AV529905 ( APZL51g03R )

[UP]


[1][TOP]
>UniRef100_O22476 Protein BRASSINOSTEROID INSENSITIVE 1 n=1 Tax=Arabidopsis thaliana
           RepID=BRI1_ARATH
          Length = 1196

 Score =  335 bits (858), Expect = 2e-90
 Identities = 168/169 (99%), Positives = 169/169 (100%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS
Sbjct: 332 VPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 391

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY
Sbjct: 392 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 451

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL
Sbjct: 452 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 500

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 64/170 (37%), Positives = 88/170 (51%), Gaps = 4/170 (2%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 214
           PF G CS L+ L +S N  SG+     +     LK+L++S N+F G +P        SL 
Sbjct: 239 PFLGDCSALQHLDISGNKLSGDFSR-AISTCTELKLLNISSNQFVGPIPPLPLK---SLQ 294

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS 394
            L L+ N F+G I P+      +TL  L L  N F G +PP   +CS L SL LS N  S
Sbjct: 295 YLSLAENKFTGEI-PDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFS 353

Query: 395 GTIPSSLGSLSKLRDLK---LWLNMLEGEIPQELMYVK-TLETLILDFND 532
           G +P  + +L K+R LK   L  N   GE+P+ L  +  +L TL L  N+
Sbjct: 354 GELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 401

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 60/152 (39%), Positives = 78/152 (51%), Gaps = 2/152 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           +PP   +CS L SL LS N  SG +P  + +L K+R LK   L  N   GE+P+ L  + 
Sbjct: 432 IPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK---LWLNMLEGEIPQELMYVK 488

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
            +L TL L  N+ +G I P+   N  N L  + L NN  TG+IP  +     L  L LS 
Sbjct: 489 -TLETLILDFNDLTGEI-PSGLSNCTN-LNWISLSNNRLTGEIPKWIGRLENLAILKLSN 545

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           N  SG IP+ LG    L  L L  N+  G IP
Sbjct: 546 NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIP 577

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 49/129 (37%), Positives = 74/129 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS S L  L L  N   GE+P + L+ ++ L+ L L FN+ +GE+P  L+N + +
Sbjct: 456 IPSSLGSLSKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDFNDLTGEIPSGLSNCT-N 513

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + LS+N  +G I P      +N L  L L NN F+G IP  L +C  L+ L L+ N 
Sbjct: 514 LNWISLSNNRLTGEI-PKWIGRLEN-LAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL 571

Query: 389 LSGTIPSSL 415
            +GTIP+++
Sbjct: 572 FNGTIPAAM 580

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 73/232 (31%), Positives = 93/232 (40%), Gaps = 69/232 (29%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG----------------E 175
           GSCS L+ L +SSN       +   LK+  L+VLDLS N  SG                 
Sbjct: 145 GSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKH 204

Query: 176 LPESLTNLS--------ASLLTLDLSSNNFSGPI-------------------------- 253
           L  S   +S         +L  LD+SSNNFS  I                          
Sbjct: 205 LAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRA 264

Query: 254 --------LPNLCQN---------PKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLS 379
                   L N+  N         P  +LQ L L  N FTG+IP  LS  C  L  L LS
Sbjct: 265 ISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLS 324

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDFND 532
            N+  G +P   GS S L  L L  N   GE+P + L+ ++ L+ L L FN+
Sbjct: 325 GNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE 376

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/188 (27%), Positives = 82/188 (43%), Gaps = 19/188 (10%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P + G    L  L LS+N+FSG +P + L   R L  LDL+ N F+G +P ++   S  
Sbjct: 528  IPKWIGRLENLAILKLSNNSFSGNIPAE-LGDCRSLIWLDLNTNLFNGTIPAAMFKQSGK 586

Query: 209  LLTLDLSSNNF---SGPILPNLCQNPKNTLQ----------------ELYLQNNGFTGKI 331
            +    ++   +       +   C    N L+                   + +  + G  
Sbjct: 587  IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHT 646

Query: 332  PPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLET 511
             PT  N   ++ L +S+N LSG IP  +GS+  L  L L  N + G IP E+  ++ L  
Sbjct: 647  SPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNI 706

Query: 512  LILDFNDL 535
            L L  N L
Sbjct: 707  LDLSSNKL 714

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 32/75 (42%), Positives = 47/75 (62%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS   L  L L  N+ SG +P D +  +RGL +LDLS N+  G +P++++ L+  
Sbjct: 670 IPKEIGSMPYLFILNLGHNDISGSIP-DEVGDLRGLNILDLSSNKLDGRIPQAMSALT-M 727

Query: 209 LLTLDLSSNNFSGPI 253
           L  +DLS+NN SGPI
Sbjct: 728 LTEIDLSNNNLSGPI 742

[2][TOP]
>UniRef100_B9H5M2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H5M2_POPTR
          Length = 1184

 Score =  224 bits (570), Expect = 4e-57
 Identities = 113/169 (66%), Positives = 133/169 (78%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FGSC+ LES  +S+NNF+GELP DT LKM  LK LDL++N F G LP+SL+   AS
Sbjct: 331 VPNSFGSCTSLESFDISTNNFTGELPFDTFLKMTSLKRLDLAYNAFMGGLPDSLSQ-HAS 389

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L +LDLSSN+ SGPI   LCQ P N  +ELYLQNN FTG IP TLSNCS+L +LHLS+NY
Sbjct: 390 LESLDLSSNSLSGPIPAGLCQVPSNNFKELYLQNNRFTGSIPATLSNCSQLTALHLSYNY 449

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GTIPSSLG+L+KLRDL LW N L GEIP ELM +K LETLILDFN+L
Sbjct: 450 LTGTIPSSLGTLNKLRDLNLWFNQLHGEIPLELMNIKALETLILDFNEL 498

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 65/165 (39%), Positives = 90/165 (54%), Gaps = 2/165 (1%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F SC  L+ L +SSNNFS  +P  +      L+ LD+S N+F G+L  ++      L  L
Sbjct: 217 FSSCKNLQYLDVSSNNFSVTVP--SFGDCLALEHLDISSNKFYGDLGRAIGG-CVKLNFL 273

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYLSG 397
           ++SSN FSGPI P     P   LQ L L  N F G+IP  L + C  LV L LS N LSG
Sbjct: 274 NISSNKFSGPI-PVF---PTGNLQSLSLGGNHFEGEIPLHLMDACPGLVMLDLSSNNLSG 329

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIP-QELMYVKTLETLILDFN 529
           ++P+S GS + L    +  N   GE+P    + + +L+ L L +N
Sbjct: 330 SVPNSFGSCTSLESFDISTNNFTGELPFDTFLKMTSLKRLDLAYN 374

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 70/178 (39%), Positives = 92/178 (51%), Gaps = 4/178 (2%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSL----LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP 181
           SL  P+P   G C +     + L L +N F+G +P  TL     L  L LS+N  +G +P
Sbjct: 399 SLSGPIPA--GLCQVPSNNFKELYLQNNRFTGSIPA-TLSNCSQLTALHLSYNYLTGTIP 455

Query: 182 ESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL 361
            SL  L+  L  L+L  N   G I P    N K  L+ L L  N  TG IP ++SNC+ L
Sbjct: 456 SSLGTLN-KLRDLNLWFNQLHGEI-PLELMNIK-ALETLILDFNELTGVIPSSISNCTNL 512

Query: 362 VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             + LS N LSG IP+S+G L  L  LKL  N   G +P EL   ++L  L L+ N L
Sbjct: 513 NWISLSNNRLSGEIPASIGQLWSLAILKLSNNSFHGRVPPELGDSRSLIWLDLNTNFL 570

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 57/153 (37%), Positives = 79/153 (51%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    +CS L +L LS N  +G +P  +L  +  L+ L+L FN+  GE+P  L N+ A 
Sbjct: 430 IPATLSNCSQLTALHLSYNYLTGTIP-SSLGTLNKLRDLNLWFNQLHGEIPLELMNIKA- 487

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TL L  N  +G ++P+   N  N L  + L NN  +G+IP ++     L  L LS N 
Sbjct: 488 LETLILDFNELTG-VIPSSISNCTN-LNWISLSNNRLSGEIPASIGQLWSLAILKLSNNS 545

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
             G +P  LG    L  L L  N L G IP EL
Sbjct: 546 FHGRVPPELGDSRSLIWLDLNTNFLNGTIPPEL 578

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 48/148 (32%), Positives = 71/148 (47%), Gaps = 4/148 (2%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLK--VLDLSFNEFSGE--LPESLTNLSASLL 214
           SC  L+SL LS N+    +P +    +RGL    +DLSFN+  G   +P  L+     L 
Sbjct: 143 SCPALKSLGLSGNSIEFSVPKEKSSGLRGLSFTFIDLSFNKIVGSNVVPFILSGGCNDLK 202

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS 394
            L L  N  SG +  + C+N    LQ L + +N F+  + P+  +C  L  L +S N   
Sbjct: 203 YLALKGNKVSGDVDFSSCKN----LQYLDVSSNNFSVTV-PSFGDCLALEHLDISSNKFY 257

Query: 395 GTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           G +  ++G   KL  L +  N   G IP
Sbjct: 258 GDLGRAIGGCVKLNFLNISSNKFSGPIP 285

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 41/104 (39%), Positives = 60/104 (57%), Gaps = 1/104 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS S L  L L  NN SG +P + + K+ GL +LDLS N   G +P+S+T LS  
Sbjct: 666 IPAAIGSMSYLYILNLGHNNLSGNIPQE-IGKLTGLDILDLSNNRLEGMIPQSMTVLSL- 723

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG-KIPP 337
           L  +D+S+N+ +G I+P   Q  +  L   +L N+G  G  +PP
Sbjct: 724 LSEIDMSNNHLTG-IIPEGGQF-QTFLNRSFLNNSGLCGIPLPP 765

[3][TOP]
>UniRef100_B9HG53 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HG53_POPTR
          Length = 1193

 Score =  221 bits (564), Expect = 2e-56
 Identities = 111/169 (65%), Positives = 134/169 (79%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GSC+ LE+L +S NNF+GELP+DTLLKM  LK LDL++N F+G LP+S +   AS
Sbjct: 335 VPSSLGSCTSLETLHISINNFTGELPVDTLLKMTSLKRLDLAYNAFTGGLPDSFSQ-HAS 393

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L +LDLSSN+ SGPI   LC+ P N L+ELYLQNN FTG +P TLSNCS+L +LHLSFNY
Sbjct: 394 LESLDLSSNSLSGPIPTGLCRGPSNNLKELYLQNNRFTGSVPATLSNCSQLTALHLSFNY 453

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GTIPSSLGSL +LRDL LW N L GEIP ELM ++ LETLILDFN+L
Sbjct: 454 LTGTIPSSLGSLYELRDLNLWFNQLHGEIPPELMNIEALETLILDFNEL 502

