPCRHMCLCSVCADTLLTHWNRRACPLCRCRIRSLIE 505

[209][TOP]
>UniRef100_A0C595 Chromosome undetermined scaffold_15, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0C595_PARTE
          Length = 688

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 3/85 (3%)
 Frame = -2

Query: 570 ELYGIDNS-ITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRF--Q 400
           ELYG+ N+        + +ED   KECVIC     +T ++PC+H+C CS CA+ +    +
Sbjct: 174 ELYGVQNTPFNPEWNPNTIED---KECVICFCNMINTVLLPCKHMCTCSTCADHILMSQK 230

Query: 399 TNKCPICRQPIHELVKIKVESSDEQ 325
             +CP+CR  I   + ++++   +Q
Sbjct: 231 VKQCPLCRIDIDNYLTLEIKDKQKQ 255

[210][TOP]
>UniRef100_Q9YKL5 Apoptosis inhibitor iap-1 n=1 Tax=Epiphyas postvittana NPV
           RepID=Q9YKL5_NPVEP
          Length = 284

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 26/52 (50%), Positives = 32/52 (61%)
 Frame = -2

Query: 498 ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKV 343
           EC ICL   +DT ++PCRH C+C  C   L    NKCP CRQ + + VKI V
Sbjct: 235 ECKICLERQRDTVLLPCRHFCVCMQCYFAL---DNKCPTCRQDVTDFVKIFV 283

[211][TOP]
>UniRef100_O77387 Binding protein, putative n=1 Tax=Plasmodium falciparum 3D7
           RepID=O77387_PLAF7
          Length = 600

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 26/55 (47%), Positives = 34/55 (61%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKVES 337
           KEC+IC+T  KDT +MPCRH   C DC + LR    KCPICR      +K  +++
Sbjct: 542 KECLICMTSYKDTLLMPCRHSSFCYDCMKSLR--QEKCPICRCLFTSFIKFPLKN 594

[212][TOP]
>UniRef100_A0CRM9 Chromosome undetermined scaffold_25, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0CRM9_PARTE
          Length = 669

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 28/85 (32%), Positives = 49/85 (57%), Gaps = 3/85 (3%)
 Frame = -2

Query: 570 ELYGIDNSITQGT-AASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRF--Q 400
           ELYG+ N++       + +ED   KECVIC     +T ++PC+H+C CS CA+ +    +
Sbjct: 192 ELYGVQNTLFNPEWNPNTIED---KECVICFYNMINTVLLPCKHMCTCSVCADHIIMSQK 248

Query: 399 TNKCPICRQPIHELVKIKVESSDEQ 325
             +CP+CR  I+  + ++++    Q
Sbjct: 249 IKQCPLCRIDINNYLALEIKDKQRQ 273

[213][TOP]
>UniRef100_Q0MW30 E3 ubiquitin-protein ligase NEURL1B n=2 Tax=Mus musculus
           RepID=NEU1B_MOUSE
          Length = 546

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 28/64 (43%), Positives = 36/64 (56%), Gaps = 3/64 (4%)
 Frame = -2

Query: 531 AASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK-CPICRQPIHE 361
           A S  E TG +  EC +C     DT +  C H+CLC  C   LR Q    CPICR+PI +
Sbjct: 480 AFSAPEPTGSRNGECTVCFDSEVDTVIYTCGHMCLCHGCGLRLRRQARACCPICRRPIKD 539

Query: 360 LVKI 349
           ++KI
Sbjct: 540 VIKI 543

[214][TOP]
>UniRef100_Q1HGY7 Iap-1 n=1 Tax=Antheraea pernyi nucleopolyhedrovirus
           RepID=Q1HGY7_NPVAP
          Length = 280

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 26/64 (40%), Positives = 36/64 (56%)
 Frame = -2

Query: 534 TAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELV 355
           +AA+    +   EC +CL   +DT +MPCRH C+C  C   L     KCP CRQ + + V
Sbjct: 219 SAAAPAAASEAMECKVCLERQRDTVLMPCRHFCVCMQCYFAL---DGKCPTCRQDVTDFV 275

