AV537140 ( pAZNII0945R )

[UP]


[1][TOP]
>UniRef100_Q9LNP3 F1L3.32 n=1 Tax=Arabidopsis thaliana RepID=Q9LNP3_ARATH
          Length = 264

 Score =  225 bits (573), Expect = 1e-57
 Identities = 110/110 (100%), Positives = 110/110 (100%)
 Frame = +2

Query: 2   AYRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 181
           AYRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK
Sbjct: 41  AYRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 100

Query: 182 ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDDD 331
           ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDDD
Sbjct: 101 ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDDD 150

[2][TOP]
>UniRef100_Q9FPI2 At1g17620 n=1 Tax=Arabidopsis thaliana RepID=Q9FPI2_ARATH
          Length = 265

 Score =  225 bits (573), Expect = 1e-57
 Identities = 110/110 (100%), Positives = 110/110 (100%)
 Frame = +2

Query: 2   AYRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 181
           AYRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK
Sbjct: 42  AYRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 101

Query: 182 ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDDD 331
           ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDDD
Sbjct: 102 ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDDD 151

[3][TOP]
>UniRef100_A9PI80 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PI80_POPTR
          Length = 266

 Score =  103 bits (256), Expect = 8e-21
 Identities = 48/99 (48%), Positives = 67/99 (67%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKI 184
           YRP   R+R+   R CCC C  WT  VI +L+++   A A++Y++YRP RPSF VS L I
Sbjct: 51  YRPQPNRKRS---RSCCCACVLWTTAVIFILIVLAVIAGAIIYVLYRPHRPSFDVSGLSI 107

Query: 185 STLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITL 301
           S+LN TSA  LTT I+L++ ARNPNK + + Y+   I++
Sbjct: 108 SSLNLTSASHLTTNINLNITARNPNKKLVYTYNPITISV 146

[4][TOP]
>UniRef100_A5B4B6 Chromosome chr9 scaffold_7, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A5B4B6_VITVI
          Length = 253

 Score =  102 bits (255), Expect = 1e-20
 Identities = 51/105 (48%), Positives = 70/105 (66%)
 Frame = +2

Query: 2   AYRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 181
           AYRP   RR    +R  CC CC W  FVI+ +L++ A ASA+ Y++YRP RPSF V+ L+
Sbjct: 40  AYRPQPQRR----SRSRCCSCCLWFTFVILSILVLAAIASAIFYVLYRPHRPSFAVTSLR 95

Query: 182 ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKAST 316
           IS  N T A +LT+ + LS+ ARNPNK + FIYD T ++   +S+
Sbjct: 96  ISQFNVT-ATKLTSKLDLSITARNPNKKLVFIYDPTTVSAATSSS 139

[5][TOP]
>UniRef100_B9SN33 Putative uncharacterized protein n=1 Tax=Ricinus communis
           RepID=B9SN33_RICCO
          Length = 263

 Score =  100 bits (250), Expect = 4e-20
 Identities = 48/109 (44%), Positives = 72/109 (66%)
 Frame = +2

Query: 2   AYRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 181
           AYRP   R+R+   R C C CC W   +I+ L+L+ A A A++Y+IYRP RP+FTVS  K
Sbjct: 45  AYRPQPQRKRSR--RRCFCFCCIWVTIIILTLILLAAIAGAILYVIYRPHRPTFTVSAFK 102

Query: 182 ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDD 328
           +S+LN TS   L+T I++++  +NPNK + +IY+   I++   +T  DD
Sbjct: 103 VSSLNLTSTSHLSTNINMNITTKNPNKKLVYIYNPVTISV---TTAKDD 148

[6][TOP]
>UniRef100_B9N188 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N188_POPTR
          Length = 253

 Score =  100 bits (248), Expect = 7e-20
 Identities = 48/105 (45%), Positives = 66/105 (62%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKI 184
           YRP   R+R+   RGC C C  WT  VI  L+++ A A A++Y++YRP RP+F VS LKI
Sbjct: 38  YRPQLNRKRS---RGCFCSCVLWTAVVIFTLIVLAAIAGAIIYVLYRPHRPTFVVSGLKI 94

Query: 185 STLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTG 319
           S+LN TS   LTT I L++  RNPNK + + Y+   I++     G
Sbjct: 95  SSLNLTSTSHLTTNIDLNITTRNPNKKLVYTYNPITISVTTEKDG 139

[7][TOP]
>UniRef100_C5YUE9 Putative uncharacterized protein Sb09g006180 n=1 Tax=Sorghum
           bicolor RepID=C5YUE9_SORBI
          Length = 299

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/108 (50%), Positives = 70/108 (64%), Gaps = 5/108 (4%)
 Frame = +2

Query: 5   YRP--PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSEL 178
           YRP  PA RRR    R   C C CW +  IILL  + A A    YL+YRPQRPSFTVS +
Sbjct: 48  YRPQAPAKRRRGRSCRCSFCCCFCWALLAIILLAFVAAVAGGAFYLLYRPQRPSFTVSSV 107

Query: 179 KISTLNFTS---AVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKAS 313
           ++++LN TS   A  LT AI+L+V ARNPNK + ++YD  D+T+  A+
Sbjct: 108 RLASLNLTSSPTAPLLTDAITLTVTARNPNKKMVYLYD--DLTVSVAT 153

[8][TOP]
>UniRef100_B9RRR8 Putative uncharacterized protein n=1 Tax=Ricinus communis
           RepID=B9RRR8_RICCO
          Length = 272

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 46/112 (41%), Positives = 70/112 (62%), Gaps = 5/112 (4%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKI 184
           YRP   RRRT   R  CC CC WT+  I+LL+L+ A A A +Y++YRP RP+F++  L+I
Sbjct: 48  YRPQPRRRRTRSGRSICCCCCFWTLLAILLLILLAAIAGAALYILYRPHRPAFSIPSLRI 107

Query: 185 STLNFT-----SAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGD 325
             LN T     S+  ++T ++L++I++NPN ++ F YD     +   S+ GD
Sbjct: 108 HRLNLTTSADSSSSHVSTLLNLTLISKNPNSHLTFFYD--SFAISSLSSDGD 157

[9][TOP]
>UniRef100_B6TX37 NDR1/HIN1-Like protein 2 n=1 Tax=Zea mays RepID=B6TX37_MAIZE
          Length = 294

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/108 (47%), Positives = 71/108 (65%), Gaps = 5/108 (4%)
 Frame = +2

Query: 5   YRP--PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSEL 178
           YRP  PA R+R    R   C C CW + V+ILL  + A    V YL+YRPQRPSF+VS +
Sbjct: 42  YRPQAPAKRQRGRSCRCSLCCCFCWALVVVILLAFVAAVCGGVFYLLYRPQRPSFSVSSV 101

Query: 179 KISTLNFTSAVR---LTTAISLSVIARNPNKNVGFIYDVTDITLYKAS 313
           ++++LN TS+     L+ AI+L+V ARNPNK + ++YD  D+TL  A+
Sbjct: 102 RLASLNLTSSATAPVLSDAITLTVTARNPNKKMVYLYD--DLTLLVAT 147

[10][TOP]
>UniRef100_B4FUU9 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FUU9_MAIZE
          Length = 294

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/108 (47%), Positives = 71/108 (65%), Gaps = 5/108 (4%)
 Frame = +2

Query: 5   YRP--PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSEL 178
           YRP  PA R+R    R   C C CW + V+ILL  + A    V YL+YRPQRPSF+VS +
Sbjct: 42  YRPQAPAKRQRGRSCRCSLCCCFCWALVVVILLAFVAAVCGGVFYLLYRPQRPSFSVSSV 101

Query: 179 KISTLNFTSAVR---LTTAISLSVIARNPNKNVGFIYDVTDITLYKAS 313
           ++++LN TS+     L+ AI+L+V ARNPNK + ++YD  D+TL  A+
Sbjct: 102 RLASLNLTSSATAPVLSDAITLTVTARNPNKKMVYLYD--DLTLLVAT 147

[11][TOP]
>UniRef100_A2Q440 Harpin-induced 1 n=1 Tax=Medicago truncatula RepID=A2Q440_MEDTR
          Length = 260

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 44/99 (44%), Positives = 63/99 (63%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKI 184
           YRP    RRT   R CCC    W   ++++LLL++       YLIYRP RPSFTV+ LK+
Sbjct: 44  YRPQPHHRRTR--RRCCCTFFFWFFLILLILLLLLGVTGTAFYLIYRPHRPSFTVTSLKL 101

Query: 185 STLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITL 301
           S LN TS+  L +  ++++ A+NPNK++ F+Y  T IT+
Sbjct: 102 SYLNLTSSSTLNSKFNVNITAKNPNKHITFVYQPTTITI 140

[12][TOP]
>UniRef100_B9HDM5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HDM5_POPTR
          Length = 276

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 50/114 (43%), Positives = 70/114 (61%), Gaps = 7/114 (6%)
 Frame = +2

Query: 5   YRP-PAGRRRTSHT-RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSEL 178
           YRP P  RR  S + R  CC CC WTI  I+LLLL+ A A A +Y++YRP RPSFT++ L
Sbjct: 47  YRPQPHTRRHRSRSGRNICCCCCFWTILTILLLLLLAAIAGAALYILYRPHRPSFTITSL 106

Query: 179 KISTLNFT-----SAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGD 325
           +I  LN T     S+  L+T  +L++I++NPN ++   Y+    T+   S G D
Sbjct: 107 RIHRLNLTTSPDSSSSHLSTLFNLTIISKNPNSHISLDYE--PFTVSALSDGND 158

[13][TOP]
>UniRef100_A9PC94 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PC94_POPTR
          Length = 276

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 50/114 (43%), Positives = 70/114 (61%), Gaps = 7/114 (6%)
 Frame = +2

Query: 5   YRP-PAGRRRTSHT-RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSEL 178
           YRP P  RR  S + R  CC CC WTI  I+LLLL+ A A A +Y++YRP RPSFT++ L
Sbjct: 47  YRPQPHTRRHRSRSGRNICCCCCFWTILTILLLLLLAAIAGAALYILYRPHRPSFTITSL 106

Query: 179 KISTLNFT-----SAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGD 325
           +I  LN T     S+  L+T  +L++I++NPN ++   Y+    T+   S G D
Sbjct: 107 RIHRLNLTTSPDSSSSHLSTLFNLTIISKNPNSHISLDYE--PFTVSALSDGND 158

[14][TOP]
>UniRef100_Q60E41 cDNA clone:J013170B15, full insert sequence n=2 Tax=Oryza sativa
           RepID=Q60E41_ORYSJ
          Length = 293

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/99 (46%), Positives = 61/99 (61%), Gaps = 6/99 (6%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTRGCCCRCCC---WTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSE 175
           YRP A   +    R C C  CC   W + V+ILL L+ A A    YL+YRP RPSFTVS 
Sbjct: 42  YRPQAAAAKRRRGRSCRCSFCCCFCWALLVVILLALVAAVAGGAFYLLYRPHRPSFTVSS 101

Query: 176 LKISTLNFTS---AVRLTTAISLSVIARNPNKNVGFIYD 283
           +K++ LN +S   +  LT +I L+V A+NPNK V ++YD
Sbjct: 102 VKLTALNLSSSPTSPSLTDSIQLTVTAKNPNKKVVYLYD 140

[15][TOP]
>UniRef100_C5XNS7 Putative uncharacterized protein Sb03g025840 n=1 Tax=Sorghum
           bicolor RepID=C5XNS7_SORBI
          Length = 312

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 47/107 (43%), Positives = 64/107 (59%)
 Frame = +2

Query: 8   RPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS 187
           RPPA R R S  RG CC CC W   V++ L+ + A A+ V Y++YRP+ PSF V+ L+++
Sbjct: 57  RPPARRPRRS-ARGWCCACCLWLTLVLVGLVFLGAIAAGVFYVVYRPRPPSFAVTSLRLA 115

Query: 188 TLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDD 328
            LN + +  LT+ I  +V ARNPN  + F Y   DI    AS  G D
Sbjct: 116 ALNVSDSDALTSRIEFTVTARNPNDKIAFRYG--DIAASFASDDGAD 160

[16][TOP]
>UniRef100_A9PAD0 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PAD0_POPTR
          Length = 276

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/112 (39%), Positives = 67/112 (59%), Gaps = 7/112 (6%)
 Frame = +2

Query: 5   YRP-PAGRRRTSHT-RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSEL 178
           YRP P  RR  S + R  CC CC WTI  I+LLLL+ A A   +Y++YRP RP+FT++ L
Sbjct: 47  YRPQPHTRRHRSRSGRNICCCCCFWTILTILLLLLLAAIAGTALYILYRPHRPTFTITSL 106

Query: 179 KISTLNFTSAV-----RLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTG 319
           +I  LN T++       L+T ++L++I+ NPN ++   Y+   ++      G
Sbjct: 107 RIHRLNLTTSADSSISHLSTLLNLTIISENPNSHISLDYEPFTVSALSDGNG 158

[17][TOP]
>UniRef100_Q2LGZ8 Putative uncharacterized protein (Fragment) n=1 Tax=Triticum
           monococcum RepID=Q2LGZ8_TRIMO
          Length = 245

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/106 (40%), Positives = 65/106 (61%)
 Frame = +2

Query: 8   RPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS 187
           +PP GRRR+   RG CC CC W   V++ L+ + A A  V Y+IY P+ P+F V+ L+++
Sbjct: 49  QPPPGRRRSG--RGWCCACCLWLTLVLVGLVFLGAIALGVFYVIYHPELPTFVVTSLRLA 106

Query: 188 TLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGD 325
            LN + +  +T+ I  +V ARNPN+ + F+Y   DI    A+ G D
Sbjct: 107 ALNVSDSDSVTSRIEFTVTARNPNEKIVFVYG--DIGAAFAADGTD 150

[18][TOP]
>UniRef100_B7ZXT7 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B7ZXT7_MAIZE
          Length = 282

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 46/112 (41%), Positives = 69/112 (61%), Gaps = 9/112 (8%)
 Frame = +2

Query: 5   YRP---PAGRRRTSHTRGC---CCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFT 166
           YRP   PA RRR    R C   CC C CWT+ V++LL ++ A A    YL+YRP RP+FT
Sbjct: 30  YRPQQAPAKRRRGG--RSCPFSCCCCFCWTLLVVVLLAVLAAVAGGAFYLLYRPHRPAFT 87