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 71/176 (40%), Positives = 90/176 (51%), Gaps = 2/176 (1%)
 Frame = +2

Query: 14  SLELPLPPFF--GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           SL  P+P     G  + L+ L L +N F+G +P  TL     L  L LSFN  +G +P S
Sbjct: 403 SLSGPIPTGLCRGPSNNLKELYLQNNRFTGSVPA-TLSNCSQLTALHLSFNYLTGTIPSS 461

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           L +L   L  L+L  N   G I P L       L+ L L  N  TG IP  +SNC+ L  
Sbjct: 462 LGSLY-ELRDLNLWFNQLHGEIPPELMNI--EALETLILDFNELTGVIPSGISNCTNLNW 518

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           + LS N LSG IP+S+G L  L  LKL  N   G IP EL   ++L  L L+ N L
Sbjct: 519 ISLSNNRLSGEIPASIGKLGSLAILKLSNNSFYGRIPPELGDCRSLIWLDLNSNFL 574

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 66/167 (39%), Positives = 95/167 (56%), Gaps = 4/167 (2%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F SC  L+ L +S+NNFS  +P  +  K   L+ LD+S N+F G+L  ++      L  L
Sbjct: 221 FSSCKNLQYLDVSANNFSSSVP--SFGKCLALEHLDISANKFYGDLGHAI-GACVKLNFL 277

Query: 221 DLSSNNFSG--PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYL 391
           ++SSN FSG  P+LP        +LQ L L  N F G IP  L + C  L  L LS N L
Sbjct: 278 NVSSNKFSGSIPVLPTA------SLQSLSLGGNLFEGGIPLHLVDACPGLFMLDLSSNNL 331

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDFN 529
           +G++PSSLGS + L  L + +N   GE+P + L+ + +L+ L L +N
Sbjct: 332 TGSVPSSLGSCTSLETLHISINNFTGELPVDTLLKMTSLKRLDLAYN 378

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 62/173 (35%), Positives = 89/173 (51%), Gaps = 6/173 (3%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGEL--PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P FG C  LE L +S+N F G+L   +   +K   L  L++S N+FSG +P   T   AS
Sbjct: 242 PSFGKCLALEHLDISANKFYGDLGHAIGACVK---LNFLNVSSNKFSGSIPVLPT---AS 295

Query: 209 LLTLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L +L L  N F G I   L + C      L  L L +N  TG +P +L +C+ L +LH+S
Sbjct: 296 LQSLSLGGNLFEGGIPLHLVDACPG----LFMLDLSSNNLTGSVPSSLGSCTSLETLHIS 351

Query: 380 FNYLSGTIP-SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            N  +G +P  +L  ++ L+ L L  N   G +P       +LE+L L  N L
Sbjct: 352 INNFTGELPVDTLLKMTSLKRLDLAYNAFTGGLPDSFSQHASLESLDLSSNSL 404

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 49/129 (37%), Positives = 72/129 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS   L  L L  N   GE+P + L+ +  L+ L L FNE +G +P  ++N + +
Sbjct: 458 IPSSLGSLYELRDLNLWFNQLHGEIPPE-LMNIEALETLILDFNELTGVIPSGISNCT-N 515

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + LS+N  SG I  ++      +L  L L NN F G+IPP L +C  L+ L L+ N+
Sbjct: 516 LNWISLSNNRLSGEIPASI--GKLGSLAILKLSNNSFYGRIPPELGDCRSLIWLDLNSNF 573

Query: 389 LSGTIPSSL 415
           L+GTIP  L
Sbjct: 574 LNGTIPPEL 582

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 54/165 (32%), Positives = 79/165 (47%), Gaps = 4/165 (2%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGL--KVLDLSFNEFSGE--LPESLTNLSASLL 214
           SC  L+SL LS N+    +  +    +RGL  K LDLSFN+  G   +P  L+     L 
Sbjct: 147 SCPALKSLDLSGNSIEFSVHEEKSSGLRGLSFKFLDLSFNKIVGSNAVPFILSEGCNELK 206

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS 394
            L L  N  SG I  + C+N    LQ L +  N F+  + P+   C  L  L +S N   
Sbjct: 207 HLALKGNKLSGDIDFSSCKN----LQYLDVSANNFSSSV-PSFGKCLALEHLDISANKFY 261

Query: 395 GTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           G +  ++G+  KL  L +  N   G IP  ++   +L++L L  N
Sbjct: 262 GDLGHAIGACVKLNFLNVSSNKFSGSIP--VLPTASLQSLSLGGN 304

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 41/110 (37%), Positives = 56/110 (50%), Gaps = 3/110 (2%)
 Frame = +2

Query: 86  NFS---GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPIL 256
           NFS   GE    T      +  LDLS+N  SG +P ++ ++S  L  L L  NNFSG I 
Sbjct: 637 NFSRVYGEYTQPTFNDNGSMIFLDLSYNMLSGSIPAAIGSMSY-LYVLILGHNNFSGNIP 695

Query: 257 PNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
             +       L  L L NN   G IPP+++  S L  + +S N+L+G IP
Sbjct: 696 QEI--GKLTGLDILDLSNNRLEGIIPPSMTGLSLLSEIDMSNNHLTGMIP 743

[4][TOP]
>UniRef100_B9T4K2 Serine/threonine-protein kinase bri1, putative n=1 Tax=Ricinus
           communis RepID=B9T4K2_RICCO
          Length = 1086

 Score =  218 bits (556), Expect = 2e-55
 Identities = 109/169 (64%), Positives = 134/169 (79%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  F +C+ L+S  +S NNF+GELP++T+ KM  LK LD S+N F G LP+S +NL+ S
Sbjct: 230 IPSSFAACTSLQSFDISINNFAGELPINTIFKMSSLKNLDFSYNFFIGGLPDSFSNLT-S 288

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDLSSNN SGPI   LC++P + L+EL+LQNN FTG IP TLSNCS+L SLHLSFNY
Sbjct: 289 LEILDLSSNNLSGPIPSGLCKDPNSNLKELFLQNNLFTGSIPATLSNCSQLTSLHLSFNY 348

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GTIPSS GSLSKLRDLKLW N+L GEIP E+  ++TLETLILDFN+L
Sbjct: 349 LTGTIPSSFGSLSKLRDLKLWFNLLHGEIPPEITNIQTLETLILDFNEL 397

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 73/192 (38%), Positives = 92/192 (47%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRG-LKVLDLSFNEFSGELPESLTNLSA 205
           LP  F + + LE L LSSNN SG +P          LK L L  N F+G +P +L+N S 
Sbjct: 279 LPDSFSNLTSLEILDLSSNNLSGPIPSGLCKDPNSNLKELFLQNNLFTGSIPATLSNCS- 337

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPK----------------------NTLQELYLQNNGF 319
            L +L LS N  +G I  +     K                       TL+ L L  N  
Sbjct: 338 QLTSLHLSFNYLTGTIPSSFGSLSKLRDLKLWFNLLHGEIPPEITNIQTLETLILDFNEL 397

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           TG IP  +SNCS+L  + LS N L+G IP+S+G LS L  LKL  N   G IP EL    
Sbjct: 398 TGVIPSGISNCSKLNWISLSNNRLTGEIPASIGQLSNLAILKLSNNSFYGRIPPELGDCS 457

Query: 500 TLETLILDFNDL 535
           +L  L L+ N L
Sbjct: 458 SLIWLDLNTNFL 469

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 62/167 (37%), Positives = 97/167 (58%), Gaps = 6/167 (3%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPM--DTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           +C  L+ L +SSNNF+  +P   D L     L+ LD+S NEF G+L  ++++  A L  L
Sbjct: 118 TCKNLQFLDVSSNNFNISIPSFGDCL----ALEHLDISSNEFYGDLAHAISDC-AKLNFL 172

Query: 221 DLSSNNFSG--PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYL 391
           ++S+N+FSG  P+LP        +LQ +YL  N F G+IP  L + C  L+ L LS N L
Sbjct: 173 NVSANDFSGEVPVLPT------GSLQYVYLAGNHFHGEIPLHLIDACPGLIQLDLSSNNL 226

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY-VKTLETLILDFN 529
           SG+IPSS  + + L+   + +N   GE+P   ++ + +L+ L   +N
Sbjct: 227 SGSIPSSFAACTSLQSFDISINNFAGELPINTIFKMSSLKNLDFSYN 273

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 62/155 (40%), Positives = 78/155 (50%), Gaps = 2/155 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMD--TLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           +P    +CS L SL LS N  +G +P    +L K+R LK   L FN   GE+P  +TN+ 
Sbjct: 329 IPATLSNCSQLTSLHLSFNYLTGTIPSSFGSLSKLRDLK---LWFNLLHGEIPPEITNIQ 385

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
            +L TL L  N  +G I   +    K  L  + L NN  TG+IP ++   S L  L LS 
Sbjct: 386 -TLETLILDFNELTGVIPSGISNCSK--LNWISLSNNRLTGEIPASIGQLSNLAILKLSN 442

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N   G IP  LG  S L  L L  N L G IP EL
Sbjct: 443 NSFYGRIPPELGDCSSLIWLDLNTNFLNGTIPPEL 477

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 65/211 (30%), Positives = 96/211 (45%), Gaps = 42/211 (19%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    +CS L  ++LS+N  +GE+P  ++ ++  L +L LS N F G +P  L + S S
Sbjct: 401  IPSGISNCSKLNWISLSNNRLTGEIPA-SIGQLSNLAILKLSNNSFYGRIPPELGDCS-S 458

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTL-------QELYLQNN------------------ 313
            L+ LDL++N  +G I P L +   N         + +YL+NN                  
Sbjct: 459  LIWLDLNTNFLNGTIPPELFKQSGNIAVNFITGKRYVYLRNNKSERCHGEGNLLEFAGIR 518

Query: 314  -------------GFT----GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 442
                          FT    G   PT  +   ++ L LS+N LSG IP  +G++  L  L
Sbjct: 519  SEQLDRISTRHPCAFTRVYGGHTQPTFKDNGSMIFLDLSYNKLSGCIPKEMGTMLYLYIL 578

Query: 443  KLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  N + G IPQEL  +  L  L L  N L
Sbjct: 579  NLGHNNITGSIPQELGNLDGLMILNLSNNKL 609

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 50/147 (34%), Positives = 76/147 (51%), Gaps = 4/147 (2%)
 Frame = +2

Query: 50  CSLLESLALSSN--NFSGELPMDTLLKMRGLKVLDLSFNEFSGE--LPESLTNLSASLLT 217
           C  L+SL LS+N  +FS +      LK+ GL++LD+SFN+ SG   +P  L+     L+ 
Sbjct: 44  CPSLKSLNLSTNLLDFSIKEKSFNGLKL-GLEILDISFNKISGSNVVPFILSGGCNELVY 102