Query: 354 KIKV 343
           K+ V
Sbjct: 276 KVFV 279

[215][TOP]
>UniRef100_A8C6B1 Inhibitor of apoptosis protein 1 n=1 Tax=Antheraea pernyi
           nucleopolyhedrovirus RepID=A8C6B1_NPVAP
          Length = 280

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 26/64 (40%), Positives = 36/64 (56%)
 Frame = -2

Query: 534 TAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELV 355
           +AA+    +   EC +CL   +DT +MPCRH C+C  C   L     KCP CRQ + + V
Sbjct: 219 SAAAPAAASEAMECKVCLERQRDTVLMPCRHFCVCMQCYFAL---DGKCPTCRQDVADFV 275

Query: 354 KIKV 343
           K+ V
Sbjct: 276 KVFV 279

[216][TOP]
>UniRef100_UPI0001623AB7 predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=UPI0001623AB7
          Length = 524

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKI 349
           + C ICL  PKD+   PC H C C  C   +R  +N+CPICRQ I  + +I
Sbjct: 471 RHCTICLDAPKDSFFDPCGHRCTCYSCGMRIRGDSNRCPICRQTIRTVRRI 521

[217][TOP]
>UniRef100_Q4N6Z8 Zinc finger protein, putative n=1 Tax=Theileria parva
           RepID=Q4N6Z8_THEPA
          Length = 435

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 25/62 (40%), Positives = 36/62 (58%)
 Frame = -2

Query: 522 GLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKV 343
           G+ D   KEC+IC+    DT ++PC H   CS C   LR   +KCP+CR+  +  VK  +
Sbjct: 373 GMGDVKDKECLICIANDMDTVLLPCGHGSFCSRCLFSLR--NDKCPVCRRSFYSYVKFPL 430

Query: 342 ES 337
           +S
Sbjct: 431 KS 432

[218][TOP]
>UniRef100_B3MJU2 GF15350 n=1 Tax=Drosophila ananassae RepID=B3MJU2_DROAN
          Length = 273

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = -2

Query: 495 CVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTN-KCPICRQPIHELVKIKV 343
           CV+CL   ++  +MPCRHLCLC +C+++L+     +CP+CR  I   + + V
Sbjct: 222 CVVCLERSRNIVIMPCRHLCLCKECSQQLQMHLQYRCPVCRDNIISFLPVYV 273

[219][TOP]
>UniRef100_A4H9Q8 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis
           RepID=A4H9Q8_LEIBR
          Length = 155

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 24/45 (53%), Positives = 28/45 (62%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPI 367
           ++CVICL   KDT  +PCRHLC C  CA   R   N CP CR P+
Sbjct: 104 EQCVICLENCKDTVFLPCRHLCTCWSCAS--RIGNNSCPTCRAPL 146

[220][TOP]
>UniRef100_Q7TLV1 Inhibitor of apoptosis 1 n=1 Tax=Choristoneura fumiferana MNPV
           RepID=Q7TLV1_NPVCF
          Length = 276

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 23/52 (44%), Positives = 32/52 (61%)
 Frame = -2

Query: 498 ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKV 343
           EC +CL  P+D  ++PCRH C+C  C   L    +KCP CRQ + + +KI V
Sbjct: 227 ECKVCLERPRDAVLLPCRHFCVCMQCYFGL---DSKCPTCRQDVADFIKIFV 275

[221][TOP]
>UniRef100_C9DQJ9 Neuralized 2 n=1 Tax=Rattus norvegicus RepID=C9DQJ9_RAT
          Length = 546

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 27/64 (42%), Positives = 35/64 (54%), Gaps = 3/64 (4%)
 Frame = -2

Query: 531 AASGLEDTGGK--ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK-CPICRQPIHE 361
           A S  E  G +  EC +C     DT +  C H+CLC  C   LR Q    CPICR+PI +
Sbjct: 480 AFSAPEPAGSRNGECTVCFDSEVDTVIYTCGHMCLCHSCGLRLRRQARACCPICRRPIKD 539