Query: 167 VSELKISTLNFTS---AVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKAS 313
           ++  +++ L+ +S   A  L+ AI +++ ARNPNK + ++YD   +T   A+
Sbjct: 88  LTAARVTRLSLSSSATAPALSDAIDVTLTARNPNKKLVYVYDDFAVTAATAA 139

[19][TOP]
>UniRef100_Q5TKE5 Putative uncharacterized protein OSJNBa0017O06.4 n=1 Tax=Oryza
           sativa Japonica Group RepID=Q5TKE5_ORYSJ
          Length = 291

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/97 (45%), Positives = 58/97 (59%), Gaps = 4/97 (4%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTRGCCCRCCC---WTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSE 175
           YRP A   +    R C C  CC   W + V+ILL L+ A A    YL+YRP RPSFTVS 
Sbjct: 42  YRPQAAAAKRRRGRSCRCSFCCCFCWALLVVILLALVAAVAGGAFYLLYRPHRPSFTVSS 101

Query: 176 LKISTLNFT-SAVRLTTAISLSVIARNPNKNVGFIYD 283
           L    L+ + ++  LT +I L+V A+NPNK V ++YD
Sbjct: 102 LTALNLSSSPTSPSLTDSIQLTVTAKNPNKKVVYLYD 138

[20][TOP]
>UniRef100_B9I456 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I456_POPTR
          Length = 267

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 34/92 (36%), Positives = 60/92 (65%)
 Frame = +2

Query: 8   RPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS 187
           +PP  RR       CCCR  CWT+ +++LL+L++ A + ++YL+++P+ P F++  L+I+
Sbjct: 68  KPPKKRR------SCCCRFLCWTLSLLLLLILVIGAVAGILYLVFQPKLPKFSIDTLQIT 121

Query: 188 TLNFTSAVRLTTAISLSVIARNPNKNVGFIYD 283
             N T+   L+   ++++ ARNPNK VG  Y+
Sbjct: 122 RFNLTNNSSLSATFNVTITARNPNKKVGVYYE 153

[21][TOP]
>UniRef100_Q8LQJ5 Os01g0574800 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q8LQJ5_ORYSJ
          Length = 291

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 45/112 (40%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = +2

Query: 5   YRP-----PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTV 169
           YRP     PA RRR+   RG CC CC W   V++ L+ + A A+ V Y+ Y PQ P+F V
Sbjct: 57  YRPKPMQAPARRRRSR--RGWCCACCLWMTLVVVGLVFLGAIAAGVFYVAYHPQLPTFAV 114

Query: 170 SELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGD 325
           + L+++ LN + +  +T+ I  +V ARNPN  + F Y   DI    A+ G D
Sbjct: 115 TSLRLAALNVSDSDAVTSRIEFTVTARNPNDKIAFAYG--DIAAAFAADGAD 164

[22][TOP]
>UniRef100_B9N9I0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N9I0_POPTR
          Length = 202

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 32/81 (39%), Positives = 53/81 (65%)
 Frame = +2

Query: 41  TRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLT 220
           TR CCC+C CWT+ +++LLL+IV A + ++YL+++P+ P+++V  L IS L     + L 
Sbjct: 9   TRSCCCKCVCWTVGLLVLLLVIVGATAGILYLVFKPKIPNYSVDSLSISDLRLNFDMSLY 68

Query: 221 TAISLSVIARNPNKNVGFIYD 283
               + + A NPNK +G  Y+
Sbjct: 69  AKFDVKITANNPNKKIGIYYE 89

[23][TOP]
>UniRef100_A2ZUM2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A2ZUM2_ORYSJ
          Length = 291

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 45/112 (40%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = +2

Query: 5   YRP-----PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTV 169
           YRP     PA RRR+   RG CC CC W   V++ L+ + A A+ V Y+ Y PQ P+F V
Sbjct: 57  YRPKPMQAPARRRRSR--RGWCCACCLWMTLVVVGLVFLGAIAAGVFYVAYHPQLPTFAV 114

Query: 170 SELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGD 325
           + L+++ LN + +  +T+ I  +V ARNPN  + F Y   DI    A+ G D
Sbjct: 115 TSLRLAALNVSDSDAVTSRIEFTVTARNPNDKIAFAYG--DIAAAFAADGAD 164

[24][TOP]
>UniRef100_Q9LYI4 Putative uncharacterized protein F14F18_60 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LYI4_ARATH
          Length = 287

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 42/115 (36%), Positives = 67/115 (58%), Gaps = 10/115 (8%)
 Frame = +2

Query: 5   YRPPAGRRRTSHT-----RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTV 169
           YRP    RR  H      R  CC CC W+I +I++L L+ A A+  +Y+IY P+ PSF+V
Sbjct: 58  YRPQPYSRRHHHQSRPSCRRICCCCCFWSILIILILALMTAIAATAMYVIYHPRPPSFSV 117

Query: 170 SELKISTLNFT-----SAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTG 319
             ++IS +N T     S   L++  + ++I+ NPN+++ F YD   +T+  A +G
Sbjct: 118 PSIRISRVNLTTSSDSSVSHLSSFFNFTLISENPNQHLSFSYDPFTVTVNSAKSG 172

[25][TOP]
>UniRef100_B9IDC5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IDC5_POPTR
          Length = 273

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 30/78 (38%), Positives = 53/78 (67%)
 Frame = +2

Query: 50  CCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAI 229
           CCCR  CWT+F++ LL+L++   + ++YL+++P+ P +++  L+I+  N T+   LT   
Sbjct: 82  CCCRFLCWTLFLLFLLILLIGVVAGILYLVFQPKLPKYSIDRLQITQFNLTNNSSLTATF 141

Query: 230 SLSVIARNPNKNVGFIYD 283
            +++ ARNPNK VG  Y+
Sbjct: 142 DVTITARNPNKKVGVYYE 159

[26][TOP]
>UniRef100_B6UHI1 Harpin-induced protein n=1 Tax=Zea mays RepID=B6UHI1_MAIZE
          Length = 284

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 45/112 (40%), Positives = 67/112 (59%), Gaps = 9/112 (8%)
 Frame = +2

Query: 5   YRP---PAGRRRTSHTRGCCCRCCC---WTIFVIILLLLIVAAASAVVYLIYRPQRPSFT 166
           YRP   PA RRR    R C   CCC   WT  V++LL  + A A    YL+YRPQRP+FT
Sbjct: 27  YRPQQAPAKRRRGG--RSCPFSCCCCFFWTALVVLLLAFLAAVAGGAFYLLYRPQRPAFT 84

Query: 167 VSELKISTLNFT---SAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKAS 313
           ++  +++ L+ +   +A  L+ AI +++ ARNPNK + ++YD   +T   A+
Sbjct: 85  LTAARVTRLSLSPSATAPALSDAIDVTLTARNPNKKLAYLYDGFAVTAATAA 136

[27][TOP]
>UniRef100_C5XLW0 Putative uncharacterized protein Sb03g002930 n=1 Tax=Sorghum
           bicolor RepID=C5XLW0_SORBI
          Length = 299

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 45/112 (40%), Positives = 67/112 (59%), Gaps = 9/112 (8%)
 Frame = +2

Query: 5   YRP---PAGRRRTSHTRGCCCRCCC---WTIFVIILLLLIVAAASAVVYLIYRPQRPSFT 166
           YRP   PA RRRT   R C   CCC   WT+ VI+LL  + A      YL+YRP RP+FT
Sbjct: 35  YRPQQAPAKRRRTGG-RSCPFSCCCCFFWTVLVILLLAFLAAVVGGAFYLLYRPHRPAFT 93

Query: 167 VSELKISTLNFTS---AVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKAS 313
           ++  +++ L+ +S   A  L+ AI +++ A+NPNK + ++YD   +T   A+
Sbjct: 94  LTVARVTKLSLSSSATAPALSDAIDVTLTAKNPNKKLVYLYDDFTVTAATAA 145

[28][TOP]
>UniRef100_B9SX36 Putative uncharacterized protein n=1 Tax=Ricinus communis
           RepID=B9SX36_RICCO
          Length = 253

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 28/90 (31%), Positives = 56/90 (62%)
 Frame = +2

Query: 14  PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL 193
           P    +    R CCC+C CWT+ ++++L++++     ++YL++RP+ P F++  L+I+  
Sbjct: 50  PVKHSKPPKKRSCCCKCLCWTLSLLLILIVVIGIIIGILYLVFRPKLPDFSIDRLQITQF 109

Query: 194 NFTSAVRLTTAISLSVIARNPNKNVGFIYD 283
           N +S   L+ A  +++ A NPN+ +G  Y+
Sbjct: 110 NLSSDSSLSAAFDVTITATNPNEKIGIYYE 139

[29][TOP]
>UniRef100_Q8LFZ0 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8LFZ0_ARATH
          Length = 287

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 41/115 (35%), Positives = 66/115 (57%), Gaps = 10/115 (8%)
 Frame = +2

Query: 5   YRPPAGRRRTSHT-----RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTV 169
           YRP    RR  H      R  CC CC W+I +I++L L+ A A+  +Y+IY P+ PSF+V
Sbjct: 58  YRPQPYSRRHHHQSRPSCRRICCCCCFWSILIILILALMTAIAATAMYVIYHPRPPSFSV 117

Query: 170 SELKISTLNFT-----SAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTG 319
             ++IS +N T     S   L++  + ++I+ NPN+++ F YD   + +  A +G
Sbjct: 118 PSIRISRVNLTTSSNSSVSHLSSFFNFTLISENPNQHLSFSYDPFTVIVNSAKSG 172

[30][TOP]
>UniRef100_B6UIQ2 Harpin-induced protein n=1 Tax=Zea mays RepID=B6UIQ2_MAIZE
          Length = 320

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/108 (39%), Positives = 58/108 (53%), Gaps = 2/108 (1%)
 Frame = +2

Query: 8   RPPAGRRRTSHT--RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 181
           RPPA RR       RG CC CC W    +  L L+   A+   Y+ YRP+ P F V+ L+
Sbjct: 57  RPPAPRRHLPRRSGRGWCCACCLWLALALAGLALLGGVAAGAFYVAYRPRPPRFAVTSLR 116

Query: 182 ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGD 325
           ++ LN + +  LT+ +  +V ARNPN N+ F Y   DI    AS G D
Sbjct: 117 LAALNVSDSDALTSRVDFTVTARNPNDNLAFRYG--DIAASFASDGAD 162

[31][TOP]
>UniRef100_B9S0S2 Putative uncharacterized protein n=1 Tax=Ricinus communis
           RepID=B9S0S2_RICCO
          Length = 267

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 33/84 (39%), Positives = 52/84 (61%)
 Frame = +2

Query: 32  TSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAV 211
           T   R C C+C CWTI +I+ LL+I+ A + ++YLI++P+ P ++V  L+IS L     +
Sbjct: 71  TKTARSCFCKCICWTICLILFLLVIIGAIAGILYLIFQPKIPKYSVDSLRISDLRLNFDM 130

Query: 212 RLTTAISLSVIARNPNKNVGFIYD 283
            L    ++ + A NPNK +G  YD
Sbjct: 131 TLYAKFNVKITANNPNKKIGIYYD 154

[32][TOP]
>UniRef100_A7PAX7 Chromosome chr16 scaffold_10, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PAX7_VITVI
          Length = 249

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 31/80 (38%), Positives = 51/80 (63%)
 Frame = +2

Query: 44  RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTT 223
           R CCC+C CWTI +++LLL+IV A + V+YL+++P+ P ++V  L+I+       + L  
Sbjct: 57  RSCCCKCMCWTISLLVLLLVIVGAIAGVLYLVFQPKLPKYSVDSLRITDFQLNYDMTLYA 116

Query: 224 AISLSVIARNPNKNVGFIYD 283
              + + A NPNK +G  Y+
Sbjct: 117 KFDMKIKANNPNKKIGIYYE 136

[33][TOP]
>UniRef100_UPI0001982E98 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982E98
          Length = 265

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 40/107 (37%), Positives = 62/107 (57%), Gaps = 8/107 (7%)
 Frame = +2

Query: 5   YRPPAGRRRTSHT-RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 181
           YRP A RRR   + R  CC C  W + V++LL+L+ A A A +++ YRP  P+F+VS  K
Sbjct: 41  YRPQAHRRRPRRSCRSICCCCFFWFLLVLLLLILLAATAGAALWVFYRPHSPTFSVSTFK 100

Query: 182 ISTLNF-------TSAVRLTTAISLSVIARNPNKNVGFIYDVTDITL 301
            +  N        +S+  L+ A +L++ ARNPNK +   YD   +++
Sbjct: 101 TTQFNLSASSADASSSGHLSAAFNLTIAARNPNKKITIFYDPFTVSI 147

[34][TOP]
>UniRef100_A5AKR1 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5AKR1_VITVI
          Length = 302

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 40/107 (37%), Positives = 62/107 (57%), Gaps = 8/107 (7%)
 Frame = +2

Query: 5   YRPPAGRRRTSHT-RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 181
           YRP A RRR   + R  CC C  W + V++LL+L+ A A A +++ YRP  P+F+VS  K
Sbjct: 78  YRPQAHRRRPRRSCRSICCCCFFWFLLVLLLLILLAATAGAALWVFYRPHSPTFSVSTFK 137

Query: 182 ISTLNF-------TSAVRLTTAISLSVIARNPNKNVGFIYDVTDITL 301
            +  N        +S+  L+ A +L++ ARNPNK +   YD   +++
Sbjct: 138 TTQFNLSASSADASSSGHLSAAFNLTIAARNPNKKITIFYDPFTVSI 184

[35][TOP]
>UniRef100_A2ZQ91 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A2ZQ91_ORYSJ
          Length = 448

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/115 (37%), Positives = 66/115 (57%), Gaps = 8/115 (6%)
 Frame = +2

Query: 5   YRP--PAGRRRTSHTRGCCCRCCC---WTIFVIILLLLIVAAASAVVYLIYRPQRPSFTV 169
           YRP  PA +RR      C   CCC   + + V++LL  + A A    YL+YRP RP+FT+
Sbjct: 35  YRPQAPAAKRRRGGRSSCRFSCCCCFFYAVLVVLLLAFVAAVAGGAFYLLYRPHRPAFTL 94