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
           L L  N  SG +  + C+N    LQ L + +N F   I P+  +C  L  L +S N   G
Sbjct: 103 LALKGNKVSGDLDVSTCKN----LQFLDVSSNNFNISI-PSFGDCLALEHLDISSNEFYG 157

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            +  ++   +KL  L +  N   GE+P
Sbjct: 158 DLAHAISDCAKLNFLNVSANDFSGEVP 184

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 58/196 (29%), Positives = 82/196 (41%), Gaps = 45/196 (22%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLK--------MRGLKVLDLSFN-------- 160
            +PP  G CS L  L L++N  +G +P +   +        + G + + L  N        
Sbjct: 449  IPPELGDCSSLIWLDLNTNFLNGTIPPELFKQSGNIAVNFITGKRYVYLRNNKSERCHGE 508

Query: 161  ----EFSGELPESLTNLSA----------------------SLLTLDLSSNNFSGPILPN 262
                EF+G   E L  +S                       S++ LDLS N  SG I   
Sbjct: 509  GNLLEFAGIRSEQLDRISTRHPCAFTRVYGGHTQPTFKDNGSMIFLDLSYNKLSGCIPKE 568

Query: 263  LCQNPKNTLQELYLQN---NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 433
            +      T+  LY+ N   N  TG IP  L N   L+ L+LS N L G IP+S+  LS L
Sbjct: 569  M-----GTMLYLYILNLGHNNITGSIPQELGNLDGLMILNLSNNKLEGMIPNSMTRLSLL 623

Query: 434  RDLKLWLNMLEGEIPQ 481
              + +  N L G IP+
Sbjct: 624  TAIDMSNNELSGMIPE 639

[5][TOP]
>UniRef100_A6N8J1 Brassinosteroid insensitive 1 n=1 Tax=Nicotiana tabacum
           RepID=A6N8J1_TOBAC
          Length = 1214

 Score =  217 bits (552), Expect = 5e-55
 Identities = 112/169 (66%), Positives = 135/169 (79%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+CS LE L +S+NNFSG+LP+DTLLK+  LK + LSFN F G LPES +NL   
Sbjct: 352 VPENLGACSSLEFLDISNNNFSGKLPVDTLLKLSNLKTMVLSFNNFIGGLPESFSNL-LK 410

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TLD+SSNN +G I   +C++P ++L+ LYLQNN FTG IP +LSNCS+LVSL LSFNY
Sbjct: 411 LETLDVSSNNITGFIPSGICKDPMSSLKVLYLQNNWFTGPIPDSLSNCSQLVSLDLSFNY 470

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G IPSSLGSLSKL+DL LWLN L GEIPQELMY+K+LE LILDFNDL
Sbjct: 471 LTGKIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLKSLENLILDFNDL 519

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 63/160 (39%), Positives = 93/160 (58%), Gaps = 2/160 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L LS+NNFS   P  +      L+ LDLS N+F G++  SL++    L  L+L++N 
Sbjct: 244 LSYLDLSANNFSTGFP--SFKDCSNLEHLDLSSNKFYGDIGASLSS-CGKLSFLNLTNNQ 300

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYLSGTIPSSL 415
           F G ++P L   P  +LQ LYL+ N F G  P  L++ C  LV L LSFN  SG +P +L
Sbjct: 301 FVG-LVPKL---PSESLQFLYLRGNDFQGVFPSQLADLCKTLVELDLSFNNFSGLVPENL 356

Query: 416 GSLSKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDFND 532
           G+ S L  L +  N   G++P + L+ +  L+T++L FN+
Sbjct: 357 GACSSLEFLDISNNNFSGKLPVDTLLKLSNLKTMVLSFNN 396

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 66/181 (36%), Positives = 93/181 (51%), Gaps = 10/181 (5%)
 Frame = +2

Query: 17  LELPLPPFFG-------SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE 175
           L+L    F+G       SC  L  L L++N F G +P    L    L+ L L  N+F G 
Sbjct: 270 LDLSSNKFYGDIGASLSSCGKLSFLNLTNNQFVGLVPK---LPSESLQFLYLRGNDFQGV 326

Query: 176 LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP-PTLSNC 352
            P  L +L  +L+ LDLS NNFSG +  NL     ++L+ L + NN F+GK+P  TL   
Sbjct: 327 FPSQLADLCKTLVELDLSFNNFSGLVPENL--GACSSLEFLDISNNNFSGKLPVDTLLKL 384

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY--VKTLETLILDF 526
           S L ++ LSFN   G +P S  +L KL  L +  N + G IP  +    + +L+ L L  
Sbjct: 385 SNLKTMVLSFNNFIGGLPESFSNLLKLETLDVSSNNITGFIPSGICKDPMSSLKVLYLQN 444

Query: 527 N 529
           N
Sbjct: 445 N 445

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 60/156 (38%), Positives = 81/156 (51%), Gaps = 2/156 (1%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    +CS L SL LS N  +G++P  +L  +  LK L L  N+ SGE+P+ L  L  
Sbjct: 450 PIPDSLSNCSQLVSLDLSFNYLTGKIP-SSLGSLSKLKDLILWLNQLSGEIPQELMYLK- 507

Query: 206 SLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           SL  L L  N+ +G I  +L  C N    L  + + NN  +G+IP +L     L  L L 
Sbjct: 508 SLENLILDFNDLTGSIPASLSNCTN----LNWISMSNNLLSGEIPASLGGLPNLAILKLG 563

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            N +SG IP+ LG+   L  L L  N L G IP  L
Sbjct: 564 NNSISGNIPAELGNCQSLIWLDLNTNFLNGSIPGPL 599

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/79 (44%), Positives = 50/79 (63%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P   GS   L  L L  N+FSG +P + L  ++ + +LDLS+N  +G +P SLT+
Sbjct: 683 LEGGIPKELGSMYYLSILNLGHNDFSGVIPQE-LGGLKNVAILDLSYNRLNGSIPNSLTS 741

Query: 197 LSASLLTLDLSSNNFSGPI 253
           L+  L  LDLS+NN +GPI
Sbjct: 742 LTL-LGELDLSNNNLTGPI 759

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 39/96 (40%), Positives = 52/96 (54%)
 Frame = +2

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N + S++ LDLS N   G I   L       L  L L +N F+G IP  L     +  L 
Sbjct: 668 NHNGSMIFLDLSYNKLEGGIPKEL--GSMYYLSILNLGHNDFSGVIPQELGGLKNVAILD 725

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
           LS+N L+G+IP+SL SL+ L +L L  N L G IP+
Sbjct: 726 LSYNRLNGSIPNSLTSLTLLGELDLSNNNLTGPIPE 761

[6][TOP]
>UniRef100_A4LAP7 BRI1 protein n=1 Tax=Nicotiana benthamiana RepID=A4LAP7_NICBE
          Length = 1214

 Score =  215 bits (548), Expect = 1e-54
 Identities = 111/169 (65%), Positives = 134/169 (79%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+CS LE L +S+NNFSG+LP+DTLLK+  LK + LSFN F G LPES +NL   
Sbjct: 352 VPENLGACSSLELLDISNNNFSGKLPVDTLLKLSNLKTMVLSFNNFIGGLPESFSNL-LK 410

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TLD+SSNN +G I   +C++P ++L+ LYLQNN  TG IP +LSNCS+LVSL LSFNY
Sbjct: 411 LETLDVSSNNITGVIPSGICKDPMSSLKVLYLQNNWLTGPIPDSLSNCSQLVSLDLSFNY 470

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G IPSSLGSLSKL+DL LWLN L GEIPQELMY+K+LE LILDFNDL
Sbjct: 471 LTGKIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLKSLENLILDFNDL 519

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 66/181 (36%), Positives = 92/181 (50%), Gaps = 10/181 (5%)
 Frame = +2

Query: 17  LELPLPPFFG-------SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE 175
           L+L    F+G       SC  L  L L+SN F G +P    L    L+ + L  N F G 
Sbjct: 270 LDLSSNKFYGDIGASLSSCGRLSFLNLTSNQFVGLVPK---LPSESLQFMYLRGNNFQGV 326

Query: 176 LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP-PTLSNC 352
            P  L +L  +L+ LDLS NNFSG +  NL     ++L+ L + NN F+GK+P  TL   
Sbjct: 327 FPSQLADLCKTLVELDLSFNNFSGLVPENL--GACSSLELLDISNNNFSGKLPVDTLLKL 384

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY--VKTLETLILDF 526
           S L ++ LSFN   G +P S  +L KL  L +  N + G IP  +    + +L+ L L  
Sbjct: 385 SNLKTMVLSFNNFIGGLPESFSNLLKLETLDVSSNNITGVIPSGICKDPMSSLKVLYLQN 444

Query: 527 N 529
           N
Sbjct: 445 N 445

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 60/156 (38%), Positives = 82/156 (52%), Gaps = 2/156 (1%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    +CS L SL LS N  +G++P  +L  +  LK L L  N+ SGE+P+ L  L  
Sbjct: 450 PIPDSLSNCSQLVSLDLSFNYLTGKIP-SSLGSLSKLKDLILWLNQLSGEIPQELMYLK- 507

Query: 206 SLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           SL  L L  N+ +G I  +L  C N    L  + + NN  +G+IP +L     L  L L 
Sbjct: 508 SLENLILDFNDLTGSIPASLSNCTN----LNWISMSNNLLSGEIPASLGGLPNLAILKLG 563

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            N +SG IP+ LG+   L  L L  N+L G IP  L
Sbjct: 564 NNSISGNIPAELGNCQSLIWLDLNTNLLNGSIPGPL 599

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 78/236 (33%), Positives = 103/236 (43%), Gaps = 72/236 (30%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNF---SGELPMDTLLKMRGLKVLDLSFNEFSGE------------ 175
           FG CS L+SL LS N     S E+   TL     L+VLDLSFN  SG+            
Sbjct: 165 FGPCSNLKSLNLSKNLMDPPSKEIKASTL----SLQVLDLSFNNISGQNLFPWLSSMRFV 220

Query: 176 ---------------LPE------SLTNLSA--------------SLLTLDLSSNNFSGP 250
                          +PE      S  +LSA              +L  LDLSSN F G 
Sbjct: 221 ELEYFSLKGNKLAGNIPELDYKNLSYLDLSANNFSTGFPSFKDCSNLEHLDLSSNKFYGD 280

Query: 251 I-----------LPNLCQN---------PKNTLQELYLQNNGFTGKIPPTLSN-CSELVS 367
           I             NL  N         P  +LQ +YL+ N F G  P  L++ C  LV 
Sbjct: 281 IGASLSSCGRLSFLNLTSNQFVGLVPKLPSESLQFMYLRGNNFQGVFPSQLADLCKTLVE 340