Query: 360 LVKI 349
           ++KI
Sbjct: 540 VIKI 543

[222][TOP]
>UniRef100_B9MVY1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MVY1_POPTR
          Length = 86

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 2/74 (2%)
 Frame = -2

Query: 564 YGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK- 391
           YG +    +G++ S  ED    K CVIC  + ++   +PC H   C DCA+ +  + NK 
Sbjct: 10  YGTNEEDDEGSSCSSSEDLYDAKLCVICYDDQRNCFFVPCGHCATCYDCAQRIMEEDNKM 69

Query: 390 CPICRQPIHELVKI 349
           CPICR+ IH++ ++
Sbjct: 70  CPICRRLIHKVRRL 83

[223][TOP]
>UniRef100_B9MVX8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MVX8_POPTR
          Length = 386

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 2/74 (2%)
 Frame = -2

Query: 564 YGIDNSITQGTAASGLEDT-GGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNK- 391
           YG +    +G++ S  ED    K CVIC  + ++   +PC H   C DCA+ +  + NK 
Sbjct: 310 YGTNEEDDEGSSCSSSEDLYDAKLCVICYDDQRNCFFVPCGHCATCYDCAQRIMEEDNKM 369

Query: 390 CPICRQPIHELVKI 349
           CPICR+ IH++ ++
Sbjct: 370 CPICRRLIHKVRRL 383

[224][TOP]
>UniRef100_B4Q3G4 GD24275 n=1 Tax=Drosophila simulans RepID=B4Q3G4_DROSI
          Length = 267

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = -2

Query: 495 CVICLTEPKDTAVMPCRHLCLCSDCAEELR-FQTNKCPICRQPIHELVKIKV 343
           CV+C+ + ++  VMPCRHLCLC +C+ +L     ++CP+CR  I   + + V
Sbjct: 216 CVVCMAQSRNVVVMPCRHLCLCKECSTQLMLLLEDRCPVCRHNITSFLSVYV 267

[225][TOP]
>UniRef100_B4LV95 GJ22999 n=1 Tax=Drosophila virilis RepID=B4LV95_DROVI
          Length = 290

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)
 Frame = -2

Query: 495 CVICLTEPKDTAVMPCRHLCLCSDCAEELRF--QTNKCPICRQPIHELVKI 349
           CV+CL   ++  V+PCRH CLC +C+++LR     N+CP+CR  +  L+ +
Sbjct: 238 CVVCLERNRNIVVLPCRHFCLCKECSQQLRHFEGGNRCPLCRHNVDTLMPV 288

[226][TOP]
>UniRef100_B4IFE7 GM23364 n=1 Tax=Drosophila sechellia RepID=B4IFE7_DROSE
          Length = 271

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 21/54 (38%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELR-FQTNKCPICRQPIHELVKIKV 343
           + CV+C+ + ++  VMPCRHLCLC +C+ +L     ++CP+CR  I   + + V
Sbjct: 218 ESCVVCMAQSRNVVVMPCRHLCLCKECSMQLMLLLEDRCPVCRHNITSFLSVYV 271

[227][TOP]
>UniRef100_B3RN49 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens
           RepID=B3RN49_TRIAD
          Length = 673

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 5/56 (8%)
 Frame = -2

Query: 570 ELYGIDNSITQ-----GTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCA 418
           E+YGI+N   +     G A     D    +CV+CL++ ++T ++PCRHLCLCS+CA
Sbjct: 249 EIYGIENKNIREDEETGDATGDQIDDASDDCVVCLSKKRNTIILPCRHLCLCSECA 304

[228][TOP]
>UniRef100_A0C829 Chromosome undetermined scaffold_157, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0C829_PARTE
          Length = 342

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 23/55 (41%), Positives = 37/55 (67%)
 Frame = -2

Query: 513 DTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKI 349
           D+  +ECV+C++   D+ +MPC+H+C+C+ C + L F    CPICR+ I +  KI
Sbjct: 289 DSKYRECVVCVSHLADSILMPCKHVCVCNSCLQGLTF----CPICRRDIKDRFKI 339