Query: 170 SELKISTLNFTS---AVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGD 325
           S  ++  L+ +S   A  LT +I + + A+NPNK + ++YD   +T   A+TG +
Sbjct: 95  SVARVDKLSLSSSATAPTLTDSIDVKLTAKNPNKKLVYLYDDFAVT---AATGAN 146

[36][TOP]
>UniRef100_Q5SMX9 Putative uncharacterized protein P0001B06.31 n=1 Tax=Oryza sativa
           Japonica Group RepID=Q5SMX9_ORYSJ
          Length = 288

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 41/111 (36%), Positives = 64/111 (57%), Gaps = 8/111 (7%)
 Frame = +2

Query: 5   YRP--PAGRRRTSHTRGCCCRCCC---WTIFVIILLLLIVAAASAVVYLIYRPQRPSFTV 169
           YRP  PA +RR      C   CCC   + + V++LL  + A A    YL+YRP RP+FT+
Sbjct: 35  YRPQAPAAKRRRGGRSSCRFSCCCCFFYAVLVVLLLAFVAAVAGGAFYLLYRPHRPAFTL 94

Query: 170 SELKISTLNFTS---AVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKAS 313
           S  ++  L+ +S   A  LT +I +++ A+NPNK + ++YD   +T   A+
Sbjct: 95  SVARVDKLSLSSSATAPTLTDSIDVTLTAKNPNKKLVYLYDDFAVTAATAA 145

[37][TOP]
>UniRef100_A2WLN5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2WLN5_ORYSI
          Length = 288

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 41/111 (36%), Positives = 64/111 (57%), Gaps = 8/111 (7%)
 Frame = +2

Query: 5   YRP--PAGRRRTSHTRGCCCRCCC---WTIFVIILLLLIVAAASAVVYLIYRPQRPSFTV 169
           YRP  PA +RR      C   CCC   + + V++LL  + A A    YL+YRP RP+FT+
Sbjct: 35  YRPQAPAAKRRRGGRSSCRFSCCCCFFYAVLVVLLLAFVAAVAGGAFYLLYRPHRPAFTL 94

Query: 170 SELKISTLNFTS---AVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKAS 313
           S  ++  L+ +S   A  LT +I +++ A+NPNK + ++YD   +T   A+
Sbjct: 95  SVARVDKLSLSSSATAPALTDSIDVTLTAKNPNKKLVYLYDDFAVTAATAA 145

[38][TOP]
>UniRef100_UPI0000162753 NHL25 (NDR1/HIN1-LIKE 25) n=1 Tax=Arabidopsis thaliana
           RepID=UPI0000162753
          Length = 248

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 29/86 (33%), Positives = 55/86 (63%)
 Frame = +2

Query: 26  RRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTS 205
           R    +R C CRC C+T+ V+ LL++IV A   ++YL++RP+ P + +  L+++      
Sbjct: 49  REKKGSRSCWCRCVCYTLLVLFLLIVIVGAIVGILYLVFRPKFPDYNIDRLQLTRFQLNQ 108

Query: 206 AVRLTTAISLSVIARNPNKNVGFIYD 283
            + L+TA ++++ A+NPN+ +G  Y+
Sbjct: 109 DLSLSTAFNVTITAKNPNEKIGIYYE 134

[39][TOP]
>UniRef100_Q9FIV4 Gb|AAF23842.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FIV4_ARATH
          Length = 256

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 29/86 (33%), Positives = 55/86 (63%)
 Frame = +2

Query: 26  RRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTS 205
           R    +R C CRC C+T+ V+ LL++IV A   ++YL++RP+ P + +  L+++      
Sbjct: 49  REKKGSRSCWCRCVCYTLLVLFLLIVIVGAIVGILYLVFRPKFPDYNIDRLQLTRFQLNQ 108

Query: 206 AVRLTTAISLSVIARNPNKNVGFIYD 283
            + L+TA ++++ A+NPN+ +G  Y+
Sbjct: 109 DLSLSTAFNVTITAKNPNEKIGIYYE 134

[40][TOP]
>UniRef100_C5YAI6 Putative uncharacterized protein Sb06g032920 n=1 Tax=Sorghum
           bicolor RepID=C5YAI6_SORBI
          Length = 247

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +2

Query: 14  PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL 193
           P  RR+  H+R  CCRC C+T   ++LL++ +   + ++YL++RP+ P+F V  L ++  
Sbjct: 47  PPPRRQRRHSR--CCRCVCYTFLALVLLVVALGVTAGILYLVFRPKIPTFNVDRLTVTRF 104

Query: 194 NF-TSAVRLTTAISLSVIARNPNKNVGFIYDVTDIT 298
           +  T+   +T A  + V A NPN+ +G  YD  D+T
Sbjct: 105 DVNTTTATVTDAFDVDVTATNPNRRIGIYYDGGDVT 140

[41][TOP]
>UniRef100_C0PPD5 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PPD5_MAIZE
          Length = 251

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 38/98 (38%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS- 187
           PP  RR+ S     CCRC C+T+  ++LL + + A + ++YL++RP+ P+F V  L ++ 
Sbjct: 52  PPPSRRKRSR----CCRCVCYTVLALVLLAVALGATAGILYLVFRPKIPTFHVDRLTVTR 107

Query: 188 -TLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDIT 298
             +N TSA  +T A  + V A NPN+ +G  YD  D+T
Sbjct: 108 FDVNGTSAT-VTDAFDVDVTADNPNRRIGIYYDGGDVT 144

[42][TOP]
>UniRef100_A7PTL1 Chromosome undetermined scaffold_30, whole genome shotgun sequence
           n=1 Tax=Vitis vinifera RepID=A7PTL1_VITVI
          Length = 251

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 31/92 (33%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = +2

Query: 44  RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTT 223
           R C C+C CWTI +++LL++I+A   A+++L+++P+ P +++  L+I+ L+  S   L+ 
Sbjct: 59  RSCLCKCFCWTISLLLLLIVIIAIVVAILFLVFKPKLPKYSIDGLRITQLSLGSDDSLSA 118

Query: 224 AISLSVIARNPNKNVGFIYD-VTDITLYKAST 316
              +++ ARNPN  +G  Y+  + IT++   T
Sbjct: 119 TFDVNITARNPNTKIGIYYEGGSSITVFYTGT 150

[43][TOP]
>UniRef100_C6TGS6 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TGS6_SOYBN
          Length = 255

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 30/91 (32%), Positives = 56/91 (61%)
 Frame = +2

Query: 8   RPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS 187
           +PP  +RR+     CCCR  CW I ++++L++ +     ++YL++RP+ P ++V EL+++
Sbjct: 55  KPPPKKRRS-----CCCRFFCWLISILLILIVAIGITVGILYLVFRPKLPKYSVDELRVT 109

Query: 188 TLNFTSAVRLTTAISLSVIARNPNKNVGFIY 280
             +      L+   +L++ ARNPNK +G  Y
Sbjct: 110 HFDLADNNSLSVTFNLTITARNPNKKIGIDY 140

[44][TOP]
>UniRef100_C6TEB3 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TEB3_SOYBN
          Length = 255

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 30/91 (32%), Positives = 56/91 (61%)
 Frame = +2

Query: 8   RPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS 187
           +PP  +RR+     CCCR  CW I ++++L++ +     ++YL++RP+ P ++V EL+++
Sbjct: 55  KPPPKKRRS-----CCCRFFCWLISILLILIVAIGITVGILYLVFRPKLPKYSVDELRVT 109

Query: 188 TLNFTSAVRLTTAISLSVIARNPNKNVGFIY 280
             +      L+   +L++ ARNPNK +G  Y
Sbjct: 110 HFDLADNNSLSVTFNLTITARNPNKKIGIDY 140

[45][TOP]
>UniRef100_Q9SHY5 F1E22.7 n=1 Tax=Arabidopsis thaliana RepID=Q9SHY5_ARATH
          Length = 260

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 30/88 (34%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = +2

Query: 44  RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTT 223
           R CCCRC C+T   ++LL++ V A+  ++YL+++P+ P +++  L+++         LTT
Sbjct: 59  RSCCCRCFCYTFCFLLLLVVAVGASIGILYLVFKPKLPDYSIDRLQLTRFALNQDSSLTT 118

Query: 224 AISLSVIARNPNKNVGFIY-DVTDITLY 304
           A ++++ A+NPN+ +G  Y D + IT++
Sbjct: 119 AFNVTITAKNPNEKIGIYYEDGSKITVW 146

[46][TOP]
>UniRef100_Q8LD98 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8LD98_ARATH
          Length = 252

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 30/88 (34%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = +2

Query: 44  RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTT 223
           R CCCRC C+T   ++LL++ V A+  ++YL+++P+ P +++  L+++         LTT
Sbjct: 59  RSCCCRCFCYTFCFLLLLVVAVGASIGILYLVFKPKLPDYSIDRLQLTRFALNQDSSLTT 118

Query: 224 AISLSVIARNPNKNVGFIY-DVTDITLY 304
           A ++++ A+NPN+ +G  Y D + IT++
Sbjct: 119 AFNVTITAKNPNEKIGIYYEDGSKITVW 146

[47][TOP]
>UniRef100_B9H298 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9H298_POPTR
          Length = 190

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 29/77 (37%), Positives = 50/77 (64%)
 Frame = +2

Query: 53  CCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAIS 232
           CC+C CWT+ +++LLL IV A + ++YL+++P+ P+++V  L+IS L     + L     
Sbjct: 1   CCKCICWTVGLLVLLLGIVGATAGILYLVFKPKIPNYSVDSLRISDLRLNFDMTLYATFD 60

Query: 233 LSVIARNPNKNVGFIYD 283
           + + A NPNK +G  Y+
Sbjct: 61  VKITANNPNKKIGIYYE 77

[48][TOP]
>UniRef100_B8AEX4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AEX4_ORYSI
          Length = 350

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 31/97 (31%), Positives = 58/97 (59%), Gaps = 1/97 (1%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           PP  RRR+   R  CCRC CWT+  +++L + + A + ++Y +++P+ P F V+ L ++ 
Sbjct: 152 PPPPRRRSRGRR--CCRCVCWTLLAVLVLAVALGATAGILYAVFKPKIPDFRVNRLTVTR 209

Query: 191 LNF-TSAVRLTTAISLSVIARNPNKNVGFIYDVTDIT 298
            +   +A  ++ A  + V + NPN+ +G  YD  ++T
Sbjct: 210 FDVNATAATVSDAFEVEVTSTNPNRRIGMYYDGLEVT 246

[49][TOP]
>UniRef100_A9NK56 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NK56_PICSI
          Length = 244

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 39/108 (36%), Positives = 61/108 (56%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKI 184
           +RP   +RR    R  CC C    +  +++L+L+   A+ V+++IYRP +PSFT++ ++I
Sbjct: 33  FRPTPPKRR----RNRCCLCFLCFVAFLLVLILLAGIAALVIWVIYRPHQPSFTLNSVQI 88

Query: 185 STLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDD 328
              N T    L+    L + A+NPNK V F YDV  +   K S+G  D
Sbjct: 89  PKFNVTKDSHLSYEFDLQMDAKNPNKKVSFYYDVFSV---KVSSGNVD 133

[50][TOP]
>UniRef100_Q7XKB7 Os04g0677300 protein n=3 Tax=Oryza sativa RepID=Q7XKB7_ORYSJ
          Length = 255

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 31/97 (31%), Positives = 57/97 (58%), Gaps = 1/97 (1%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           PP  RRR+   R  CCRC CWT+  +++L + + A + ++Y +++P+ P F V  L ++ 
Sbjct: 54  PPPPRRRSRGRR--CCRCVCWTLLAVLVLAVALGATAGILYAVFKPKIPDFHVDRLTVTR 111

Query: 191 LNF-TSAVRLTTAISLSVIARNPNKNVGFIYDVTDIT 298
            +   +A  ++ A  + V + NPN+ +G  YD  ++T
Sbjct: 112 FDVNATAATVSDAFEVEVTSTNPNRRIGIYYDGGEVT 148

[51][TOP]
>UniRef100_B7FJW5 Putative uncharacterized protein n=1 Tax=Medicago truncatula
           RepID=B7FJW5_MEDTR
          Length = 180

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 32/86 (37%), Positives = 50/86 (58%)
 Frame = +2

Query: 26  RRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTS 205
           RR S   GCCC C CW I ++  L++++A A+ V YLI RP+ P + +  + +  +N TS
Sbjct: 55  RRKSRRCGCCC-CLCWFIGILFTLIVLMAIAAGVFYLIVRPEAPKYAIDRVSVKGMNLTS 113

Query: 206 AVRLTTAISLSVIARNPNKNVGFIYD 283
              ++    +SV A N NK +G  Y+
Sbjct: 114 LSTISPEFDVSVKADNGNKKIGIYYE 139

[52][TOP]
>UniRef100_A2X2X5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2X2X5_ORYSI
          Length = 375

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 30/97 (30%), Positives = 56/97 (57%), Gaps = 1/97 (1%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           PP   RR S  R CCC C CWT+  +++  + + A + ++Y +++P+ P F V+ L ++ 
Sbjct: 177 PPPPPRRRSRGRRCCC-CVCWTLLAVLVRAVALGATAGILYAVFKPKIPDFRVNRLTVTR 235

Query: 191 LNF-TSAVRLTTAISLSVIARNPNKNVGFIYDVTDIT 298
            +   +A  ++ A  + V + NPN+ +G  YD  ++T
Sbjct: 236 FDVNATAATVSDAFEVEVTSTNPNRRIGMYYDGLEVT 272

[53][TOP]
>UniRef100_B9HQ55 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HQ55_POPTR
          Length = 281

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 29/85 (34%), Positives = 50/85 (58%)
 Frame = +2

Query: 29  RTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSA 208
           R    R  CC C CW +  +   L +V  A+A++YL++RP+ P +++  + IS LN TS+
Sbjct: 84  RRKPRRSHCCCCLCWFLSFLAAFLFLVGLAAAILYLVFRPESPDYSIERVSISGLNLTSS 143