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDFND 532
           L LSFN  SG +P +LG+ S L  L +  N   G++P + L+ +  L+T++L FN+
Sbjct: 341 LDLSFNNFSGLVPENLGACSSLELLDISNNNFSGKLPVDTLLKLSNLKTMVLSFNN 396

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 34/79 (43%), Positives = 49/79 (62%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P   GS   L  L L  N+ SG +P + L  ++ + +LDLS+N  +G +P SLT+
Sbjct: 683 LEGSIPKELGSMYYLSILNLGHNDLSGVIPQE-LGGLKNVAILDLSYNRLNGSIPNSLTS 741

Query: 197 LSASLLTLDLSSNNFSGPI 253
           L+  L  LDLS+NN +GPI
Sbjct: 742 LTL-LGELDLSNNNLTGPI 759

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 38/96 (39%), Positives = 51/96 (53%)
 Frame = +2

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N + S++ LDLS N   G I   L       L  L L +N  +G IP  L     +  L 
Sbjct: 668 NHNGSMIFLDLSYNKLEGSIPKEL--GSMYYLSILNLGHNDLSGVIPQELGGLKNVAILD 725

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
           LS+N L+G+IP+SL SL+ L +L L  N L G IP+
Sbjct: 726 LSYNRLNGSIPNSLTSLTLLGELDLSNNNLTGPIPE 761

[7][TOP]
>UniRef100_UPI00019839BC PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019839BC
          Length = 1190

 Score =  213 bits (541), Expect = 9e-54
 Identities = 111/169 (65%), Positives = 134/169 (79%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  F SCS L S+ +S NNFSG LP+DTLLK   L+ L LS+N F G LPESL+ L  +
Sbjct: 333 VPSNFQSCSSLVSIDISRNNFSGVLPIDTLLKWTNLRKLSLSYNNFVGSLPESLSKLM-N 391

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TLD+SSNNFSG I   LC +P+N+L+EL+LQNN FTG+IP  LSNCS+LVSL LSFNY
Sbjct: 392 LETLDVSSNNFSGLIPSGLCGDPRNSLKELHLQNNLFTGRIPEALSNCSQLVSLDLSFNY 451

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GTIPSSLGSL+KL+ L LWLN L G+IP+ELM +KTLE LILDFN+L
Sbjct: 452 LTGTIPSSLGSLTKLQHLMLWLNQLHGQIPEELMNLKTLENLILDFNEL 500

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 65/167 (38%), Positives = 90/167 (53%), Gaps = 1/167 (0%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 214
           P  G CS L  L LS+N FSGE+  + L   + L  L+LS N F+G +P   T   A+L 
Sbjct: 240 PSLGRCSALNYLDLSANKFSGEIK-NQLAYCQQLNHLNLSSNHFTGAIPALPT---ANLE 295

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS 394
            + LS N+F G I P L  +   TL EL L +N  +G +P    +CS LVS+ +S N  S
Sbjct: 296 YVYLSGNDFQGGI-PLLLADACPTLLELNLSSNNLSGTVPSNFQSCSSLVSIDISRNNFS 354

Query: 395 GTIP-SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           G +P  +L   + LR L L  N   G +P+ L  +  LETL +  N+
Sbjct: 355 GVLPIDTLLKWTNLRKLSLSYNNFVGSLPESLSKLMNLETLDVSSNN 401

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 67/184 (36%), Positives = 92/184 (50%), Gaps = 21/184 (11%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMD-------------------TLLKMRGLKVLDLSFNEF 166
           G C  L+SLAL  NN +G +P+                    +L +   L  LDLS N+F
Sbjct: 199 GGCRQLKSLALKGNNANGSIPLSGCGNLEYLDVSFNNFSAFPSLGRCSALNYLDLSANKF 258

Query: 167 SGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS 346
           SGE+   L      L  L+LSSN+F+G I P L   P   L+ +YL  N F G IP  L+
Sbjct: 259 SGEIKNQLA-YCQQLNHLNLSSNHFTGAI-PAL---PTANLEYVYLSGNDFQGGIPLLLA 313

Query: 347 N-CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP-QELMYVKTLETLIL 520
           + C  L+ L+LS N LSGT+PS+  S S L  + +  N   G +P   L+    L  L L
Sbjct: 314 DACPTLLELNLSSNNLSGTVPSNFQSCSSLVSIDISRNNFSGVLPIDTLLKWTNLRKLSL 373

Query: 521 DFND 532
            +N+
Sbjct: 374 SYNN 377

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 51/129 (39%), Positives = 75/129 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS + L+ L L  N   G++P + L+ ++ L+ L L FNE +G +P+ L+N + +
Sbjct: 456 IPSSLGSLTKLQHLMLWLNQLHGQIP-EELMNLKTLENLILDFNELTGPIPDGLSNCT-N 513

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + LS+N  SG I P       N L  L L NN F G IPP L +C  L+ L L+ N+
Sbjct: 514 LNWISLSNNRLSGEI-PGWIGKLSN-LAILKLGNNSFYGSIPPELGDCRSLIWLDLNTNH 571

Query: 389 LSGTIPSSL 415
           L+GTIP +L
Sbjct: 572 LTGTIPPAL 580

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 65/218 (29%), Positives = 97/218 (44%), Gaps = 42/218 (19%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
            F  L  P+P    +C+ L  ++LS+N  SGE+P   + K+  L +L L  N F G +P  
Sbjct: 497  FNELTGPIPDGLSNCTNLNWISLSNNRLSGEIP-GWIGKLSNLAILKLGNNSFYGSIPPE 555

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL-------YLQNNG---------- 316
            L +   SL+ LDL++N+ +G I P L +   N    L       Y++N+G          
Sbjct: 556  LGD-CRSLIWLDLNTNHLTGTIPPALFKQSGNIAVGLVTGKSYVYIRNDGSKECHGAGNL 614

Query: 317  -------------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
                                     + G+  PT ++   L+ L LS+N L G+IP  LG+
Sbjct: 615  LEYGGIREEEMDRISTRNPCNFTRVYKGRTNPTFNHNGSLIFLDLSYNMLGGSIPKELGT 674

Query: 422  LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
               L  L L  N L G IP EL  +K +  L   +N L
Sbjct: 675  PYYLYILNLAHNNLSGAIPVELGGLKNVNILDFSYNRL 712

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 58/153 (37%), Positives = 76/153 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    +CS L SL LS N  +G +P  +L  +  L+ L L  N+  G++PE L NL  +
Sbjct: 432 IPEALSNCSQLVSLDLSFNYLTGTIP-SSLGSLTKLQHLMLWLNQLHGQIPEELMNLK-T 489

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N  +GPI P+   N  N L  + L NN  +G+IP  +   S L  L L  N 
Sbjct: 490 LENLILDFNELTGPI-PDGLSNCTN-LNWISLSNNRLSGEIPGWIGKLSNLAILKLGNNS 547

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
             G+IP  LG    L  L L  N L G IP  L
Sbjct: 548 FYGSIPPELGDCRSLIWLDLNTNHLTGTIPPAL 580

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 57/194 (29%), Positives = 74/194 (38%), Gaps = 43/194 (22%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDL------------------- 151
            +PP  G C  L  L L++N+ +G +P   L K  G   + L                   
Sbjct: 552  IPPELGDCRSLIWLDLNTNHLTGTIP-PALFKQSGNIAVGLVTGKSYVYIRNDGSKECHG 610

Query: 152  --SFNEFSGELPESLTNLSA----------------------SLLTLDLSSNNFSGPILP 259
              +  E+ G   E +  +S                       SL+ LDLS N   G I  
Sbjct: 611  AGNLLEYGGIREEEMDRISTRNPCNFTRVYKGRTNPTFNHNGSLIFLDLSYNMLGGSIPK 670

Query: 260  NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 439
             L       L  L L +N  +G IP  L     +  L  S+N L GTIP SL  LS L D
Sbjct: 671  EL--GTPYYLYILNLAHNNLSGAIPVELGGLKNVNILDFSYNRLQGTIPQSLSGLSMLND 728

Query: 440  LKLWLNMLEGEIPQ 481
            + L  N L G IPQ
Sbjct: 729  IDLSNNNLSGTIPQ 742

[8][TOP]
>UniRef100_A7PKY8 Chromosome chr7 scaffold_20, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PKY8_VITVI
          Length = 1097

 Score =  213 bits (541), Expect = 9e-54
 Identities = 111/169 (65%), Positives = 134/169 (79%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  F SCS L S+ +S NNFSG LP+DTLLK   L+ L LS+N F G LPESL+ L  +
Sbjct: 268 VPSNFQSCSSLVSIDISRNNFSGVLPIDTLLKWTNLRKLSLSYNNFVGSLPESLSKLM-N 326

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TLD+SSNNFSG I   LC +P+N+L+EL+LQNN FTG+IP  LSNCS+LVSL LSFNY
Sbjct: 327 LETLDVSSNNFSGLIPSGLCGDPRNSLKELHLQNNLFTGRIPEALSNCSQLVSLDLSFNY 386

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GTIPSSLGSL+KL+ L LWLN L G+IP+ELM +KTLE LILDFN+L
Sbjct: 387 LTGTIPSSLGSLTKLQHLMLWLNQLHGQIPEELMNLKTLENLILDFNEL 435

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 51/129 (39%), Positives = 75/129 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS + L+ L L  N   G++P + L+ ++ L+ L L FNE +G +P+ L+N + +
Sbjct: 391 IPSSLGSLTKLQHLMLWLNQLHGQIP-EELMNLKTLENLILDFNELTGPIPDGLSNCT-N 448

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + LS+N  SG I P       N L  L L NN F G IPP L +C  L+ L L+ N+
Sbjct: 449 LNWISLSNNRLSGEI-PGWIGKLSN-LAILKLGNNSFYGSIPPELGDCRSLIWLDLNTNH 506

Query: 389 LSGTIPSSL 415
           L+GTIP +L
Sbjct: 507 LTGTIPPAL 515

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 65/218 (29%), Positives = 97/218 (44%), Gaps = 42/218 (19%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
            F  L  P+P    +C+ L  ++LS+N  SGE+P   + K+  L +L L  N F G +P  
Sbjct: 432  FNELTGPIPDGLSNCTNLNWISLSNNRLSGEIP-GWIGKLSNLAILKLGNNSFYGSIPPE 490

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL-------YLQNNG---------- 316
            L +   SL+ LDL++N+ +G I P L +   N    L       Y++N+G          
Sbjct: 491  LGD-CRSLIWLDLNTNHLTGTIPPALFKQSGNIAVGLVTGKSYVYIRNDGSKECHGAGNL 549

Query: 317  -------------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
                                     + G+  PT ++   L+ L LS+N L G+IP  LG+
Sbjct: 550  LEYGGIREEEMDRISTRNPCNFTRVYKGRTNPTFNHNGSLIFLDLSYNMLGGSIPKELGT 609