[229][TOP]
>UniRef100_UPI000186F1E7 conserved hypothetical protein n=1 Tax=Pediculus humanus corporis
           RepID=UPI000186F1E7
          Length = 342

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 21/45 (46%), Positives = 32/45 (71%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPI 367
           K CV+C + PK+  ++PC H+CLC DC+E++   TN CP+C+  I
Sbjct: 292 KLCVVCQSNPKEVILLPCGHVCLCEDCSEQI---TNFCPVCKSLI 333

[230][TOP]
>UniRef100_Q6VTV3 Inhibitor of apoptosis protein 1 n=1 Tax=Choristoneura fumiferana
           DEF MNPV RepID=Q6VTV3_NPVCD
          Length = 282

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 25/52 (48%), Positives = 31/52 (59%)
 Frame = -2

Query: 498 ECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKV 343
           EC ICL   +DT ++PCRH C+C  C   L     KCP CRQ + + VKI V
Sbjct: 233 ECKICLERQRDTVLLPCRHFCVCMQCYFAL---DGKCPACRQDVTDFVKIFV 281

[231][TOP]
>UniRef100_Q9FIZ4 Genomic DNA, chromosome 5, TAC clone:K23L20 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FIZ4_ARATH
          Length = 684

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 24/61 (39%), Positives = 36/61 (59%)
 Frame = -2

Query: 519 LEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKVE 340
           L D+  + C IC   P D+ +  C H+C C  CA EL++   KCPIC  PI ++V+  ++
Sbjct: 624 LSDSLERNCSICFEMPIDSLLYRCGHMCTCLKCAHELQWSNMKCPICMAPIVDVVRAFLD 683

Query: 339 S 337
           S
Sbjct: 684 S 684

[232][TOP]
>UniRef100_Q4XA46 Putative uncharacterized protein (Fragment) n=1 Tax=Plasmodium
           chabaudi RepID=Q4XA46_PLACH
          Length = 154

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKVES 337
           KEC+IC+   KDT +MPCRH   C DC + LR    KCPICR      +K  +++
Sbjct: 99  KECLICMASYKDTLLMPCRHSSFCYDCMKSLR--QEKCPICRCLFTSFIKFPLKN 151

[233][TOP]
>UniRef100_C5L3T8 Copine, putative n=1 Tax=Perkinsus marinus ATCC 50983
           RepID=C5L3T8_9ALVE
          Length = 449

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 23/69 (33%), Positives = 37/69 (53%)
 Frame = -2

Query: 558 IDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPIC 379
           ID  + +   A     T    C +C     +T ++PC+H C+C DCA  +R  + KCP+C
Sbjct: 377 IDGDLIRDAPAPVWIRTESGMCKVCFENTTNTTLLPCKHQCMCFDCATGVRDSSGKCPLC 436

Query: 378 RQPIHELVK 352
           RQ I  +++
Sbjct: 437 RQDIDAVIE 445

[234][TOP]
>UniRef100_A0CYH5 Chromosome undetermined scaffold_31, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0CYH5_PARTE
          Length = 705

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 3/85 (3%)
 Frame = -2

Query: 570 ELYGIDNS-ITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRF--Q 400
           ELYG+ N+        + +ED   KECVIC     +T ++PC+H+C CS CA+ +    +
Sbjct: 192 ELYGVKNTPFNPEWNPNTIED---KECVICFCNIINTVLLPCKHMCTCSICADHILMSQK 248

Query: 399 TNKCPICRQPIHELVKIKVESSDEQ 325
             +CP+CR  I   + ++++   +Q
Sbjct: 249 VKQCPLCRIDIDNYLTLEIKDKVKQ 273

[235][TOP]
>UniRef100_UPI0000E8160A PREDICTED: similar to Ring finger protein 26 n=1 Tax=Gallus gallus
           RepID=UPI0000E8160A
          Length = 441