Query: 209 VRLTTAISLSVIARNPNKNVGFIYD 283
             ++   +++V A NPN  +G  Y+
Sbjct: 144 GPISPEFNVTVRANNPNNKIGIYYE 168

[54][TOP]
>UniRef100_Q9SLI0 Putative uncharacterized protein F20D21.35 n=1 Tax=Arabidopsis
           thaliana RepID=Q9SLI0_ARATH
          Length = 239

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 27/83 (32%), Positives = 50/83 (60%)
 Frame = +2

Query: 35  SHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVR 214
           S  R  CC+  CW + ++++ L+ +A A AVVY ++ P+ PS+ V+ L+++ L     + 
Sbjct: 44  SKNRNMCCKIFCWVLSLLVIALIALAIAVAVVYFVFHPKLPSYEVNSLRVTNLGINLDLS 103

Query: 215 LTTAISLSVIARNPNKNVGFIYD 283
           L+    + + ARNPN+ +G  Y+
Sbjct: 104 LSAEFKVEITARNPNEKIGIYYE 126

[55][TOP]
>UniRef100_B9MYT1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MYT1_POPTR
          Length = 273

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +2

Query: 29  RTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSA 208
           R   +R  CC C CW + ++  L+ +V  A+AV Y ++RP+ P ++V  L IS  N TS+
Sbjct: 76  RRKPSRSPCCCCLCWLLALLTALIFLVGVAAAVFYFVFRPESPDYSVERLSISGFNLTSS 135

Query: 209 VRLTTAISLSVIARNPNKNVGFIY 280
             ++    ++V A NPN  +G  Y
Sbjct: 136 RWVSPEFDVTVRANNPNDKIGIYY 159

[56][TOP]
>UniRef100_A9P136 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9P136_PICSI
          Length = 270

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 29/79 (36%), Positives = 49/79 (62%)
 Frame = +2

Query: 44  RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTT 223
           R  CCRC C TI  +  L+ I+A A  V+YL+++P+ P ++V  ++I+  +  + +    
Sbjct: 79  RNSCCRCLCCTICFLFALVAIIAIACGVLYLVFQPRIPKYSVDSIRITNFSINADLTTNC 138

Query: 224 AISLSVIARNPNKNVGFIY 280
            +S++V ARNPNK +G  Y
Sbjct: 139 QVSVNVRARNPNKKIGIYY 157

[57][TOP]
>UniRef100_A9P0D8 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9P0D8_PICSI
          Length = 270

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = +2

Query: 44  RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTT 223
           R  CCRC C TI  +  L+ I+A A  V+YL+++P+ P ++V  ++I+  +  + +    
Sbjct: 79  RNSCCRCLCCTICFLFALVAIIAIACGVLYLVFQPRIPKYSVDSIRITNFSINADLTTNC 138

Query: 224 AISLSVIARNPNKNVGFIY 280
            ++++V ARNPNK +G  Y
Sbjct: 139 QVAVNVRARNPNKKIGIYY 157

[58][TOP]
>UniRef100_A2Z8T0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2Z8T0_ORYSI
          Length = 266

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 31/91 (34%), Positives = 48/91 (52%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           PP  RRR     GCCCR  C  +  ++LL ++ AAA   +YL++ P+ P ++V  L +S 
Sbjct: 68  PPPKRRR-----GCCCRLICCVLVTVVLLAVLAAAAVGALYLVFDPKAPRYSVDRLSVSE 122

Query: 191 LNFTSAVRLTTAISLSVIARNPNKNVGFIYD 283
                 +  T    ++V A NPN  +G  Y+
Sbjct: 123 FQVDPTLTATARFDVTVTATNPNARIGIYYE 153

[59][TOP]
>UniRef100_UPI0001984DF7 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001984DF7
          Length = 219

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/92 (38%), Positives = 49/92 (53%)
 Frame = +2

Query: 8   RPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS 187
           +PP+  R     R CC          I +LLL+    + VV+L+YRPQ P FTV  + I 
Sbjct: 22  KPPSPYRPKDPRRACCT--------FIFILLLLAGITALVVWLVYRPQEPQFTVMGVAIY 73

Query: 188 TLNFTSAVRLTTAISLSVIARNPNKNVGFIYD 283
            LN TS   ++T +  +++ RNPNK V   YD
Sbjct: 74  DLNTTSPPLISTNMQFTIVTRNPNKRVSIYYD 105

[60][TOP]
>UniRef100_A9NYU7 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NYU7_PICSI
          Length = 268

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 28/92 (30%), Positives = 51/92 (55%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKI 184
           ++ P    R    R  CCRC C TI  +  L+ I+  A  ++YL+++P+ P ++V  ++I
Sbjct: 64  HQTPRYHSRPPKRRNSCCRCLCCTICFLFALVAIIVIACGILYLVFQPRIPKYSVDGIRI 123

Query: 185 STLNFTSAVRLTTAISLSVIARNPNKNVGFIY 280
           +  +  + +      +++V ARNPNK +G  Y
Sbjct: 124 TNFSINADLSTNCQFTVNVRARNPNKKIGIYY 155

[61][TOP]
>UniRef100_A7PXU0 Chromosome chr15 scaffold_37, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PXU0_VITVI
          Length = 197

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/92 (38%), Positives = 49/92 (53%)
 Frame = +2

Query: 8   RPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS 187
           +PP+  R     R CC          I +LLL+    + VV+L+YRPQ P FTV  + I 
Sbjct: 5   KPPSPYRPKDPRRACCT--------FIFILLLLAGITALVVWLVYRPQEPQFTVMGVAIY 56

Query: 188 TLNFTSAVRLTTAISLSVIARNPNKNVGFIYD 283
            LN TS   ++T +  +++ RNPNK V   YD
Sbjct: 57  DLNTTSPPLISTNMQFTIVTRNPNKRVSIYYD 88

[62][TOP]
>UniRef100_A5BJJ5 Putative uncharacterized protein n=1 Tax=Vitis vinifera
            RepID=A5BJJ5_VITVI
          Length = 991

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/92 (38%), Positives = 49/92 (53%)
 Frame = +2

Query: 8    RPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS 187
            +PP+  R     R CC          I +LLL+    + VV+L+YRPQ P FTV  + I 
Sbjct: 794  KPPSPYRPKDPRRACCT--------FIFILLLLAGITALVVWLVYRPQEPQFTVMGVAIY 845

Query: 188  TLNFTSAVRLTTAISLSVIARNPNKNVGFIYD 283
             LN TS   ++T +  +++ RNPNK V   YD
Sbjct: 846  DLNTTSPPLISTNMQFTIVTRNPNKRVSIYYD 877

[63][TOP]
>UniRef100_B8LMX4 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=B8LMX4_PICSI
          Length = 244

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 31/98 (31%), Positives = 54/98 (55%)
 Frame = +2

Query: 2   AYRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 181
           ++RP   ++R++     CC C    I  ++ L+L+   A  V+++IY+P+ P FTV+ ++
Sbjct: 32  SFRPTPPKKRSNR----CCLCILCLIAFLLALILLAGIAGFVLWIIYKPREPHFTVASVQ 87

Query: 182 ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDI 295
           I   N T    L+    L ++A NPNK + F YD   +
Sbjct: 88  IPKFNVTGGSHLSYEFILQMVAGNPNKKLSFYYDAFSV 125

[64][TOP]
>UniRef100_A9NWB5 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NWB5_PICSI
          Length = 268

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 29/91 (31%), Positives = 52/91 (57%)
 Frame = +2

Query: 8   RPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS 187
           RPP  +RR S     CCRC C+ I  +  L+ I+A    ++YL++ P+ P +++  ++I+
Sbjct: 72  RPP--KRRNS-----CCRCLCYAICFLFALVAIIAITCGILYLVFEPRIPKYSIDSVRIT 124

Query: 188 TLNFTSAVRLTTAISLSVIARNPNKNVGFIY 280
             +  + +      +++V ARNPNK +G  Y
Sbjct: 125 NFSINADLSTNCQFAVNVSARNPNKKIGIYY 155

[65][TOP]
>UniRef100_Q84VP8 Putative uncharacterized protein At5g21130 n=1 Tax=Arabidopsis
           thaliana RepID=Q84VP8_ARATH
          Length = 281

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 26/87 (29%), Positives = 55/87 (63%)
 Frame = +2

Query: 23  RRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFT 202
           RR+T+  + CC RC C+++  +++++++ A A    YL+Y+P +P F+VS + ++ +N T
Sbjct: 84  RRKTN--KSCCRRCLCYSLSALLIIIVLAAIAFGFFYLVYQPHKPQFSVSGVSVTGINLT 141

Query: 203 SAVRLTTAISLSVIARNPNKNVGFIYD 283
           S+   +  I + + ++N    +G IY+
Sbjct: 142 SSSPFSPVIRIKLRSQNVKGKLGLIYE 168

[66][TOP]
>UniRef100_C7J2D2 Os05g0199100 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=C7J2D2_ORYSJ
          Length = 332

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 3/62 (4%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTRGCCCRCCC---WTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSE 175
           YRP A   +    R C C  CC   W + V+ILL L+ A A    YL+YRP RPSFTVS 
Sbjct: 42  YRPQAAAAKRRRGRSCRCSFCCCFCWALLVVILLALVAAVAGGAFYLLYRPHRPSFTVSS 101

Query: 176 LK 181
           +K
Sbjct: 102 VK 103

[67][TOP]
>UniRef100_A5AZX3 Chromosome chr8 scaffold_23, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A5AZX3_VITVI
          Length = 226

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 33/102 (32%), Positives = 54/102 (52%), Gaps = 4/102 (3%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCC----WTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSEL 178
           PP  R   SH RG  C CCC    + + +I+ +++IV  A  + +LI RP +  F V + 
Sbjct: 19  PPKSRSYHSHGRGSGCGCCCCLLGFLLKLIVTVVIIVGIAVLLFWLIVRPNKVKFHVVDA 78

Query: 179 KISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLY 304
            ++  N TS   L   +++++  RNPNK +G  +D  +   Y
Sbjct: 79  SLTEFNLTSDNILQYNLTVNMTVRNPNKRIGIYFDRIEAKAY 120

[68][TOP]
>UniRef100_Q9M132 Putative hypoersensitive response protein n=1 Tax=Arabidopsis
           thaliana RepID=Q9M132_ARATH
          Length = 227

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 31/75 (41%), Positives = 47/75 (62%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLS 238
           R  C  IF I+++L I+A    +++L+YRP +P  TV    I  LNFT+   ++T++  S
Sbjct: 42  RAICGAIFTILVILGIIAL---ILWLVYRPHKPRLTVVGAAIYDLNFTAPPLISTSVQFS 98

Query: 239 VIARNPNKNVGFIYD 283
           V+ARNPN+ V   YD
Sbjct: 99  VLARNPNRRVSIHYD 113

[69][TOP]
>UniRef100_O81329 F3D13.5 protein n=1 Tax=Arabidopsis thaliana RepID=O81329_ARATH
          Length = 202

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 31/75 (41%), Positives = 47/75 (62%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLS 238
           R  C  IF I+++L I+A    +++L+YRP +P  TV    I  LNFT+   ++T++  S
Sbjct: 17  RAICGAIFTILVILGIIAL---ILWLVYRPHKPRLTVVGAAIYDLNFTAPPLISTSVQFS 73

Query: 239 VIARNPNKNVGFIYD 283
           V+ARNPN+ V   YD
Sbjct: 74  VLARNPNRRVSIHYD 88

[70][TOP]
>UniRef100_C5WXE7 Putative uncharacterized protein Sb01g018550 n=1 Tax=Sorghum
           bicolor RepID=C5WXE7_SORBI
          Length = 278

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 31/92 (33%), Positives = 46/92 (50%), Gaps = 1/92 (1%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           PP  R+R    RGCCCR  C  +   ++L ++ AAA   +YL   P+ P ++V  L +S 
Sbjct: 73  PPPSRKRRG--RGCCCRLLCCVVITAVVLAVLAAAAVGALYLALDPKAPRYSVDRLSVSA 130

Query: 191 LNF-TSAVRLTTAISLSVIARNPNKNVGFIYD 283
                S V       ++V A NPN  +G  Y+
Sbjct: 131 FQVDPSTVTARARFDVTVTAANPNSRIGIQYE 162

[71][TOP]
>UniRef100_B9I5K6 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I5K6_POPTR
          Length = 239

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 9/112 (8%)
 Frame = +2

Query: 8   RPPAGRRRTS-------HTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFT 166
           RPP  RR          H+ G C +C C+    +I++++++A+  A +Y+   P+ P + 
Sbjct: 23  RPPPQRRNIPRYQSNHHHSHGGCLKCVCFCFCFLIVMIILLASVIAFIYMTLNPKMPEYN 82

Query: 167 VSELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIY--DVTDITLYKAST 316
           V+   ++  N      L T  +++V A NPN  + FIY  + + +  Y  ST
Sbjct: 83  VASFDVNAFNMAPDFSLYTEFAVTVKANNPNTGISFIYGKESSVVVAYSDST 134

[72][TOP]
>UniRef100_C5X7K9 Putative uncharacterized protein Sb02g017900 n=1 Tax=Sorghum
           bicolor RepID=C5X7K9_SORBI
          Length = 208

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query: 44  RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSA-VRLT 220
           +G CC C CW    ++L++ ++A  +A  + +Y+P+ PS++VS + +S  +F S+ + L 
Sbjct: 15  KGGCCGCLCWCCCFLLLIVAVLAGTAAYFFFVYKPKAPSYSVSNMSVSQFDFKSSDLTLY 74

Query: 221 TAISLSVIARNPNKNVGFIY 280
             ++ SV A NPN+ +   Y
Sbjct: 75  VKLTASVRAENPNEMITIKY 94

[73][TOP]
>UniRef100_A7PG45 Chromosome chr6 scaffold_15, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PG45_VITVI
          Length = 267

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 31/96 (32%), Positives = 55/96 (57%), Gaps = 3/96 (3%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKI 184
           Y+  +GR+      GCCC C CW + +  LL+ ++A A+ + YL+ RP+  S++V ++ I
Sbjct: 62  YQKYSGRK--PRRSGCCC-CLCWFLGLAALLIFLLAIAAGIFYLVIRPKALSYSVEDISI 118