Query: 422  LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
               L  L L  N L G IP EL  +K +  L   +N L
Sbjct: 610  PYYLYILNLAHNNLSGAIPVELGGLKNVNILDFSYNRL 647

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 64/167 (38%), Positives = 85/167 (50%), Gaps = 5/167 (2%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPM-DTLLKMRGLKVLDLSFNEFSGE--LPESLTNLSASLLT 217
           SCS L+SL LS NN        D+     GL+VLDLS N  SGE  +   L+     L +
Sbjct: 147 SCSSLKSLNLSRNNLEFTAGRRDSGGVFTGLEVLDLSNNRISGENVVGWILSGGCRQLKS 206

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYLS 394
           L L  NN +G I  + C N    L  +YL  N F G IP  L++ C  L+ L+LS N LS
Sbjct: 207 LALKGNNANGSIPLSGCGN-LEYLDYVYLSGNDFQGGIPLLLADACPTLLELNLSSNNLS 265

Query: 395 GTIPSSLGSLSKLRDLKLWLNMLEGEIP-QELMYVKTLETLILDFND 532
           GT+PS+  S S L  + +  N   G +P   L+    L  L L +N+
Sbjct: 266 GTVPSNFQSCSSLVSIDISRNNFSGVLPIDTLLKWTNLRKLSLSYNN 312

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 58/153 (37%), Positives = 76/153 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    +CS L SL LS N  +G +P  +L  +  L+ L L  N+  G++PE L NL  +
Sbjct: 367 IPEALSNCSQLVSLDLSFNYLTGTIP-SSLGSLTKLQHLMLWLNQLHGQIPEELMNLK-T 424

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N  +GPI P+   N  N L  + L NN  +G+IP  +   S L  L L  N 
Sbjct: 425 LENLILDFNELTGPI-PDGLSNCTN-LNWISLSNNRLSGEIPGWIGKLSNLAILKLGNNS 482

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
             G+IP  LG    L  L L  N L G IP  L
Sbjct: 483 FYGSIPPELGDCRSLIWLDLNTNHLTGTIPPAL 515

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 58/201 (28%), Positives = 77/201 (38%), Gaps = 43/201 (21%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDL------------------- 151
            +PP  G C  L  L L++N+ +G +P   L K  G   + L                   
Sbjct: 487  IPPELGDCRSLIWLDLNTNHLTGTIP-PALFKQSGNIAVGLVTGKSYVYIRNDGSKECHG 545

Query: 152  --SFNEFSGELPESLTNLSA----------------------SLLTLDLSSNNFSGPILP 259
              +  E+ G   E +  +S                       SL+ LDLS N   G I  
Sbjct: 546  AGNLLEYGGIREEEMDRISTRNPCNFTRVYKGRTNPTFNHNGSLIFLDLSYNMLGGSIPK 605

Query: 260  NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 439
             L       L  L L +N  +G IP  L     +  L  S+N L GTIP SL  LS L D
Sbjct: 606  EL--GTPYYLYILNLAHNNLSGAIPVELGGLKNVNILDFSYNRLQGTIPQSLSGLSMLND 663

Query: 440  LKLWLNMLEGEIPQELMYVKT 502
            + L  N L G IPQ   ++ T
Sbjct: 664  IDLSNNNLSGTIPQSGQFLTT 684

[9][TOP]
>UniRef100_Q8L899 Systemin receptor SR160 n=1 Tax=Solanum peruvianum RepID=BRI1_SOLPE
          Length = 1207

 Score =  212 bits (540), Expect = 1e-53
 Identities = 108/169 (63%), Positives = 133/169 (78%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G CS LE + +S+NNFSG+LP+DTLLK+  +K + LSFN+F G LP+S +NL   
Sbjct: 344 VPESLGECSSLELVDISNNNFSGKLPVDTLLKLSNIKTMVLSFNKFVGGLPDSFSNLP-K 402

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TLD+SSNN +G I   +C++P N L+ LYLQNN F G IP +LSNCS+LVSL LSFNY
Sbjct: 403 LETLDMSSNNLTGIIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNY 462

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IPSSLGSLSKL+DL LWLN L GEIPQELMY++ LE LILDFNDL
Sbjct: 463 LTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDL 511

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 62/154 (40%), Positives = 81/154 (52%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    +CS L SL LS N  +G +P  +L  +  LK L L  N+ SGE+P+ L  L A
Sbjct: 442 PIPDSLSNCSQLVSLDLSFNYLTGSIP-SSLGSLSKLKDLILWLNQLSGEIPQELMYLQA 500

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  L L  N+ +GPI  +L    K  L  + L NN  +G+IP +L   S L  L L  N
Sbjct: 501 -LENLILDFNDLTGPIPASLSNCTK--LNWISLSNNQLSGEIPASLGRLSNLAILKLGNN 557

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            +SG IP+ LG+   L  L L  N L G IP  L
Sbjct: 558 SISGNIPAELGNCQSLIWLDLNTNFLNGSIPPPL 591

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 65/216 (30%), Positives = 98/216 (45%), Gaps = 42/216 (19%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
            F  L  P+P    +C+ L  ++LS+N  SGE+P  +L ++  L +L L  N  SG +P  
Sbjct: 508  FNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPA-SLGRLSNLAILKLGNNSISGNIPAE 566

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL-------YLQNNG---------- 316
            L N   SL+ LDL++N  +G I P L +   N    L       Y++N+G          
Sbjct: 567  LGNCQ-SLIWLDLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNL 625

Query: 317  -------------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
                                     + G   PT ++   ++ L LS+N L G+IP  LG+
Sbjct: 626  LEFGGIRQEQLDRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGA 685

Query: 422  LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            +  L  L L  N L G IPQ+L  +K +  L L +N
Sbjct: 686  MYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYN 721

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 60/168 (35%), Positives = 87/168 (51%), Gaps = 1/168 (0%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 214
           P F  CS L+ L LSSN F G++   +L     L  L+L+ N+F G +P+     S SL 
Sbjct: 251 PSFKDCSNLQHLDLSSNKFYGDIG-SSLSSCGKLSFLNLTNNQFVGLVPKLP---SESLQ 306

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS 394
            L L  N+F G + PN   +   T+ EL L  N F+G +P +L  CS L  + +S N  S
Sbjct: 307 YLYLRGNDFQG-VYPNQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISNNNFS 365

Query: 395 GTIP-SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G +P  +L  LS ++ + L  N   G +P     +  LETL +  N+L
Sbjct: 366 GKLPVDTLLKLSNIKTMVLSFNKFVGGLPDSFSNLPKLETLDMSSNNL 413

 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 38/103 (36%), Positives = 56/103 (54%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P   G+   L  L L  N+ SG +P   L  ++ + +LDLS+N F+G +P SLT+
Sbjct: 675 LEGSIPKELGAMYYLSILNLGHNDLSGMIPQQ-LGGLKNVAILDLSYNRFNGTIPNSLTS 733

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 325
           L+  L  +DLS+NN SG I  +    P +T  +    NN   G
Sbjct: 734 LTL-LGEIDLSNNNLSGMIPESA---PFDTFPDYRFANNSLCG 772

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 56/181 (30%), Positives = 77/181 (42%), Gaps = 23/181 (12%)
 Frame = +2

Query: 59  LESLALSSNNFSGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN 235
           L+S+ L+ N  SG +  + +      LK L+LS N       E L   + SL  LDLS N
Sbjct: 136 LDSIDLAENTISGPISDISSFGVCSNLKSLNLSKNFLDPPGKEMLKGATFSLQVLDLSYN 195

Query: 236 NFSG-PILPNLCQNPKNTLQELYLQNNGFTGKIP---------------------PTLSN 349
           N SG  + P +       L+   ++ N   G IP                     P+  +
Sbjct: 196 NISGFNLFPWVSSMGFVELEFFSIKGNKLAGSIPELDFKNLSYLDLSANNFSTVFPSFKD 255

Query: 350 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           CS L  L LS N   G I SSL S  KL  L L  N   G +P+  +  ++L+ L L  N
Sbjct: 256 CSNLQHLDLSSNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVPK--LPSESLQYLYLRGN 313

Query: 530 D 532
           D
Sbjct: 314 D 314

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 37/96 (38%), Positives = 50/96 (52%)
 Frame = +2

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N + S++ LDLS N   G I   L       L  L L +N  +G IP  L     +  L 
Sbjct: 660 NHNGSMIFLDLSYNKLEGSIPKEL--GAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILD 717

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
           LS+N  +GTIP+SL SL+ L ++ L  N L G IP+
Sbjct: 718 LSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIPE 753

[10][TOP]
>UniRef100_A4LAP6 BRI1 protein n=1 Tax=Solanum tuberosum RepID=A4LAP6_SOLTU
          Length = 1206

 Score =  211 bits (538), Expect = 2e-53
 Identities = 108/169 (63%), Positives = 132/169 (78%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G CS LE + +S+NNFSG+LP+DTLLK+  +K + LSFN+F G LP+S +NL   
Sbjct: 343 VPESLGECSSLELVDISNNNFSGKLPVDTLLKLSNMKTMVLSFNKFVGVLPDSFSNL-LK 401

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TLD+SSNN +G I   +C++P N L+ LYLQNN F G IP +LSNCS+LVSL LSFNY
Sbjct: 402 LETLDVSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFEGPIPASLSNCSQLVSLDLSFNY 461

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G IPSSLGSLSKL+DL LWLN L GEIPQELMY++ LE LILDFNDL
Sbjct: 462 LTGRIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDL 510

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 59/159 (37%), Positives = 90/159 (56%), Gaps = 2/159 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L LS+NNFS   P  +      L+ LDLS N+F G++  SL++    L  L+L++N 
Sbjct: 235 LSHLDLSANNFSTVFP--SFKDCSNLQHLDLSSNKFYGDIGSSLSSCG-KLSFLNLTNNQ 291

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYLSGTIPSSL 415
           F G ++P L      +LQ LYL+ N F G  P  L++ C  +V L LS+N  SG +P SL
Sbjct: 292 FVG-LVPKL---QSESLQYLYLRGNDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESL 347

Query: 416 GSLSKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDFN 529
           G  S L  + +  N   G++P + L+ +  ++T++L FN
Sbjct: 348 GECSSLELVDISNNNFSGKLPVDTLLKLSNMKTMVLSFN 386

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/156 (39%), Positives = 81/156 (51%)
 Frame = +2

Query: 20  ELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL 199
           E P+P    +CS L SL LS N  +G +P  +L  +  LK L L  N+ SGE+P+ L  L
Sbjct: 439 EGPIPASLSNCSQLVSLDLSFNYLTGRIP-SSLGSLSKLKDLILWLNQLSGEIPQELMYL 497

Query: 200 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
            A L  L L  N+ +GPI  +L    K  L  + L NN  +G+IP +L   S L  L L 
Sbjct: 498 QA-LENLILDFNDLTGPIPASLSNCTK--LNWISLSNNQLSGEIPASLGRLSNLAILKLG 554