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 3/54 (5%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT---NKCPICRQPIHELVKI 349
           K+CVIC  + K   ++PCRHLCLC +C E L  Q      CP+CRQ I + + +
Sbjct: 386 KKCVICQDQTKTVLLLPCRHLCLCQECTEVLLQQAIYQRNCPLCRQMILQTLNV 439

[236][TOP]
>UniRef100_UPI0000ECA222 RING finger protein 26. n=1 Tax=Gallus gallus RepID=UPI0000ECA222
          Length = 433

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 3/54 (5%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQT---NKCPICRQPIHELVKI 349
           K+CVIC  + K   ++PCRHLCLC +C E L  Q      CP+CRQ I + + +
Sbjct: 378 KKCVICQDQTKTVLLLPCRHLCLCQECTEVLLQQAIYQRNCPLCRQMILQTLNV 431

[237][TOP]
>UniRef100_Q0VFN3 Putative uncharacterized protein MGC145700 n=1 Tax=Xenopus
           (Silurana) tropicalis RepID=Q0VFN3_XENTR
          Length = 444

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 3/56 (5%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQ---TNKCPICRQPIHELVKIKV 343
           K+CVIC  E K   ++PCRHLCLC+ C E L  Q      CP+CRQ I + + + +
Sbjct: 389 KKCVICQDENKTVLLLPCRHLCLCASCTEILLQQPVHQRNCPLCRQMILQTLNVYI 444

[238][TOP]
>UniRef100_B9NBW1 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9NBW1_POPTR
          Length = 444

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 22/56 (39%), Positives = 35/56 (62%)
 Frame = -2

Query: 516 EDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKI 349
           ED G   CVICL  P + A +PC H+  C  C +E++ +   CP+CR  I+++V++
Sbjct: 386 EDGGSSSCVICLDAPVEGACIPCGHMVGCMSCLKEIKAKKWGCPVCRATINQVVRL 441

[239][TOP]
>UniRef100_Q9VIK5 CG2617 n=1 Tax=Drosophila melanogaster RepID=Q9VIK5_DROME
          Length = 274

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 21/54 (38%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEEL-RFQTNKCPICRQPIHELVKIKV 343
           + CV+C+ + ++  VMPCRHLCLC +C+ +L     ++CP+CR  I   + + V
Sbjct: 221 ERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSVYV 274

[240][TOP]
>UniRef100_Q4UIL4 Putative uncharacterized protein n=1 Tax=Theileria annulata
           RepID=Q4UIL4_THEAN
          Length = 434

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 24/62 (38%), Positives = 36/62 (58%)
 Frame = -2

Query: 522 GLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKV 343
           G+ D   KEC+IC+    DT ++PC H   CS C   LR   +KCP+CR+  +  VK  +
Sbjct: 373 GMGDVKDKECLICIANDMDTVLLPCGHGSFCSRCLYSLR--NDKCPVCRRNFYSYVKFPL 430

Query: 342 ES 337
           ++
Sbjct: 431 KA 432

[241][TOP]
>UniRef100_Q4QDN2 Putative uncharacterized protein n=1 Tax=Leishmania major
           RepID=Q4QDN2_LEIMA
          Length = 154

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 24/48 (50%), Positives = 29/48 (60%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHEL 358
           ++CVICL   KDT  +PCRHLC C  CA   R   + CP CR PI  +
Sbjct: 103 EQCVICLENCKDTVFLPCRHLCTCWSCAS--RIGNSACPTCRAPIEAM 148

[242][TOP]
>UniRef100_A4HY27 Putative uncharacterized protein n=1 Tax=Leishmania infantum
           RepID=A4HY27_LEIIN
          Length = 154

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 24/48 (50%), Positives = 29/48 (60%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHEL 358
           ++CVICL   KDT  +PCRHLC C  CA   R   + CP CR PI  +
Sbjct: 103 EQCVICLENCKDTVFLPCRHLCTCWSCAS--RIGNSACPTCRAPIQAM 148

[243][TOP]
>UniRef100_UPI000194DE1F PREDICTED: similar to ring finger protein 26 n=1 Tax=Taeniopygia
           guttata RepID=UPI000194DE1F
          Length = 236