Query: 185 STLNFTSA---VRLTTAISLSVIARNPNKNVGFIYD 283
           +  N +SA     ++    ++V A NPNK +   Y+
Sbjct: 119 TGFNVSSAAATASISPEFDVTVRADNPNKKISIYYE 154

[74][TOP]
>UniRef100_C0PDX3 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PDX3_MAIZE
          Length = 274

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 1/92 (1%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           PP  RR     RGCCCR  C  +   ++L ++ AAA+  +YL+  P+ P ++V  L +ST
Sbjct: 73  PPPKRRG----RGCCCRFLCCAVITAVVLAVLAAAAAGALYLLLDPKAPRYSVDRLSVST 128

Query: 191 LNF-TSAVRLTTAISLSVIARNPNKNVGFIYD 283
                S +       ++V A NPN  +   Y+
Sbjct: 129 FQVDPSTLTARAGFDVAVTAANPNSRIAIQYE 160

[75][TOP]
>UniRef100_B6U0I5 NHL25 n=1 Tax=Zea mays RepID=B6U0I5_MAIZE
          Length = 274

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 1/92 (1%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           PP  RR     RGCCCR  C  +   ++L ++ AAA+  +YL+  P+ P ++V  L +S 
Sbjct: 73  PPPKRRG----RGCCCRFLCCAVITAVVLAVLAAAAAGALYLLLDPKAPRYSVDRLSVSA 128

Query: 191 LNF-TSAVRLTTAISLSVIARNPNKNVGFIYD 283
                S         ++V A NPN  +G  Y+
Sbjct: 129 FQVDPSTFTARAGFDVAVTAANPNSRIGIQYE 160

[76][TOP]
>UniRef100_B4FJQ3 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FJQ3_MAIZE
          Length = 208

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 26/80 (32%), Positives = 47/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query: 44  RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNF-TSAVRLT 220
           +G CC C CW    ++ ++  +A  +A  + +Y+P+ PS++VS + +S  +F TS + L 
Sbjct: 15  KGGCCGCLCWCCCFLLFIVAALAGTAAYFFFVYKPKAPSYSVSNMSVSQFDFSTSDLTLY 74

Query: 221 TAISLSVIARNPNKNVGFIY 280
             ++ SV A NPN+ +   Y
Sbjct: 75  VKLTASVRAENPNEMITIRY 94

[77][TOP]
>UniRef100_Q9ZVD2 Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q9ZVD2_ARATH
          Length = 260

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 27/88 (30%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +2

Query: 23  RRRTSHTRGCCCRCCCWTIFVIILLLLIVAAAS-AVVYLIYRPQRPSFTVSELKISTLNF 199
           R++T+ +    CRCC  +    + +L+++A  S AV+YLIYRP+ P +++    +S +N 
Sbjct: 63  RKKTNRSN---CRCCFCSFLAAVFILIVLAGISFAVLYLIYRPEAPKYSIEGFSVSGINL 119

Query: 200 TSAVRLTTAISLSVIARNPNKNVGFIYD 283
            S   ++ + +++V +RN N  +G  Y+
Sbjct: 120 NSTSPISPSFNVTVRSRNGNGKIGVYYE 147

[78][TOP]
>UniRef100_B6TUW3 VAMP protein SEC22 n=1 Tax=Zea mays RepID=B6TUW3_MAIZE
          Length = 221

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 9/92 (9%)
 Frame = +2

Query: 44  RGCCC-------RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFT 202
           +GC C       RCC   + +I+L+L IV     VV+L+ RP +P F + +L +  LN T
Sbjct: 10  KGCECERERLYRRCCAAVVALILLVLFIVL----VVWLVLRPHKPRFYLQDLSVLCLNVT 65

Query: 203 --SAVRLTTAISLSVIARNPNKNVGFIYDVTD 292
             ++  L T +  +V ARNPN+ VG  YD  D
Sbjct: 66  PPASTYLFTTMQATVAARNPNERVGVYYDQAD 97

[79][TOP]
>UniRef100_B4FKP0 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FKP0_MAIZE
          Length = 221

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 9/92 (9%)
 Frame = +2

Query: 44  RGCCC-------RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFT 202
           +GC C       RCC   + +I+L+L IV     VV+L+ RP +P F + +L +  LN T
Sbjct: 10  KGCECERERLYRRCCAAVVALILLVLFIVL----VVWLVLRPHKPRFYLQDLSVLCLNVT 65

Query: 203 --SAVRLTTAISLSVIARNPNKNVGFIYDVTD 292
             ++  L T +  +V ARNPN+ VG  YD  D
Sbjct: 66  PPASTYLFTTMQATVAARNPNERVGVYYDQAD 97

[80][TOP]
>UniRef100_UPI0001984539 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001984539
          Length = 231

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 6/109 (5%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTR---GCC-CRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVS 172
           YR    R  + H +   GC  C CCC+   +I++ LL  A  +   Y +++P+ PS+ V 
Sbjct: 24  YRRNVPRYHSGHHKSGGGCLKCICCCYCFLIILIFLL--AGITFYFYTVFQPKVPSYQVE 81

Query: 173 ELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIY--DVTDITLYKAS 313
            L +   +      L T   ++V A NPN+++GFIY  D + I +Y  S
Sbjct: 82  HLDVKAFDMQMDFSLNTEFLVTVKADNPNQHIGFIYGKDSSAIVMYSDS 130

[81][TOP]
>UniRef100_A5AZ43 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5AZ43_VITVI
          Length = 1452

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 6/109 (5%)
 Frame = +2

Query: 5   YRPPAGRRRTSHTR---GCC-CRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVS 172
           YR    R  + H +   GC  C CCC+   +I++ LL  A  +   Y +++P+ PS+ V 
Sbjct: 24  YRRNVPRYHSGHHKSGGGCLKCICCCYCFLIILIFLL--AGITFYFYTVFQPKVPSYQVE 81

Query: 173 ELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIY--DVTDITLYKAS 313
            L +   +      L T   ++V A NPN+++GFIY  D + I +Y  S
Sbjct: 82  HLDVKAFDMQMDFSLNTEFLVTVKADNPNQHIGFIYGKDSSAIVMYSDS 130

[82][TOP]
>UniRef100_Q9SJ52 Similar to harpin-induced protein hin1 from tobacco n=1
           Tax=Arabidopsis thaliana RepID=Q9SJ52_ARATH
          Length = 227

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/98 (34%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = +2

Query: 14  PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL 193
           P G  R  H RGC C      + VII L++I+  A+ + +LI RP+   F V++  ++  
Sbjct: 21  PKGYYRRGHGRGCGCCLLSLFVKVIISLIVILGVAALIFWLIVRPRAIKFHVTDASLTRF 80

Query: 194 NFTSAVR-LTTAISLSVIARNPNKNVGFIYDVTDITLY 304
           + TS    L   ++L+V  RNPNK +G  YD  +   Y
Sbjct: 81  DHTSPDNILRYNLALTVPVRNPNKRIGLYYDRIEAHAY 118

[83][TOP]
>UniRef100_Q6Z0E0 Os08g0324200 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6Z0E0_ORYSJ
          Length = 242

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 3/82 (3%)
 Frame = +2

Query: 44  RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIY--RPQRPSFTVSELKISTLNFTSA-VR 214
           RGC C CCC+      LLLL+VA A+   YL+Y  RP+ PS++VS++ ++  + +S+ + 
Sbjct: 53  RGCLCWCCCF------LLLLVVAVAATSAYLLYACRPKAPSYSVSDMSVARFDVSSSDLT 106

Query: 215 LTTAISLSVIARNPNKNVGFIY 280
           +   +  SV A NPN  VG  Y
Sbjct: 107 VYAKLVASVRAENPNDMVGIGY 128

[84][TOP]
>UniRef100_C5XUZ0 Putative uncharacterized protein Sb04g023155 (Fragment) n=1
           Tax=Sorghum bicolor RepID=C5XUZ0_SORBI
          Length = 202

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 30/92 (32%), Positives = 45/92 (48%), Gaps = 1/92 (1%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           PP  R+R    RGCCCR  C  +   ++L ++ AA    +YL   P+ P ++V  L +S 
Sbjct: 23  PPPPRKRRG--RGCCCRLLCCAVVTAVVLAVLAAAVVGALYLALDPKAPRYSVDRLSVSA 80

Query: 191 LNF-TSAVRLTTAISLSVIARNPNKNVGFIYD 283
                S V       ++V A NPN  +G  Y+
Sbjct: 81  FQVDPSTVTARARFDVTVTAVNPNSRIGIQYE 112

[85][TOP]
>UniRef100_B9RNK9 Putative uncharacterized protein n=1 Tax=Ricinus communis
           RepID=B9RNK9_RICCO
          Length = 226

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 29/67 (43%), Positives = 41/67 (61%)
 Frame = +2

Query: 83  VIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLSVIARNPNK 262
           VI + LL+   A  +V+LIYRP +P FTV    I  LN TS   ++ ++  +++ RNPNK
Sbjct: 46  VITIFLLLAGLAVFIVWLIYRPHKPRFTVLGAAIYDLNTTSPPFVSASMQFTIVTRNPNK 105

Query: 263 NVGFIYD 283
            V  IYD
Sbjct: 106 RVAIIYD 112

[86][TOP]
>UniRef100_B1Q4T2 Harpin-induced protein n=1 Tax=Bruguiera gymnorhiza
           RepID=B1Q4T2_9ROSI
          Length = 200

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 31/103 (30%), Positives = 51/103 (49%), Gaps = 2/103 (1%)
 Frame = +2

Query: 2   AYRPPAGRRRTSHTRGCCCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQRPSFTVSE 175
           A  PP    R     G  C CC  +    +II  ++I+  A  V++L+ RP +  F V++
Sbjct: 16  AIPPPKNYHRPGGRSGSGCGCCLLSFLFKLIITAVVIIGIAILVIWLVLRPNKIKFHVTD 75

Query: 176 LKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLY 304
             ++  N T+   L   ++L++  RNPNK +G  YD  D   +
Sbjct: 76  ATLTQFNITANNTLQYNLALNLTVRNPNKRIGIYYDKIDAAAF 118

[87][TOP]
>UniRef100_A9U1X7 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9U1X7_PHYPA
          Length = 278

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 29/111 (26%), Positives = 57/111 (51%), Gaps = 13/111 (11%)
 Frame = +2

Query: 8   RPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIS 187
           RPP       + R CC RC   +  +++LL+ +V  A+ +++++++P+ P F+V +++I+
Sbjct: 61  RPPRKPVNRRNPRRCCKRCLITSCSILVLLIFLVGLAALIIWILFKPKIPQFSVQDVRIN 120

Query: 188 TLNFTSAVRLTTA-------------ISLSVIARNPNKNVGFIYDVTDITL 301
            LN T+     TA             I  ++ A NPNK +   Y   ++ +
Sbjct: 121 KLNVTATYDTATASLKATNPTYVDTDILFTIHASNPNKKIRIDYKKVNVQM 171

[88][TOP]
>UniRef100_A2YTX3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2YTX3_ORYSI
          Length = 242

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 3/82 (3%)
 Frame = +2

Query: 44  RGCCCRCCCWTIFVIILLLLIVAAASAVVYLIY--RPQRPSFTVSELKISTLNFTSA-VR 214
           RGC C CCC+      LLLL+VA A+   YL+Y  RP+ PS++VS++ ++  + +S+ + 
Sbjct: 53  RGCLCWCCCF------LLLLVVAVAATSAYLLYACRPKAPSYSVSDMSVARFDVSSSDLT 106

Query: 215 LTTAISLSVIARNPNKNVGFIY 280
           +   +  SV A NPN  VG  Y
Sbjct: 107 VYAKLVASVRAENPNDMVGIGY 128

[89][TOP]
>UniRef100_B6STF5 NHL25 n=1 Tax=Zea mays RepID=B6STF5_MAIZE
          Length = 265

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 1/92 (1%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           PP  RR     RGCCCR  C  +    +L ++ AAA+  +YL   P+ P ++V  L +S 
Sbjct: 63  PPPKRRG----RGCCCRLLCCAVISAAVLAVLAAAAAGALYLALDPKAPRYSVDRLSVSA 118

Query: 191 LNFTSAVRLTTA-ISLSVIARNPNKNVGFIYD 283
                A     A   ++V A NPN  +G  Y+
Sbjct: 119 FQVDPATLAARARFDVAVAATNPNSRIGIHYE 150

[90][TOP]
>UniRef100_Q8RUR5 Os01g0812100 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q8RUR5_ORYSJ
          Length = 312

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 10/97 (10%)
 Frame = +2

Query: 23  RRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL--- 193
           RR     R  C R C W +  ++LL   +AA++AVVYL+++P++P +T+  L +S L   
Sbjct: 98  RRARRRARCSCARVCSWLLLALVLLAAALAASAAVVYLVFKPRQPDYTLLSLAVSGLGGI 157

Query: 194 --NFTSA-----VRLTTAISLSVIARNPNKNVGFIYD 283
             N +S      V  +     +V A NPN  +G  Y+
Sbjct: 158 LGNASSTAAPAPVSFSPEFDATVRADNPNGKIGVHYE 194

[91][TOP]
>UniRef100_B9N2B2 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9N2B2_POPTR
          Length = 225

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 10/113 (8%)
 Frame = +2

Query: 8   RPPAGRRRTS-------HTRG-CCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSF 163
           RPP  RR          H+ G CC +C C      I++++++A+  +V+Y+   P+ P +
Sbjct: 17  RPPPQRRNIPRYHSNHHHSHGHCCLKCVCCCFCFSIVVIIVLASLLSVLYVTLDPKMPQY 76

Query: 164 TVSELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIY--DVTDITLYKAST 316
            +   +++  N      L T   + V A NPNK + F Y  D + +  Y  ST
Sbjct: 77  NIESFEVNAFNMAPDFSLYTEFVVVVKANNPNKEIAFTYGKDSSVVVAYSDST 129

[92][TOP]
>UniRef100_A2ZYW2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A2ZYW2_ORYSJ
          Length = 237

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 10/97 (10%)
 Frame = +2

Query: 23  RRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL--- 193
           RR     R  C R C W +  ++LL   +AA++AVVYL+++P++P +T+  L +S L   
Sbjct: 23  RRARRRARCSCARVCSWLLLALVLLAAALAASAAVVYLVFKPRQPDYTLLSLAVSGLGGI 82