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            N +S  IP+ LG+   L  L L  N L G IP  L
Sbjct: 555 NNSISRNIPAELGNCQSLIWLDLNTNFLNGSIPPPL 590

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 59/162 (36%), Positives = 86/162 (53%), Gaps = 8/162 (4%)
 Frame = +2

Query: 17  LELPLPPFFG-------SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE 175
           L+L    F+G       SC  L  L L++N F G +P    L+   L+ L L  N+F G 
Sbjct: 261 LDLSSNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVPK---LQSESLQYLYLRGNDFQGV 317

Query: 176 LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP-PTLSNC 352
            P  L +L  +++ LDLS NNFSG +  +L     ++L+ + + NN F+GK+P  TL   
Sbjct: 318 YPNQLADLCKTVVELDLSYNNFSGMVPESL--GECSSLELVDISNNNFSGKLPVDTLLKL 375

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           S + ++ LSFN   G +P S  +L KL  L +  N L G IP
Sbjct: 376 SNMKTMVLSFNKFVGVLPDSFSNLLKLETLDVSSNNLTGVIP 417

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 60/168 (35%), Positives = 87/168 (51%), Gaps = 1/168 (0%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 214
           P F  CS L+ L LSSN F G++   +L     L  L+L+ N+F G +P+     S SL 
Sbjct: 250 PSFKDCSNLQHLDLSSNKFYGDIG-SSLSSCGKLSFLNLTNNQFVGLVPKL---QSESLQ 305

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS 394
            L L  N+F G + PN   +   T+ EL L  N F+G +P +L  CS L  + +S N  S
Sbjct: 306 YLYLRGNDFQG-VYPNQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISNNNFS 364

Query: 395 GTIP-SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G +P  +L  LS ++ + L  N   G +P     +  LETL +  N+L
Sbjct: 365 GKLPVDTLLKLSNMKTMVLSFNKFVGVLPDSFSNLLKLETLDVSSNNL 412

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 64/216 (29%), Positives = 97/216 (44%), Gaps = 42/216 (19%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
            F  L  P+P    +C+ L  ++LS+N  SGE+P  +L ++  L +L L  N  S  +P  
Sbjct: 507  FNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPA-SLGRLSNLAILKLGNNSISRNIPAE 565

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL-------YLQNNG---------- 316
            L N   SL+ LDL++N  +G I P L +   N    L       Y++N+G          
Sbjct: 566  LGNCQ-SLIWLDLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNL 624

Query: 317  -------------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
                                     + G   PT ++   ++ L LS+N L G+IP  LG+
Sbjct: 625  LEFGGIRQEQLGRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGT 684

Query: 422  LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            +  L  L L  N L G IPQ+L  +K +  L L +N
Sbjct: 685  MYYLSILNLGHNDLSGMIPQDLGGLKNVAILDLSYN 720

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 39/103 (37%), Positives = 57/103 (55%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P   G+   L  L L  N+ SG +P D L  ++ + +LDLS+N F+G +P SLT+
Sbjct: 674 LEGSIPKELGTMYYLSILNLGHNDLSGMIPQD-LGGLKNVAILDLSYNRFNGPIPNSLTS 732

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 325
           L+  L  +DLS+NN SG I  +    P +T  +    NN   G
Sbjct: 733 LTL-LGEIDLSNNNLSGMIPESA---PFDTFPDYRFANNSLCG 771

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 57/181 (31%), Positives = 77/181 (42%), Gaps = 23/181 (12%)
 Frame = +2

Query: 59  LESLALSSNNFSGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN 235
           L+S+ L+ N  SG +  + +      LK L+LS N       E L   + SL  LDLS N
Sbjct: 135 LDSIDLAENTISGPISDISSFGVCSNLKSLNLSKNFLDPPGKEILKGATFSLQVLDLSYN 194

Query: 236 NFSG-PILPNLCQNPKNTLQELYLQNNGFTGKIP---------------------PTLSN 349
           N SG  + P +       L+   L+ N   G IP                     P+  +
Sbjct: 195 NISGFNLFPWVSSMGFGELEFFSLKGNKLAGSIPELDFKNLSHLDLSANNFSTVFPSFKD 254

Query: 350 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           CS L  L LS N   G I SSL S  KL  L L  N   G +P+  +  ++L+ L L  N
Sbjct: 255 CSNLQHLDLSSNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVPK--LQSESLQYLYLRGN 312

Query: 530 D 532
           D
Sbjct: 313 D 313

 Score = 53.5 bits (127), Expect = 9e-06
 Identities = 36/96 (37%), Positives = 49/96 (51%)
 Frame = +2

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N + S++ LDLS N   G I   L       L  L L +N  +G IP  L     +  L 
Sbjct: 659 NHNGSMIFLDLSYNKLEGSIPKEL--GTMYYLSILNLGHNDLSGMIPQDLGGLKNVAILD 716

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
           LS+N  +G IP+SL SL+ L ++ L  N L G IP+
Sbjct: 717 LSYNRFNGPIPNSLTSLTLLGEIDLSNNNLSGMIPE 752

[11][TOP]
>UniRef100_A4LAP5 BRI1 protein n=1 Tax=Solanum pimpinellifolium RepID=A4LAP5_SOLPI
          Length = 1207

 Score =  209 bits (532), Expect = 1e-52
 Identities = 107/169 (63%), Positives = 131/169 (77%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G CS LE + +S NNFSG+LP+DTL K+  +K + LSFN+F G LP+S +NL   
Sbjct: 344 VPESLGECSSLELVDISYNNFSGKLPVDTLSKLSNIKTMVLSFNKFVGGLPDSFSNL-LK 402

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TLD+SSNN +G I   +C++P N L+ LYLQNN F G IP +LSNCS+LVSL LSFNY
Sbjct: 403 LETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNY 462

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IPSSLGSLSKL+DL LWLN L GEIPQELMY++ LE LILDFNDL
Sbjct: 463 LTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDL 511

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 62/154 (40%), Positives = 81/154 (52%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    +CS L SL LS N  +G +P  +L  +  LK L L  N+ SGE+P+ L  L A
Sbjct: 442 PIPDSLSNCSQLVSLDLSFNYLTGSIP-SSLGSLSKLKDLILWLNQLSGEIPQELMYLQA 500

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  L L  N+ +GPI  +L    K  L  + L NN  +G+IP +L   S L  L L  N
Sbjct: 501 -LENLILDFNDLTGPIPASLSNCTK--LNWISLSNNQLSGEIPASLGRLSNLAILKLGNN 557

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            +SG IP+ LG+   L  L L  N L G IP  L
Sbjct: 558 SISGNIPAELGNCQSLIWLDLNTNFLNGSIPPPL 591

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 60/168 (35%), Positives = 88/168 (52%), Gaps = 1/168 (0%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 214
           P F  CS L+ L LSSN F G++   +L     L  L+L+ N+F G +P+     S SL 
Sbjct: 251 PSFKDCSNLQHLDLSSNKFYGDIG-SSLSSCGKLSFLNLTNNQFVGLVPKLP---SESLQ 306

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS 394
            L L  N+F G + PN   +   T+ EL L  N F+G +P +L  CS L  + +S+N  S
Sbjct: 307 YLYLRGNDFQG-VYPNQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISYNNFS 365

Query: 395 GTIP-SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G +P  +L  LS ++ + L  N   G +P     +  LETL +  N+L
Sbjct: 366 GKLPVDTLSKLSNIKTMVLSFNKFVGGLPDSFSNLLKLETLDMSSNNL 413

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 65/216 (30%), Positives = 98/216 (45%), Gaps = 42/216 (19%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
            F  L  P+P    +C+ L  ++LS+N  SGE+P  +L ++  L +L L  N  SG +P  
Sbjct: 508  FNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPA-SLGRLSNLAILKLGNNSISGNIPAE 566

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL-------YLQNNG---------- 316
            L N   SL+ LDL++N  +G I P L +   N    L       Y++N+G          
Sbjct: 567  LGNCQ-SLIWLDLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNL 625

Query: 317  -------------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
                                     + G   PT ++   ++ L LS+N L G+IP  LG+
Sbjct: 626  LEFGGIRQEQLDRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGA 685

Query: 422  LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            +  L  L L  N L G IPQ+L  +K +  L L +N
Sbjct: 686  MYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYN 721

 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 38/103 (36%), Positives = 56/103 (54%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P   G+   L  L L  N+ SG +P   L  ++ + +LDLS+N F+G +P SLT+
Sbjct: 675 LEGSIPKELGAMYYLSILNLGHNDLSGMIPQQ-LGGLKNVAILDLSYNRFNGTIPNSLTS 733

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 325
           L+  L  +DLS+NN SG I  +    P +T  +    NN   G
Sbjct: 734 LTL-LGEIDLSNNNLSGMIPESA---PFDTFPDYRFANNSLCG 772

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 57/181 (31%), Positives = 77/181 (42%), Gaps = 23/181 (12%)
 Frame = +2

Query: 59  LESLALSSNNFSGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN 235
           L+S+ L+ N  SG +  + +      LK L+LS N       E L   + SL  LDLS N
Sbjct: 136 LDSVDLAENTISGPISDISSFGVCSNLKSLNLSKNFLDPPGKEMLNAATFSLQVLDLSYN 195

Query: 236 NFSG-PILPNLCQNPKNTLQELYLQNNGFTGKIP---------------------PTLSN 349
           N SG  + P +       L+   L+ N   G IP                     P+  +
Sbjct: 196 NISGFNLFPWVSSMGFVELEFFSLKGNKLAGSIPELDFKNLSYLDLSANNFSTVFPSFKD 255

Query: 350 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           CS L  L LS N   G I SSL S  KL  L L  N   G +P+  +  ++L+ L L  N
Sbjct: 256 CSNLQHLDLSSNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVPK--LPSESLQYLYLRGN 313

Query: 530 D 532
           D
Sbjct: 314 D 314

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 37/96 (38%), Positives = 50/96 (52%)
 Frame = +2

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N + S++ LDLS N   G I   L       L  L L +N  +G IP  L     +  L 
Sbjct: 660 NHNGSMIFLDLSYNKLEGSIPKEL--GAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILD 717

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
           LS+N  +GTIP+SL SL+ L ++ L  N L G IP+
Sbjct: 718 LSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIPE 753

[12][TOP]
>UniRef100_Q8GUQ5 Brassinosteroid LRR receptor kinase n=1 Tax=Solanum lycopersicum
           RepID=BRI1_SOLLC
          Length = 1207

 Score =  209 bits (532), Expect = 1e-52
 Identities = 107/169 (63%), Positives = 131/169 (77%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G CS LE + +S NNFSG+LP+DTL K+  +K + LSFN+F G LP+S +NL   
Sbjct: 344 VPESLGECSSLELVDISYNNFSGKLPVDTLSKLSNIKTMVLSFNKFVGGLPDSFSNL-LK 402