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 3/54 (5%)
 Frame = -2

Query: 501 KECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQ---TNKCPICRQPIHELVKI 349
           K+CVIC  + K   ++PCRHLCLC +C E L  Q      CP+CRQ I + + +
Sbjct: 181 KKCVICQDQTKTVLLLPCRHLCLCQECTEVLLQQDIYQRNCPLCRQVILQTLNV 234

[244][TOP]
>UniRef100_C7J344 Os05g0397650 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=C7J344_ORYSJ
          Length = 334

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 27/44 (61%), Positives = 31/44 (70%)
 Frame = -2

Query: 570 ELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHL 439
           E+YGI NS T+       +   GKECVICLTEP+DTAV PCRHL
Sbjct: 276 EIYGIVNS-TEADVPDADDSDMGKECVICLTEPRDTAVFPCRHL 318

[245][TOP]
>UniRef100_Q7JP67 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans
           RepID=Q7JP67_CAEEL
          Length = 617

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = -2

Query: 504 GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVK 352
           G EC IC+  P ++ +  C H+C+C +C   L      CPICR P+ +++K
Sbjct: 563 GDECTICMDAPVNSVLYTCGHMCMCFECGRRLLTTKGTCPICRAPVQDVIK 613

[246][TOP]
>UniRef100_Q7JP66 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans
           RepID=Q7JP66_CAEEL
          Length = 437

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = -2

Query: 504 GKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVK 352
           G EC IC+  P ++ +  C H+C+C +C   L      CPICR P+ +++K
Sbjct: 383 GDECTICMDAPVNSVLYTCGHMCMCFECGRRLLTTKGTCPICRAPVQDVIK 433

[247][TOP]
>UniRef100_B7PKQ1 Putative uncharacterized protein n=1 Tax=Ixodes scapularis
           RepID=B7PKQ1_IXOSC
          Length = 199

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 22/68 (32%), Positives = 38/68 (55%)
 Frame = -2

Query: 552 NSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQ 373
           +++     A  LE    K+CV+C+ E ++  + PC HLC C+ C   L  + + CPICR+
Sbjct: 129 DTLCSALTAEVLETGRDKDCVVCMDEERNCVLHPCHHLCTCAACGRVLLKRQDACPICRR 188

Query: 372 PIHELVKI 349
            I  + ++
Sbjct: 189 HITSIFRV 196

[248][TOP]
>UniRef100_B4MWC3 GK19052 n=1 Tax=Drosophila willistoni RepID=B4MWC3_DROWI
          Length = 276

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%), Gaps = 2/53 (3%)
 Frame = -2

Query: 495 CVICLTEPKDTAVMPCRHLCLCSDCAE--ELRFQTNKCPICRQPIHELVKIKV 343
           CVIC+   ++  ++PCRHLCLC +C++  E RF+ ++CP+CR  I   + + V
Sbjct: 225 CVICMDRNRNIVILPCRHLCLCKECSQQFEQRFE-DRCPVCRNAISSFLPVYV 276

[249][TOP]
>UniRef100_B0WTA2 Putative uncharacterized protein n=1 Tax=Culex quinquefasciatus
           RepID=B0WTA2_CULQU
          Length = 392

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 27/67 (40%), Positives = 36/67 (53%)
 Frame = -2

Query: 543 TQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIH 364
           T+    SGL  + G  C+IC    K   ++PC HLCLC  CA +L      CP+CR  IH
Sbjct: 327 TEKQPGSGLLASIGL-CIICEDNEKSVVLVPCGHLCLCKRCANQLSHYDQYCPLCRMLIH 385

Query: 363 ELVKIKV 343
             V++ V
Sbjct: 386 RKVEVFV 392

[250][TOP]
>UniRef100_A2F2I1 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3
           RepID=A2F2I1_TRIVA
          Length = 231

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 495 CVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKI 349
           C+IC +EP     +PCRH  +C  C+ +    +  CP+CRQP+ EL+ +
Sbjct: 179 CLICFSEPATVISLPCRHCSMCQQCSLKFAAMSTICPVCRQPVTELINV 227