Query: 194 --NFTSA-----VRLTTAISLSVIARNPNKNVGFIYD 283
             N +S      V  +     +V A NPN  +G  Y+
Sbjct: 83  LGNASSTAAPAPVSFSPEFDATVRADNPNGKIGVHYE 119

[93][TOP]
>UniRef100_A2WW90 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2WW90_ORYSI
          Length = 312

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 10/97 (10%)
 Frame = +2

Query: 23  RRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL--- 193
           RR     R  C R C W +  ++LL   +AA++AVVYL+++P++P +T+  L +S L   
Sbjct: 98  RRARRRARCSCARVCSWLLLALVLLAAALAASAAVVYLVFKPRQPDYTLLSLAVSGLGGI 157

Query: 194 --NFTSA-----VRLTTAISLSVIARNPNKNVGFIYD 283
             N +S      V  +     +V A NPN  +G  Y+
Sbjct: 158 LGNASSTAAPAPVAFSPEFDATVRADNPNGKIGVHYE 194

[94][TOP]
>UniRef100_Q2QY99 Os12g0127200 protein n=2 Tax=Oryza sativa RepID=Q2QY99_ORYSJ
          Length = 275

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/90 (41%), Positives = 47/90 (52%), Gaps = 1/90 (1%)
 Frame = +2

Query: 14  PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL 193
           PA RRR  H        CC     ++LLLL+ AA   VVYL++RP  PSF+V+ L I  L
Sbjct: 76  PARRRRLRHA-------CCGAFCGVLLLLLLAAAFVGVVYLVFRPLAPSFSVASLSIRGL 128

Query: 194 NFTSAVRLTTAISLSVIARN-PNKNVGFIY 280
           +  +   LT  I  +V A N  NK  G  Y
Sbjct: 129 DALAVSSLTPQIDAAVRADNGANKKTGIDY 158

[95][TOP]
>UniRef100_B9GRR5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GRR5_POPTR
          Length = 195

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 27/67 (40%), Positives = 41/67 (61%)
 Frame = +2

Query: 83  VIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLSVIARNPNK 262
           +I + LL+   A  +V+LIYRP +P FTV    I  LN T    ++T++  S++ RNPN+
Sbjct: 15  LITIFLLLAGLAVLIVWLIYRPHKPQFTVVGAAIYDLNTTCPPFISTSMQFSLVTRNPNR 74

Query: 263 NVGFIYD 283
            V  +YD
Sbjct: 75  RVSIMYD 81

[96][TOP]
>UniRef100_Q6H4U3 Os09g0267400 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6H4U3_ORYSJ
          Length = 210

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 29/80 (36%), Positives = 48/80 (60%), Gaps = 3/80 (3%)
 Frame = +2

Query: 50  CC--CRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTS-AVRLT 220
           CC  C CCC+    + L++  +A A+A    +Y+P+ PS++VS + +S  +F S  + L 
Sbjct: 21  CCVLCWCCCF----LFLIVAALAGAAAYALFLYKPKAPSYSVSNMSVSQFDFNSNDLTLY 76

Query: 221 TAISLSVIARNPNKNVGFIY 280
           T +  +V A NPN+ +G IY
Sbjct: 77  TKLVATVRAENPNEMIGIIY 96

[97][TOP]
>UniRef100_C5Y3Z3 Putative uncharacterized protein Sb05g001840 n=1 Tax=Sorghum
           bicolor RepID=C5Y3Z3_SORBI
          Length = 304

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 37/87 (42%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +2

Query: 26  RRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTS 205
           RR +  R CCC      I +++LL+ + AA    VYLIYRP+ PSF+V+ L I  LN TS
Sbjct: 100 RRRALRRACCC-----AIAIVLLLVALAAAFVGAVYLIYRPRAPSFSVASLSIHGLNTTS 154

Query: 206 -AVRLTTAISLSVIARNP-NKNVGFIY 280
            +  L+  +   V A N  NK VG  Y
Sbjct: 155 LSSSLSPRLDAVVRADNARNKKVGIEY 181

[98][TOP]
>UniRef100_C5XU17 Putative uncharacterized protein Sb04g022010 n=1 Tax=Sorghum
           bicolor RepID=C5XU17_SORBI
          Length = 212

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 1/91 (1%)
 Frame = +2

Query: 26  RRTSHTRGCC-CRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFT 202
           R   H R CC C   C     ++ L+L+VA  + V+YL  RP +PSF + +L++      
Sbjct: 9   RHEHHLRRCCGCMASC-----LLALVLVVAFVALVIYLALRPSKPSFYLQDLQLRRPISL 63

Query: 203 SAVRLTTAISLSVIARNPNKNVGFIYDVTDI 295
               LT +  +++ +RNPN++VG  Y   D+
Sbjct: 64  GDPSLTASAQVTLASRNPNEHVGIFYKRLDV 94

[99][TOP]
>UniRef100_A3BWP2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3BWP2_ORYSJ
          Length = 339

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 29/80 (36%), Positives = 48/80 (60%), Gaps = 3/80 (3%)
 Frame = +2

Query: 50  CC--CRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTS-AVRLT 220
           CC  C CCC+    + L++  +A A+A    +Y+P+ PS++VS + +S  +F S  + L 
Sbjct: 21  CCVLCWCCCF----LFLIVAALAGAAAYALFLYKPKAPSYSVSNMSVSQFDFNSNDLTLY 76

Query: 221 TAISLSVIARNPNKNVGFIY 280
           T +  +V A NPN+ +G IY
Sbjct: 77  TKLVATVRAENPNEMIGIIY 96

[100][TOP]
>UniRef100_UPI0000DD9AF5 Os11g0130400 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000DD9AF5
          Length = 297

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 36/90 (40%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +2

Query: 14  PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL 193
           PA RRR  H        CC      +LLLL+ AA    VYL++RP+ PSF+V+ L I  L
Sbjct: 75  PARRRRLRHA-------CCAAFCAALLLLLLAAAFVGAVYLVFRPRAPSFSVASLSIRGL 127

Query: 194 NFTSAVRLTTAISLSVIARN-PNKNVGFIY 280
           +  +   LT  I  +V A N  NK  G  Y
Sbjct: 128 DALAVSSLTPQIDAAVRADNGANKKTGIDY 157

[101][TOP]
>UniRef100_Q2RB10 Harpin-induced protein 1 containing protein, expressed n=1
           Tax=Oryza sativa Japonica Group RepID=Q2RB10_ORYSJ
          Length = 276

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 36/90 (40%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +2

Query: 14  PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL 193
           PA RRR  H        CC      +LLLL+ AA    VYL++RP+ PSF+V+ L I  L
Sbjct: 75  PARRRRLRHA-------CCAAFCAALLLLLLAAAFVGAVYLVFRPRAPSFSVASLSIRGL 127

Query: 194 NFTSAVRLTTAISLSVIARN-PNKNVGFIY 280
           +  +   LT  I  +V A N  NK  G  Y
Sbjct: 128 DALAVSSLTPQIDAAVRADNGANKKTGIDY 157

[102][TOP]
>UniRef100_B6TG26 VAMP protein SEC22 n=1 Tax=Zea mays RepID=B6TG26_MAIZE
          Length = 207

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 32/87 (36%), Positives = 46/87 (52%), Gaps = 1/87 (1%)
 Frame = +2

Query: 38  HTRGCC-CRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVR 214
           H R CC C   C     ++ L+LIVA  S VVYL  RP +PSF + +L++          
Sbjct: 12  HLRRCCGCMASC-----LLALVLIVAFVSLVVYLALRPSKPSFYLQDLQLRRPISLGDPS 66

Query: 215 LTTAISLSVIARNPNKNVGFIYDVTDI 295
           LT +  +++ +RNPN  VG  Y   D+
Sbjct: 67  LTASAQVTLASRNPNDRVGIFYKRLDV 93

[103][TOP]
>UniRef100_B6TBX4 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6TBX4_MAIZE
          Length = 207

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 32/87 (36%), Positives = 46/87 (52%), Gaps = 1/87 (1%)
 Frame = +2

Query: 38  HTRGCC-CRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVR 214
           H R CC C   C     ++ L+LIVA  S VVYL  RP +PSF + +L++          
Sbjct: 12  HLRRCCGCMASC-----LLALVLIVAFVSLVVYLALRPSKPSFYLQDLQLRRPISLGDPS 66

Query: 215 LTTAISLSVIARNPNKNVGFIYDVTDI 295
           LT +  +++ +RNPN  VG  Y   D+
Sbjct: 67  LTASAQVTLASRNPNDRVGIFYKRLDV 93

[104][TOP]
>UniRef100_A7PZR5 Chromosome chr15 scaffold_40, whole genome shotgun sequence n=2
           Tax=Vitis vinifera RepID=A7PZR5_VITVI
          Length = 242

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 36/108 (33%), Positives = 51/108 (47%), Gaps = 3/108 (2%)
 Frame = +2

Query: 14  PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL 193
           P  RRR    R CC   CC+      +L++I+    A  YL + P+ P F +  LKI   
Sbjct: 40  PVKRRR----RSCCRIFCCFFCIFSFILIIILFLGGAFFYLWFNPKVPVFHLQSLKIQRF 95

Query: 194 NFT---SAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDD 328
           N T    A  + +  ++ V  RNPN  + F Y  T +TL  A  G D+
Sbjct: 96  NVTVKSDATYIDSQTAVKVEVRNPNDKITFRYGKTSVTL-TAGLGEDE 142

[105][TOP]
>UniRef100_Q9SRN1 T19F11.5 protein n=1 Tax=Arabidopsis thaliana RepID=Q9SRN1_ARATH
          Length = 240

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 35/111 (31%), Positives = 53/111 (47%), Gaps = 13/111 (11%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCC--------RCCCWTIFVIILLLLIVAA-----ASAVVYLIYRPQ 151
           P A R   S   GCCC        RCC   I  +I  +LI  A     A+ +++LI+RP 
Sbjct: 21  PKAHRSYNSPGFGCCCFSCLGSCLRCCGCCILSLICNILIAVAVILGVAALILWLIFRPN 80

Query: 152 RPSFTVSELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLY 304
              F V++  ++  +F     L  ++ L+   RNPN+ VG  YD   ++ Y
Sbjct: 81  AVKFYVADANLNRFSFDPNNNLHYSLDLNFTIRNPNQRVGVYYDEFSVSGY 131

[106][TOP]
>UniRef100_Q9LKQ3 NDR1/HIN1-Like protein 2 n=1 Tax=Arabidopsis thaliana
           RepID=Q9LKQ3_ARATH
          Length = 240

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 35/111 (31%), Positives = 53/111 (47%), Gaps = 13/111 (11%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCC--------RCCCWTIFVIILLLLIVAA-----ASAVVYLIYRPQ 151
           P A R   S   GCCC        RCC   I  +I  +LI  A     A+ +++LI+RP 
Sbjct: 21  PKAHRSYNSPGFGCCCFSCLGSCLRCCGCCILSLICNILIAVAVILGVAALILWLIFRPN 80

Query: 152 RPSFTVSELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLY 304
              F V++  ++  +F     L  ++ L+   RNPN+ VG  YD   ++ Y
Sbjct: 81  AVKFYVADANLNRFSFDPNNNLHYSLDLNFTIRNPNQRVGVYYDEFSVSGY 131

[107][TOP]
>UniRef100_Q6PUQ1 Putative uncharacterized protein n=1 Tax=Petunia integrifolia
           subsp. inflata RepID=Q6PUQ1_PETIN
          Length = 234

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 23/77 (29%), Positives = 42/77 (54%)
 Frame = +2

Query: 50  CCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAI 229
           CC RC C    V+  +++++ A +   Y +Y+P+ P++    L++    +     LTT I
Sbjct: 44  CCIRCICCCYCVLFFIIVLLGAFAFYFYTMYQPKLPTYKFQSLEVKEFGYQPDFSLTTDI 103

Query: 230 SLSVIARNPNKNVGFIY 280
            +++ A NPNK +  IY
Sbjct: 104 IVTIRAENPNKAISLIY 120

[108][TOP]
>UniRef100_Q1JUZ3 Hairpin-induced family protein n=1 Tax=Ipomoea nil
           RepID=Q1JUZ3_IPONI
          Length = 207

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 26/67 (38%), Positives = 43/67 (64%)
 Frame = +2

Query: 83  VIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLSVIARNPNK 262
           V+  L  I+ A   +V++   P RP F++SE KI+ LN  +A  L ++I L+++++NPNK
Sbjct: 27  VVAFLFSILLALIFIVWISLHPSRPEFSLSEAKINQLNLFTAHLLYSSIQLTLLSKNPNK 86

Query: 263 NVGFIYD 283
            +G  YD
Sbjct: 87  KIGIYYD 93

[109][TOP]
>UniRef100_C5YLD7 Putative uncharacterized protein Sb07g000370 n=1 Tax=Sorghum
           bicolor RepID=C5YLD7_SORBI
          Length = 214

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 29/79 (36%), Positives = 47/79 (59%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLS 238
           R C   + +I+LLLLIV     +V+L+ RP +P F ++++ I  +N +SA  LT  +  +
Sbjct: 20  RFCAALVGIILLLLLIVL----IVWLVLRPTKPRFFLNDVSIVCINVSSASYLTVTMQAT 75

Query: 239 VIARNPNKNVGFIYDVTDI 295
           + +RN N  VG  YD  D+
Sbjct: 76  LASRNTNDRVGIYYDRADV 94

[110][TOP]
>UniRef100_B0ZC11 Hairpin-inducing protein n=1 Tax=Casuarina glauca
           RepID=B0ZC11_CASGL
          Length = 225

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 28/101 (27%), Positives = 53/101 (52%), Gaps = 3/101 (2%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIF---VIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 181
           PP    R   + G  C C C+  F   +I+ +++I+  A+ + +LI+RP   +F V++  
Sbjct: 20  PPQSYHRPGRSGGRGCGCACFFCFLLKLIVSVIVILGLAALIFWLIFRPTSINFHVTDAT 79

Query: 182 ISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLY 304
           ++  +F+    L   ++L+V  RN N+ +G  YD  +   Y
Sbjct: 80  LTQFDFSDNNTLQYNLALNVSVRNSNRKIGVYYDTIEARAY 120