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TLD+SSNN +G I   +C++P N L+ LYLQNN F G IP +LSNCS+LVSL LSFNY
Sbjct: 403 LETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNY 462

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IPSSLGSLSKL+DL LWLN L GEIPQELMY++ LE LILDFNDL
Sbjct: 463 LTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDL 511

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 62/154 (40%), Positives = 81/154 (52%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    +CS L SL LS N  +G +P  +L  +  LK L L  N+ SGE+P+ L  L A
Sbjct: 442 PIPDSLSNCSQLVSLDLSFNYLTGSIP-SSLGSLSKLKDLILWLNQLSGEIPQELMYLQA 500

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  L L  N+ +GPI  +L    K  L  + L NN  +G+IP +L   S L  L L  N
Sbjct: 501 -LENLILDFNDLTGPIPASLSNCTK--LNWISLSNNQLSGEIPASLGRLSNLAILKLGNN 557

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            +SG IP+ LG+   L  L L  N L G IP  L
Sbjct: 558 SISGNIPAELGNCQSLIWLDLNTNFLNGSIPPPL 591

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 60/168 (35%), Positives = 88/168 (52%), Gaps = 1/168 (0%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 214
           P F  CS L+ L LSSN F G++   +L     L  L+L+ N+F G +P+     S SL 
Sbjct: 251 PSFKDCSNLQHLDLSSNKFYGDIG-SSLSSCGKLSFLNLTNNQFVGLVPKLP---SESLQ 306

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS 394
            L L  N+F G + PN   +   T+ EL L  N F+G +P +L  CS L  + +S+N  S
Sbjct: 307 YLYLRGNDFQG-VYPNQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISYNNFS 365

Query: 395 GTIP-SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G +P  +L  LS ++ + L  N   G +P     +  LETL +  N+L
Sbjct: 366 GKLPVDTLSKLSNIKTMVLSFNKFVGGLPDSFSNLLKLETLDMSSNNL 413

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 65/216 (30%), Positives = 98/216 (45%), Gaps = 42/216 (19%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
            F  L  P+P    +C+ L  ++LS+N  SGE+P  +L ++  L +L L  N  SG +P  
Sbjct: 508  FNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPA-SLGRLSNLAILKLGNNSISGNIPAE 566

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL-------YLQNNG---------- 316
            L N   SL+ LDL++N  +G I P L +   N    L       Y++N+G          
Sbjct: 567  LGNCQ-SLIWLDLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNL 625

Query: 317  -------------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
                                     + G   PT ++   ++ L LS+N L G+IP  LG+
Sbjct: 626  LEFGGIRQEQLDRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGA 685

Query: 422  LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            +  L  L L  N L G IPQ+L  +K +  L L +N
Sbjct: 686  MYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYN 721

 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 38/103 (36%), Positives = 56/103 (54%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P   G+   L  L L  N+ SG +P   L  ++ + +LDLS+N F+G +P SLT+
Sbjct: 675 LEGSIPKELGAMYYLSILNLGHNDLSGMIPQQ-LGGLKNVAILDLSYNRFNGTIPNSLTS 733

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 325
           L+  L  +DLS+NN SG I  +    P +T  +    NN   G
Sbjct: 734 LTL-LGEIDLSNNNLSGMIPESA---PFDTFPDYRFANNSLCG 772

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 57/181 (31%), Positives = 77/181 (42%), Gaps = 23/181 (12%)
 Frame = +2

Query: 59  LESLALSSNNFSGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN 235
           L+S+ L+ N  SG +  + +      LK L+LS N       E L   + SL  LDLS N
Sbjct: 136 LDSIDLAENTISGPISDISSFGVCSNLKSLNLSKNFLDPPGKEMLKAATFSLQVLDLSYN 195

Query: 236 NFSG-PILPNLCQNPKNTLQELYLQNNGFTGKIP---------------------PTLSN 349
           N SG  + P +       L+   L+ N   G IP                     P+  +
Sbjct: 196 NISGFNLFPWVSSMGFVELEFFSLKGNKLAGSIPELDFKNLSYLDLSANNFSTVFPSFKD 255

Query: 350 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           CS L  L LS N   G I SSL S  KL  L L  N   G +P+  +  ++L+ L L  N
Sbjct: 256 CSNLQHLDLSSNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVPK--LPSESLQYLYLRGN 313

Query: 530 D 532
           D
Sbjct: 314 D 314

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 37/96 (38%), Positives = 50/96 (52%)
 Frame = +2

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N + S++ LDLS N   G I   L       L  L L +N  +G IP  L     +  L 
Sbjct: 660 NHNGSMIFLDLSYNKLEGSIPKEL--GAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILD 717

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
           LS+N  +GTIP+SL SL+ L ++ L  N L G IP+
Sbjct: 718 LSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIPE 753

[13][TOP]
>UniRef100_C6FF79 Brassinosteroid receptor n=2 Tax=Glycine max RepID=C6FF79_SOYBN
          Length = 1187

 Score =  206 bits (525), Expect = 7e-52
 Identities = 112/173 (64%), Positives = 130/173 (75%), Gaps = 4/173 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP  FG+C+ L+SL +SSN F+G LPM  L +M  LK L ++FN F G LPESL+ LSA 
Sbjct: 325 LPGAFGACTSLQSLDISSNLFAGALPMSVLTQMTSLKELAVAFNGFLGALPESLSKLSA- 383

Query: 209 LLTLDLSSNNFSGPILPNLCQNP----KNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
           L  LDLSSNNFSG I  +LC        N L+ELYLQNN FTG IPPTLSNCS LV+L L
Sbjct: 384 LELLDLSSNNFSGSIPASLCGGGDAGINNNLKELYLQNNRFTGFIPPTLSNCSNLVALDL 443

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           SFN+L+GTIP SLGSLS L+D  +WLN L GEIPQELMY+K+LE LILDFNDL
Sbjct: 444 SFNFLTGTIPPSLGSLSNLKDFIIWLNQLHGEIPQELMYLKSLENLILDFNDL 496

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 64/211 (30%), Positives = 99/211 (46%), Gaps = 42/211 (19%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    +C+ L  ++LS+N  SGE+P   + K+  L +L LS N FSG +P  L + + S
Sbjct: 500  IPSGLVNCTKLNWISLSNNRLSGEIP-PWIGKLSNLAILKLSNNSFSGRIPPELGDCT-S 557

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQE-------LYLQNNG----------------- 316
            L+ LDL++N  +GPI P L +               +Y++N+G                 
Sbjct: 558  LIWLDLNTNMLTGPIPPELFKQSGKIAVNFISGKTYVYIKNDGSKECHGAGNLLEFAGIS 617

Query: 317  ------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 442
                              + GK+ PT ++   ++ L +S N LSG+IP  +G++  L  L
Sbjct: 618  QQQLNRISTRNPCNFTRVYGGKLQPTFNHNGSMIFLDISHNMLSGSIPKEIGAMYYLYIL 677

Query: 443  KLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  N + G IPQEL  +K L  L L  N L
Sbjct: 678  NLGHNNVSGSIPQELGKMKNLNILDLSNNRL 708

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 76/205 (37%), Positives = 93/205 (45%), Gaps = 52/205 (25%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPM------DTLLKMRGLKVLDLSFNEFSGELPESL 190
           LP      S LE L LSSNNFSG +P       D  +    LK L L  N F+G +P +L
Sbjct: 374 LPESLSKLSALELLDLSSNNFSGSIPASLCGGGDAGIN-NNLKELYLQNNRFTGFIPPTL 432

Query: 191 TNLSASLLTLDLSSNNFSGPILPNL--CQNPKN--------------------TLQELYL 304
           +N S +L+ LDLS N  +G I P+L    N K+                    +L+ L L
Sbjct: 433 SNCS-NLVALDLSFNFLTGTIPPSLGSLSNLKDFIIWLNQLHGEIPQELMYLKSLENLIL 491

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL------------ 448
             N  TG IP  L NC++L  + LS N LSG IP  +G LS L  LKL            
Sbjct: 492 DFNDLTGNIPSGLVNCTKLNWISLSNNRLSGEIPPWIGKLSNLAILKLSNNSFSGRIPPE 551

Query: 449 --------WL----NMLEGEIPQEL 487
                   WL    NML G IP EL
Sbjct: 552 LGDCTSLIWLDLNTNMLTGPIPPEL 576

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 78/241 (32%), Positives = 108/241 (44%), Gaps = 68/241 (28%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSS-----------------------NNFSGE------- 100
           LS  L    F  SCS L+SL LSS                       N  SG        
Sbjct: 132 LSASLNDMSFLASCSNLQSLNLSSNLLQFGPPPHWKLHHLRFADFSYNKISGPGVVSWLL 191

Query: 101 LPMDTLLKMRGLKV--------------LDLSFNEFSGELPE-------SLTNLSA---- 205
            P+  LL ++G KV              LDLS N FS  LP           +LSA    
Sbjct: 192 NPVIELLSLKGNKVTGETDFSGSISLQYLDLSSNNFSVTLPTFGECSSLEYLDLSANKYL 251

Query: 206 -----------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN- 349
                      SL+ L++SSN FSGP+ P+L   P  +LQ +YL  N F G+IP +L++ 
Sbjct: 252 GDIARTLSPCKSLVYLNVSSNQFSGPV-PSL---PSGSLQFVYLAANHFHGQIPLSLADL 307

Query: 350 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDF 526
           CS L+ L LS N L+G +P + G+ + L+ L +  N+  G +P   L  + +L+ L + F
Sbjct: 308 CSTLLQLDLSSNNLTGALPGAFGACTSLQSLDISSNLFAGALPMSVLTQMTSLKELAVAF 367

Query: 527 N 529
           N
Sbjct: 368 N 368

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 58/208 (27%), Positives = 85/208 (40%), Gaps = 41/208 (19%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP+ G  S L  L LS+N+FSG +P + L     L  LDL+ N  +G +P  L   S  
Sbjct: 524  IPPWIGKLSNLAILKLSNNSFSGRIPPE-LGDCTSLIWLDLNTNMLTGPIPPELFKQSGK 582

Query: 209  LLTLDLSSNNF-------------SGPILP---------------NLCQ----------- 271
            +    +S   +             +G +L                N C            
Sbjct: 583  IAVNFISGKTYVYIKNDGSKECHGAGNLLEFAGISQQQLNRISTRNPCNFTRVYGGKLQP 642

Query: 272  --NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
              N   ++  L + +N  +G IP  +     L  L+L  N +SG+IP  LG +  L  L 
Sbjct: 643  TFNHNGSMIFLDISHNMLSGSIPKEIGAMYYLYILNLGHNNVSGSIPQELGKMKNLNILD 702