[111][TOP]
>UniRef100_Q9FNH6 Harpin-induced protein-like n=2 Tax=Arabidopsis thaliana
           RepID=Q9FNH6_ARATH
          Length = 231

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 30/111 (27%), Positives = 54/111 (48%), Gaps = 13/111 (11%)
 Frame = +2

Query: 11  PPAGRRRTSHTR-----GC------CCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQ 151
           PP  +   SH R     GC      CC CC  ++   ++I + +++  A+ +++LI+RP 
Sbjct: 14  PPPKKVSHSHGRRGGGCGCLGDCLGCCGCCILSVIFNILITIAVLLGIAALIIWLIFRPN 73

Query: 152 RPSFTVSELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLY 304
              F V++ K++         L   + L+   RNPN+ +G  YD  ++  Y
Sbjct: 74  AIKFHVTDAKLTEFTLDPTNNLRYNLDLNFTIRNPNRRIGVYYDEIEVRGY 124

[112][TOP]
>UniRef100_B6TRZ2 VAMP protein SEC22 n=1 Tax=Zea mays RepID=B6TRZ2_MAIZE
          Length = 214

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 29/79 (36%), Positives = 47/79 (59%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLS 238
           R C   + VI+L+LLIV     +V+L+ RP +P F ++++ I  +N +SA  LT  +  +
Sbjct: 20  RFCAALVGVIVLVLLIVL----IVWLVLRPTKPRFFLNDVSIVCINVSSASYLTVTMQAT 75

Query: 239 VIARNPNKNVGFIYDVTDI 295
           + +RN N  VG  YD  D+
Sbjct: 76  LASRNTNDRVGIYYDRADV 94

[113][TOP]
>UniRef100_B9T2S1 Syntaxin, plant, putative n=1 Tax=Ricinus communis
           RepID=B9T2S1_RICCO
          Length = 219

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 2/96 (2%)
 Frame = +2

Query: 2   AYRPPAGRRRTSHTRGCCCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQRPSFTVSE 175
           A  PP    R   + GC C CC  +    +II + +++  A  + +L+ RP +  F V+E
Sbjct: 16  AIPPPQSYHRPGRS-GCGCGCCLLSCLLKIIITIAVVLGLAVLIFWLVVRPNKVKFHVTE 74

Query: 176 LKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYD 283
             +S  N  +   L   ++L++  RNPNK +G  YD
Sbjct: 75  ANLSEFNINNNT-LHYNLALNITVRNPNKKIGIYYD 109

[114][TOP]
>UniRef100_B4FDU9 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FDU9_MAIZE
          Length = 212

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 5/84 (5%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSF-----TVSELKISTLNFTSAVRLTT 223
           R C   +  I++L L V   + +VYL+ RP  P F     ++ +L +S    +++  L+T
Sbjct: 15  RSCRRLLATIVVLALTVGVVALIVYLVLRPTHPRFYLQDASLRQLDLSNATTSTSTLLST 74

Query: 224 AISLSVIARNPNKNVGFIYDVTDI 295
           AI +++ +RNPN+ VG  YD  D+
Sbjct: 75  AIQVTLASRNPNERVGVYYDRLDV 98

[115][TOP]
>UniRef100_Q7XPU0 Os04g0685400 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q7XPU0_ORYSJ
          Length = 220

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 8/92 (8%)
 Frame = +2

Query: 44  RGCCC------RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFT- 202
           +GC C      R  CW +  ++LL L +     VV+L  RP +P F + +L +  LN T 
Sbjct: 11  KGCECEKEKVHRRLCWALVALVLLTLFIVL---VVWLALRPHKPRFYLQDLSVLCLNVTP 67

Query: 203 -SAVRLTTAISLSVIARNPNKNVGFIYDVTDI 295
            ++  L T +  +V ARN N  VG  YD  D+
Sbjct: 68  PASAYLFTTMQATVAARNDNGRVGVYYDKVDV 99

[116][TOP]
>UniRef100_B8LL00 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=B8LL00_PICSI
          Length = 210

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 26/75 (34%), Positives = 45/75 (60%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLS 238
           R C  ++FV++++ L V     VVYL+  P +P F V +  +  LN T+ + LT+++  S
Sbjct: 25  RRCMGSLFVLVVIALFVIL---VVYLVLHPHKPRFYVQDATVHQLNLTNGL-LTSSLQFS 80

Query: 239 VIARNPNKNVGFIYD 283
           +++ NPN  +G  YD
Sbjct: 81  IVSHNPNDRIGVYYD 95

[117][TOP]
>UniRef100_B6TFE0 VAMP protein SEC22 n=1 Tax=Zea mays RepID=B6TFE0_MAIZE
          Length = 214

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 7/86 (8%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVR-------L 217
           R C   + ++++L L V   + +VYL+ RP  P F + +  +  L+ ++A         L
Sbjct: 15  RSCRRLLAILVVLALTVGVVALIVYLVLRPTHPRFYLQDASLRQLDLSNATTSTSTSTLL 74

Query: 218 TTAISLSVIARNPNKNVGFIYDVTDI 295
           +TAI +++ +RNPN+ VG  YD  D+
Sbjct: 75  STAIQVTLASRNPNERVGVYYDRLDV 100

[118][TOP]
>UniRef100_A3AYT8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3AYT8_ORYSJ
          Length = 220

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 8/92 (8%)
 Frame = +2

Query: 44  RGCCC------RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFT- 202
           +GC C      R  CW +  ++LL L +     VV+L  RP +P F + +L +  LN T 
Sbjct: 11  KGCECEKEKVHRRLCWALVALVLLTLFIVL---VVWLALRPHKPRFYLQDLSVLCLNVTP 67

Query: 203 -SAVRLTTAISLSVIARNPNKNVGFIYDVTDI 295
            ++  L T +  +V ARN N  VG  YD  D+
Sbjct: 68  PASAYLFTTMQATVAARNDNGRVGVYYDKVDV 99

[119][TOP]
>UniRef100_A2YZ56 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2YZ56_ORYSI
          Length = 339

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 3/80 (3%)
 Frame = +2

Query: 50  CC--CRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTS-AVRLT 220
           CC  C CCC+    + L++  +A A+A    +Y+P+ PS++VS + +S  +F S  + L 
Sbjct: 21  CCVLCWCCCF----LFLIVAALAGAAAYALFLYKPKAPSYSVSNMSVSQFDFNSNDLTLY 76

Query: 221 TAISLSVIARNPNKNVGFIY 280
           T +  SV A NPN  +G  Y
Sbjct: 77  TKLVASVRAENPNDMIGIKY 96

[120][TOP]
>UniRef100_Q259M8 H0723C07.1 protein n=2 Tax=Oryza sativa RepID=Q259M8_ORYSA
          Length = 220

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 8/92 (8%)
 Frame = +2

Query: 44  RGCCC------RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFT- 202
           +GC C      R  CW +  ++LL L +     VV+L  RP +P F + +L +  LN T 
Sbjct: 11  KGCECEKEKVPRRLCWALVALVLLTLFIVL---VVWLALRPHKPRFYLQDLSVLCLNVTP 67

Query: 203 -SAVRLTTAISLSVIARNPNKNVGFIYDVTDI 295
            ++  L T +  +V ARN N  VG  YD  D+
Sbjct: 68  PASAYLFTTMQATVAARNDNGRVGVYYDKVDV 99

[121][TOP]
>UniRef100_C5YAZ6 Putative uncharacterized protein Sb06g033580 n=1 Tax=Sorghum
           bicolor RepID=C5YAZ6_SORBI
          Length = 219

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 9/92 (9%)
 Frame = +2

Query: 44  RGCCC-------RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFT 202
           +GC C       RCC   +  I+L+L ++     VV+L+ RP +P F + +L +  LN T
Sbjct: 10  KGCECERERLYRRCCAALVAFILLVLFVIL----VVWLVLRPHKPKFYLQDLSVLCLNVT 65

Query: 203 --SAVRLTTAISLSVIARNPNKNVGFIYDVTD 292
             ++  L T +  +V ARN N  VG  YD  D
Sbjct: 66  PPASTYLFTTMQATVAARNVNDRVGVYYDQAD 97

[122][TOP]
>UniRef100_B9I951 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I951_POPTR
          Length = 214

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 26/66 (39%), Positives = 38/66 (57%)
 Frame = +2

Query: 86  IILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLSVIARNPNKN 265
           I   LL+   A  +V+LIYRP +P FTV    +  LN TS   ++T++  ++  RNPN  
Sbjct: 35  ITTFLLLAGLAVLIVWLIYRPHKPRFTVVGAAVYDLNTTSPPFISTSMQFTIFTRNPNTR 94

Query: 266 VGFIYD 283
           V  +YD
Sbjct: 95  VSIMYD 100

[123][TOP]
>UniRef100_Q2QXF1 Os12g0159600 protein n=2 Tax=Oryza sativa RepID=Q2QXF1_ORYSJ
          Length = 212

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 5/82 (6%)
 Frame = +2

Query: 65  CCWTIFVIILLLLIVAAASAVVYLIYRPQRPSF-----TVSELKISTLNFTSAVRLTTAI 229
           C   I V+++L ++V   + +VYL+ RP  P F     T+ +L +S  + T+   L+T I
Sbjct: 17  CRRFITVLVVLAILVGIIALIVYLVLRPTHPRFYLQDATLRQLDLSNSSSTAGGVLSTTI 76

Query: 230 SLSVIARNPNKNVGFIYDVTDI 295
            ++V +RNPN  VG  YD  D+
Sbjct: 77  QVTVASRNPNDRVGVYYDRLDV 98

[124][TOP]
>UniRef100_Q9M154 Putative uncharacterized protein AT4g01110 n=1 Tax=Arabidopsis
           thaliana RepID=Q9M154_ARATH
          Length = 265

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 34/111 (30%), Positives = 55/111 (49%), Gaps = 6/111 (5%)
 Frame = +2

Query: 14  PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL 193
           P  +R+ S  R  CC C C T+ ++ILLL++  +   V +L Y P+ P   +S  ++S  
Sbjct: 52  PTKKRQWSRCRVFCC-CVCITVAIVILLLILTVS---VFFLYYSPRLPVVRLSSFRVSNF 107

Query: 194 NFTSA------VRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDD 328
           NF+         +LT   +  +  RNPN  + + Y   D+ +   S G DD
Sbjct: 108 NFSGGKAGDGLSQLTAEATARLDFRNPNGKLRYYYGNVDVAV---SVGEDD 155

[125][TOP]
>UniRef100_Q5XV90 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q5XV90_ARATH
          Length = 261

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 34/111 (30%), Positives = 55/111 (49%), Gaps = 6/111 (5%)
 Frame = +2

Query: 14  PAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTL 193
           P  +R+ S  R  CC C C T+ ++ILLL++  +   V +L Y P+ P   +S  ++S  
Sbjct: 52  PTKKRQWSRCRVFCC-CVCITVAIVILLLILTVS---VFFLYYSPRLPVVRLSSFRVSNF 107

Query: 194 NFTSA------VRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDD 328
           NF+         +LT   +  +  RNPN  + + Y   D+ +   S G DD
Sbjct: 108 NFSGGKAGDGLSQLTAEATARLDFRNPNGKLRYYYGNVDVAV---SVGEDD 155

[126][TOP]
>UniRef100_B0ZVY9 NHL3 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=B0ZVY9_ARATH
          Length = 172

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +2

Query: 53  CCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTA 226
           CC CC  ++   ++I + +++  A+ +++LI+RP    F V++ K++         L   
Sbjct: 1   CCGCCILSVIFNILITIAVLLGIAALIIWLIFRPNAIKFHVTDAKLTEFTLDXTNNLRYN 60

Query: 227 ISLSVIARNPNKNVGFIYDVTDITLY 304
           + L+   RNPN+ +G  YD  ++  Y
Sbjct: 61  LDLNFTIRNPNRRIGVYYDEIEVRGY 86

[127][TOP]
>UniRef100_B0ZVS1 NHL3 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=B0ZVS1_ARATH
          Length = 167

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +2

Query: 53  CCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTA 226
           CC CC  ++   ++I + +++  A+ +++LI+RP    F V++ K++         L   
Sbjct: 1   CCGCCILSVIFNILITIAVLLGIAALIIWLIFRPNAIKFHVTDAKLTEFTLDPTNNLRYN 60

Query: 227 ISLSVIARNPNKNVGFIYDVTDITLY 304
           + L+   RNPN+ +G  YD  ++  Y
Sbjct: 61  LDLNFTIRNPNRRIGVYYDEIEVRGY 86

[128][TOP]
>UniRef100_B0ZVQ4 NHL3 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=B0ZVQ4_ARATH
          Length = 169

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +2

Query: 53  CCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTA 226
           CC CC  ++   ++I + +++  A+ +++LI+RP    F V++ K++         L   
Sbjct: 1   CCGCCILSVIFNILITIXVLLGIAALIIWLIFRPNAIKFHVTDAKLTEFTLDPTNNLRYN 60

Query: 227 ISLSVIARNPNKNVGFIYDVTDITLY 304
           + L+   RNPN+ +G  YD  ++  Y
Sbjct: 61  LDLNFTIRNPNRRIGVYYDEIEVRGY 86

[129][TOP]
>UniRef100_B0ZVQ2 NHL3 (Fragment) n=2 Tax=Arabidopsis thaliana RepID=B0ZVQ2_ARATH
          Length = 168

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +2

Query: 53  CCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTA 226
           CC CC  ++   ++I + +++  A+ +++LI+RP    F V++ K++         L   
Sbjct: 1   CCGCCILSVIFNILITIAVLLGIAALIIWLIFRPNAIKFHVTDAKLTEFTLDPTNNLRYN 60

Query: 227 ISLSVIARNPNKNVGFIYDVTDITLY 304
           + L+   RNPN+ +G  YD  ++  Y
Sbjct: 61  LDLNFTIRNPNRRIGVYYDEIEVRGY 86

[130][TOP]
>UniRef100_B0ZVP9 NHL3 (Fragment) n=2 Tax=Arabidopsis thaliana RepID=B0ZVP9_ARATH
          Length = 172

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +2

Query: 53  CCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTA 226
           CC CC  ++   ++I + +++  A+ +++LI+RP    F V++ K++         L   
Sbjct: 1   CCGCCILSVIFNILITIAVLLGIAALIIWLIFRPNAIKFHVTDAKLTEFTLDPTNNLRYN 60

Query: 227 ISLSVIARNPNKNVGFIYDVTDITLY 304
           + L+   RNPN+ +G  YD  ++  Y
Sbjct: 61  LDLNFTIRNPNRRIGVYYDEIEVRGY 86

[131][TOP]
>UniRef100_B0ZVP8 NHL3 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=B0ZVP8_ARATH
          Length = 172

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +2

Query: 53  CCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTA 226
           CC CC  ++   ++I + +++  A+ +++LI+RP    F V++ K++         L   
Sbjct: 1   CCGCCILSVIFNILITIAVLLGIAALIIWLIFRPNAIKFHVTDAKLTEFTLDPTNNLRYN 60

Query: 227 ISLSVIARNPNKNVGFIYDVTDITLY 304
           + L+   RNPN+ +G  YD  ++  Y
Sbjct: 61  LDLNFTIRNPNRRIGVYYDEIEVRGY 86

[132][TOP]
>UniRef100_Q9LKQ2 NDR1/HIN1-like protein 3 n=1 Tax=Arabidopsis thaliana
           RepID=Q9LKQ2_ARATH
          Length = 230

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 28/105 (26%), Positives = 52/105 (49%), Gaps = 13/105 (12%)
 Frame = +2

Query: 11  PPAGRRRTSHTR-----GC------CCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQ 151
           PP  +   SH R     GC      CC CC  ++   ++I + +++  A+ +++LI+RP 
Sbjct: 14  PPPKKVSHSHGRRGGGCGCLGDCLGCCGCCILSVIFNILITIAVLLGIAALIIWLIFRPN 73

Query: 152 RPSFTVSELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDV 286
              F V++ K++         L   + L+   RNPN+ +G  Y++
Sbjct: 74  AIKFHVTDAKLTEFTLDPTNNLRYNLDLNFTIRNPNRRIGVYYEI 118

[133][TOP]
>UniRef100_Q8H1B5 Hin1-like protein n=1 Tax=Solanum tuberosum RepID=Q8H1B5_SOLTU
          Length = 225

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCR-------CCCWTIFVIILLLLIVAAASAVV-YLIYRPQRPSFT 166
           PP  +    H RG  C        C C  IF II  +LIV    A+V +L+ RP + +F 
Sbjct: 14  PPPSKSYHRHGRGSSCNPCSCLFGCLCNCIFQIIFTILIVLGVIALVLWLVLRPNKVNFY 73

Query: 167 VSELKISTLNF-TSAVRLTTAISLSVIARNPNKNVGFIYD 283
           V++  ++  ++ T+   L   ++L++  RNPNK +G  YD
Sbjct: 74  VTDATLTQFDYSTTNNTLYYDLALNMTIRNPNKRIGIYYD 113

[134][TOP]
>UniRef100_Q32ZJ1 HIN1-like protein (Fragment) n=1 Tax=Solanum tuberosum
           RepID=Q32ZJ1_SOLTU
          Length = 208

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCR-------CCCWTIFVIILLLLIVAAASAVV-YLIYRPQRPSFT 166
           PP  +    H RG  C        C C  IF II  +LIV    A+V +L+ RP + +F 
Sbjct: 9   PPPSKSYHRHGRGSSCNPCSCLFGCLCNCIFQIIFTILIVLGVIALVLWLVLRPNKVNFY 68

Query: 167 VSELKISTLNF-TSAVRLTTAISLSVIARNPNKNVGFIYD 283
           V++  ++  ++ T+   L   ++L++  RNPNK +G  YD
Sbjct: 69  VTDATLTQFDYSTTNNTLYYDLALNMTIRNPNKRIGIYYD 108

[135][TOP]
>UniRef100_B4FTJ5 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FTJ5_MAIZE
          Length = 213

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 5/84 (5%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSF-----TVSELKISTLNFTSAVRLTT 223
           R C   + ++++L LIV   + ++YL+ RP  P F     ++ +L +S     S+  L+T
Sbjct: 16  RSCRRLLAILLVLALIVGVIALIIYLVVRPTHPRFYLQDASLQQLDLSNSTTPSSSLLST 75

Query: 224 AISLSVIARNPNKNVGFIYDVTDI 295
            + +++ +RNPN+ VG  YD  D+
Sbjct: 76  TLQVTLASRNPNERVGVYYDRLDV 99

[136][TOP]
>UniRef100_B0ZVQ1 NHL3 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=B0ZVQ1_ARATH
          Length = 172

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +2

Query: 53  CCRCCCWTIF--VIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVRLTTA 226
           CC CC  ++   ++I + +++  A+ +++LI+RP    F V++ K++         L   
Sbjct: 1   CCGCCILSVXFNILITIAVLLGIAALIIWLIFRPNAIKFHVTDAKLTEFTLDPTNNLRYN 60

Query: 227 ISLSVIARNPNKNVGFIYDVTDITLY 304
           + L+   RNPN+ +G  YD  ++  Y
Sbjct: 61  LDLNFTIRNPNRRIGVYYDEIEVRGY 86

[137][TOP]
>UniRef100_Q75QH3 Hin1 like protein n=1 Tax=Capsicum chinense RepID=Q75QH3_CAPCH
          Length = 228

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 9/100 (9%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCR-------CCCWTIFVIILLLLIVAAASAVV-YLIYRPQRPSFT 166
           PP  +    H RG  C        C C  IF II  +LIV    A+V +L+ RP +  F 
Sbjct: 16  PPPSKSYHRHGRGSSCNPCSCLFGCLCNCIFQIIFTILIVLGVIALVLWLVLRPNKVKFY 75

Query: 167 VSELKISTLNFTSAVR-LTTAISLSVIARNPNKNVGFIYD 283
           V++  ++  + ++A   L   ++L++  RNPNK +G  YD
Sbjct: 76  VTDATLTQFDLSTANNTLYYDLALNMTIRNPNKRIGIYYD 115

[138][TOP]
>UniRef100_Q6L7J8 Harpin inducing protein 1-like 9 n=1 Tax=Nicotiana tabacum
           RepID=Q6L7J8_TOBAC
          Length = 229

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 33/104 (31%), Positives = 53/104 (50%), Gaps = 13/104 (12%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCR-------CCCWTIFVIIL-LLLIVAAASAVVYLIYRPQRPSF- 163
           PP+ +    H RG  C        C C  IF I   +L+I+  A+ V++L+ RP +  F 
Sbjct: 16  PPSSKTYHHHGRGSSCNPCSCLFGCLCNCIFQIFFTILVIIGVAALVLWLVLRPNKVKFY 75

Query: 164 ----TVSELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYD 283
               T+++  +ST N T    +   ++L++  RNPNK +G  YD
Sbjct: 76  VTDATLTQFDLSTTNNT----INYDLALNMTIRNPNKRIGIYYD 115

[139][TOP]
>UniRef100_B9GQG2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GQG2_POPTR
          Length = 240

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 3/113 (2%)
 Frame = +2

Query: 2   AYRPPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELK 181
           A  PP+   R   +R C    CC ++ +II +LL++  A  + YL + P+ P F +   K
Sbjct: 34  ALLPPSFEPRKRRSRHCRLCLCCLSLLLIIAILLMI-IAGGLFYLWFDPKLPVFHLQSFK 92

Query: 182 ISTLNFT---SAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDDD 331
            S  N T       LT  +   +  RNPN+N+ + +  + +     +T GDD+
Sbjct: 93  FSAFNITKRSDGTYLTAKMVARIEVRNPNENIIYHFGESKV----ETTAGDDE 141

[140][TOP]
>UniRef100_Q69U64 Os08g0102700 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q69U64_ORYSJ
          Length = 227

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 13/92 (14%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVR-------- 214
           R CC  IF I+LLLL++     +V+LI RP +P F +++L +  LN T+           
Sbjct: 19  RRCCAAIFGILLLLLLIVL---IVWLILRPTKPRFYLNDLTVVCLNVTTGGSYAGATASS 75

Query: 215 -----LTTAISLSVIARNPNKNVGFIYDVTDI 295
                LT  +  ++ ARN N+ VG  YD  D+
Sbjct: 76  GYFSFLTVTMQTTLAARNGNERVGIYYDRADV 107

[141][TOP]
>UniRef100_C5YS71 Putative uncharacterized protein Sb08g003720 n=1 Tax=Sorghum
           bicolor RepID=C5YS71_SORBI
          Length = 214

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 7/86 (8%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVS-------ELKISTLNFTSAVRL 217
           R C   + ++++L L+VA  + ++YL+ RP  P F +        +L  +T   ++A  L
Sbjct: 15  RSCRRLLAILLVLALLVALIALIIYLVLRPTHPRFFLQDASLRQLDLSNTTTTTSAAGAL 74

Query: 218 TTAISLSVIARNPNKNVGFIYDVTDI 295
           +T + ++V +RNPN  VG  YD  D+
Sbjct: 75  STTLQVTVASRNPNDKVGVYYDRLDV 100

[142][TOP]
>UniRef100_A2YQC2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2YQC2_ORYSI
          Length = 205

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 13/92 (14%)
 Frame = +2

Query: 59  RCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKISTLNFTSAVR-------- 214
           R CC  IF I+LLLL++     +V+LI RP +P F +++L +  LN T+           
Sbjct: 19  RRCCAAIFGILLLLLLIVL---IVWLILRPTKPRFYLNDLTVVCLNVTTGGSYAGATASS 75

Query: 215 -----LTTAISLSVIARNPNKNVGFIYDVTDI 295
                LT  +  ++ ARN N+ VG  YD  D+
Sbjct: 76  GYFSFLTVTMQTTLAARNGNERVGIYYDRADV 107

[143][TOP]
>UniRef100_UPI0001738F6F unknown protein n=1 Tax=Arabidopsis thaliana RepID=UPI0001738F6F
          Length = 289

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 36/103 (34%), Positives = 53/103 (51%), Gaps = 6/103 (5%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           P   +RR S  R  CC  C   +F +ILLL+++A A  V +L Y P+ P   ++  KIS 
Sbjct: 57  PADKKRRCSFCRVFCC--CVCILFAVILLLILIAVA--VFFLWYSPKLPVVRLASFKISN 112

Query: 191 LNFTSAV-----RLTTAISLSVI-ARNPNKNVGFIYDVTDITL 301
            NF+           +A + SV+  RNPN  + F Y  TD+ +
Sbjct: 113 FNFSDGKSDDGWSFLSADTTSVLDFRNPNGKLTFYYGDTDVAV 155

[144][TOP]
>UniRef100_Q9LMN2 F22L4.1 protein n=1 Tax=Arabidopsis thaliana RepID=Q9LMN2_ARATH
          Length = 1025

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 36/103 (34%), Positives = 53/103 (51%), Gaps = 6/103 (5%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           P   +RR S  R  CC  C   +F +ILLL+++A A  V +L Y P+ P   ++  KIS 
Sbjct: 57  PADKKRRCSFCRVFCC--CVCILFAVILLLILIAVA--VFFLWYSPKLPVVRLASFKISN 112

Query: 191 LNFTSAV-----RLTTAISLSVI-ARNPNKNVGFIYDVTDITL 301
            NF+           +A + SV+  RNPN  + F Y  TD+ +
Sbjct: 113 FNFSDGKSDDGWSFLSADTTSVLDFRNPNGKLTFYYGDTDVAV 155

[145][TOP]
>UniRef100_Q2R1Y2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=Q2R1Y2_ORYSJ
          Length = 324

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 38/112 (33%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = +2

Query: 11  PPAGRRRT-----SHTRGCCCRCCCWTIFVIILLLLIVAAASA-VVYLIYRPQRPSFTVS 172
           PPA  RR       HTR  C      T+  ++L+LL+VA     VV+L  RP RP F V 
Sbjct: 14  PPASGRRARWRVAEHTRASCTTVVANTLCTLLLVLLLVAGVVLFVVWLSLRPHRPRFAVV 73

Query: 173 ELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDD 328
              + +   T        ++ +V  RNPN+++G  YD T   +     GGDD
Sbjct: 74  SFTVVSPPATGGGG-HQKVAFNVSDRNPNRHIGIHYDATRAAVL---YGGDD 121

[146][TOP]
>UniRef100_B9G8D2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9G8D2_ORYSJ
          Length = 216

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 38/112 (33%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = +2

Query: 11  PPAGRRRT-----SHTRGCCCRCCCWTIFVIILLLLIVAAASA-VVYLIYRPQRPSFTVS 172
           PPA  RR       HTR  C      T+  ++L+LL+VA     VV+L  RP RP F V 
Sbjct: 14  PPASGRRARWRVAEHTRASCTTVVANTLCTLLLVLLLVAGVVLFVVWLSLRPHRPRFAVV 73

Query: 173 ELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKASTGGDD 328
              + +   T        ++ +V  RNPN+++G  YD T   +     GGDD
Sbjct: 74  SFTVVSPPATGGGG-HQKVAFNVSDRNPNRHIGIHYDATRAAVL---YGGDD 121

[147][TOP]
>UniRef100_B3H6G3 Uncharacterized protein At1g01453.1 n=1 Tax=Arabidopsis thaliana
           RepID=B3H6G3_ARATH
          Length = 267

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 36/103 (34%), Positives = 53/103 (51%), Gaps = 6/103 (5%)
 Frame = +2

Query: 11  PPAGRRRTSHTRGCCCRCCCWTIFVIILLLLIVAAASAVVYLIYRPQRPSFTVSELKIST 190
           P   +RR S  R  CC  C   +F +ILLL+++A A  V +L Y P+ P   ++  KIS 
Sbjct: 57  PADKKRRCSFCRVFCC--CVCILFAVILLLILIAVA--VFFLWYSPKLPVVRLASFKISN 112

Query: 191 LNFTSAV-----RLTTAISLSVI-ARNPNKNVGFIYDVTDITL 301
            NF+           +A + SV+  RNPN  + F Y  TD+ +
Sbjct: 113 FNFSDGKSDDGWSFLSADTTSVLDFRNPNGKLTFYYGDTDVAV 155