Query: 446  LWLNMLEGEIPQELMYVKTLETLILDFN 529
            L  N LEG+IPQ L  +  L  + L  N
Sbjct: 703  LSNNRLEGQIPQSLTGLSLLTEIDLSNN 730

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 53/196 (27%), Positives = 76/196 (38%), Gaps = 45/196 (22%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMD-------------------------------- 112
            +PP  G C+ L  L L++N  +G +P +                                
Sbjct: 548  IPPELGDCTSLIWLDLNTNMLTGPIPPELFKQSGKIAVNFISGKTYVYIKNDGSKECHGA 607

Query: 113  -TLLKMRGLKVLDLS---------FNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPN 262
              LL+  G+    L+         F    G   +   N + S++ LD+S N  SG I   
Sbjct: 608  GNLLEFAGISQQQLNRISTRNPCNFTRVYGGKLQPTFNHNGSMIFLDISHNMLSGSIPKE 667

Query: 263  LCQNPKNTLQELYLQN---NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 433
            +       +  LY+ N   N  +G IP  L     L  L LS N L G IP SL  LS L
Sbjct: 668  I-----GAMYYLYILNLGHNNVSGSIPQELGKMKNLNILDLSNNRLEGQIPQSLTGLSLL 722

Query: 434  RDLKLWLNMLEGEIPQ 481
             ++ L  N+L G IP+
Sbjct: 723  TEIDLSNNLLTGTIPE 738

 Score = 53.5 bits (127), Expect = 9e-06
 Identities = 38/90 (42%), Positives = 49/90 (54%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           LD+S N  SG +P+ +  +   L  L+L  NN SG I P      KN L  L L NN   
Sbjct: 653 LDISHNMLSGSIPKEIGAMYY-LYILNLGHNNVSGSI-PQELGKMKN-LNILDLSNNRLE 709

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           G+IP +L+  S L  + LS N L+GTIP S
Sbjct: 710 GQIPQSLTGLSLLTEIDLSNNLLTGTIPES 739

[14][TOP]
>UniRef100_Q76FZ8 Brassinosteroid receptor n=1 Tax=Pisum sativum RepID=Q76FZ8_PEA
          Length = 1188

 Score =  205 bits (521), Expect = 2e-51
 Identities = 109/171 (63%), Positives = 132/171 (77%), Gaps = 1/171 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P  FG+C+ + S  +SSN F+GELPM+ L +M  LK L ++FNEF+G LPESL+ L+ 
Sbjct: 329 PVPREFGACTSVTSFDISSNKFAGELPMEVLTEMNSLKELTVAFNEFAGPLPESLSKLTG 388

Query: 206 SLLTLDLSSNNFSGPILPNLC-QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
            L +LDLSSNNFSG I   LC +   N L+ LYLQNN FTG IPPTLSNCS LV+L LSF
Sbjct: 389 -LESLDLSSNNFSGTIPRWLCGEESGNNLKGLYLQNNVFTGFIPPTLSNCSNLVALDLSF 447

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           NYL+GTIP SLGSLSKLRDL +WLN L GEIPQEL  +++LE LILDFN+L
Sbjct: 448 NYLTGTIPPSLGSLSKLRDLIMWLNQLHGEIPQELSNMESLENLILDFNEL 498

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 62/166 (37%), Positives = 95/166 (57%), Gaps = 2/166 (1%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F   + L  L +SSNNF+  +P  +      L+ LD+S N++ G++  +L+    +LL L
Sbjct: 216 FSGYTTLRYLDISSNNFTVSIP--SFGDCSSLQHLDISANKYFGDITRTLSPCK-NLLHL 272

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYLSG 397
           +LS N F+GP+ P+L   P  +LQ LYL  N F GKIP  L++ CS LV L LS N L+G
Sbjct: 273 NLSGNQFTGPV-PSL---PSGSLQFLYLAENHFAGKIPARLADLCSTLVELDLSSNNLTG 328

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDFND 532
            +P   G+ + +    +  N   GE+P E L  + +L+ L + FN+
Sbjct: 329 PVPREFGACTSVTSFDISSNKFAGELPMEVLTEMNSLKELTVAFNE 374

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 67/218 (30%), Positives = 101/218 (46%), Gaps = 42/218 (19%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
            F  L   +P    +C+ L  ++LS+N  +GE+P   + K+  L +L LS N FSG +P  
Sbjct: 495  FNELSGTIPSGLVNCTKLNWISLSNNRLTGEIP-SWIGKLSNLAILKLSNNSFSGRIPPE 553

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE-------LYLQNNG---------- 316
            L +   SL+ LDL++N  +GPI P L +     +         +Y++N+G          
Sbjct: 554  LGDCP-SLIWLDLNTNFLTGPIPPELGKQSGKVVVNFISGKTYVYIKNDGSKECHGAGSL 612

Query: 317  -------------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
                                     + GK+ PT +    ++ L +S N LSGTIP  +G 
Sbjct: 613  LEFAGINQEQLRRISTRNPCNFTRVYGGKLQPTFTLNGSMIFLDVSHNMLSGTIPKEIGE 672

Query: 422  LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            ++ L  L L  N L G IPQEL  +K L  L L +N L
Sbjct: 673  MTYLYVLHLSHNNLSGSIPQELGKMKNLNILDLSYNKL 710

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 60/153 (39%), Positives = 77/153 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   +CS L +L LS N  +G +P  +L  +  L+ L +  N+  GE+P+ L+N+  S
Sbjct: 430 IPPTLSNCSNLVALDLSFNYLTGTIP-PSLGSLSKLRDLIMWLNQLHGEIPQELSNME-S 487

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N  SG I   L    K  L  + L NN  TG+IP  +   S L  L LS N 
Sbjct: 488 LENLILDFNELSGTIPSGLVNCTK--LNWISLSNNRLTGEIPSWIGKLSNLAILKLSNNS 545

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            SG IP  LG    L  L L  N L G IP EL
Sbjct: 546 FSGRIPPELGDCPSLIWLDLNTNFLTGPIPPEL 578

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 60/209 (28%), Positives = 88/209 (42%), Gaps = 41/209 (19%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P + G  S L  L LS+N+FSG +P + L     L  LDL+ N  +G +P  L   S  
Sbjct: 526  IPSWIGKLSNLAILKLSNNSFSGRIPPE-LGDCPSLIWLDLNTNFLTGPIPPELGKQSGK 584

Query: 209  LLTLDLSSNNF-------------SGPILP---------------NLCQ---------NP 277
            ++   +S   +             +G +L                N C           P
Sbjct: 585  VVVNFISGKTYVYIKNDGSKECHGAGSLLEFAGINQEQLRRISTRNPCNFTRVYGGKLQP 644

Query: 278  KNTLQE----LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
              TL      L + +N  +G IP  +   + L  LHLS N LSG+IP  LG +  L  L 
Sbjct: 645  TFTLNGSMIFLDVSHNMLSGTIPKEIGEMTYLYVLHLSHNNLSGSIPQELGKMKNLNILD 704

Query: 446  LWLNMLEGEIPQELMYVKTLETLILDFND 532
            L  N L+ +IPQ L  +  L    +DF++
Sbjct: 705  LSYNKLQDQIPQTLTRLSLLTE--IDFSN 731

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 37/106 (34%), Positives = 54/106 (50%)
 Frame = +2

Query: 164 FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL 343
           + G+L  + T L+ S++ LD+S N  SG I   + +     L  L+L +N  +G IP  L
Sbjct: 638 YGGKLQPTFT-LNGSMIFLDVSHNMLSGTIPKEIGE--MTYLYVLHLSHNNLSGSIPQEL 694

Query: 344 SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
                L  L LS+N L   IP +L  LS L ++    N L G IP+
Sbjct: 695 GKMKNLNILDLSYNKLQDQIPQTLTRLSLLTEIDFSNNCLSGMIPE 740

[15][TOP]
>UniRef100_Q76CZ5 Putative brassinosteroid-insensitive 1 n=2 Tax=Hordeum vulgare
           RepID=Q76CZ5_HORSP
          Length = 1118

 Score =  176 bits (445), Expect = 1e-42
 Identities = 91/168 (54%), Positives = 118/168 (70%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           PP     + L +L LS+NNFSGE+P D    ++ L+ L LSFN FSG +P+S+  L   L
Sbjct: 259 PPNIAGLTSLTALNLSNNNFSGEVPADAFTGLQQLQSLSLSFNHFSGSIPDSVAALP-DL 317

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             LDLSSNNFSG I  +LCQ+P + L+ LYLQNN  +G IP  +SNC++LVSL LS NY+
Sbjct: 318 EVLDLSSNNFSGSIPDSLCQDPNSRLRVLYLQNNYLSGSIPEAVSNCTDLVSLDLSLNYI 377

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +G+IP SLG LS+L+DL +W N+LEGEIP  L  +  LE LILD+N L
Sbjct: 378 NGSIPESLGELSRLQDLIMWQNLLEGEIPASLSSIPGLEHLILDYNGL 425

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 81/219 (36%), Positives = 106/219 (48%), Gaps = 47/219 (21%)
 Frame = +2

Query: 20  ELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN- 196
           E+P   F G    L+SL+LS N+FSG +P D++  +  L+VLDLS N FSG +P+SL   
Sbjct: 281 EVPADAFTG-LQQLQSLSLSFNHFSGSIP-DSVAALPDLEVLDLSSNNFSGSIPDSLCQD 338

Query: 197 --------------LSAS----------LLTLDLSSNNFSGPILPNLCQNPKNT------ 286
                         LS S          L++LDLS N  +G I  +L +  +        
Sbjct: 339 PNSRLRVLYLQNNYLSGSIPEAVSNCTDLVSLDLSLNYINGSIPESLGELSRLQDLIMWQ 398

Query: 287 ----------------LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
                           L+ L L  NG TG IPP L+ C +L  + L+ N LSG IPS LG
Sbjct: 399 NLLEGEIPASLSSIPGLEHLILDYNGLTGSIPPELAKCKQLNWISLASNRLSGPIPSWLG 458

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LS L  LKL  N   G+IP EL   K+L  L L+ N L
Sbjct: 459 KLSNLAILKLSNNSFTGKIPAELGDCKSLVWLDLNSNQL 497

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 65/212 (30%), Positives = 92/212 (43%), Gaps = 43/212 (20%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP    C  L  ++L+SN  SG +P   L K+  L +L LS N F+G++P  L +   S
Sbjct: 429  IPPELAKCKQLNWISLASNRLSGPIP-SWLGKLSNLAILKLSNNSFTGKIPAELGDCK-S 486

Query: 209  LLTLDLSSNNFSGPILPNLC-QNPKNTL------QELYLQNNG----------------- 316
            L+ LDL+SN  +G I P L  Q+ K T+        +YL+N+                  
Sbjct: 487  LVWLDLNSNQLNGSIPPELAEQSGKMTVGLIIGRPYVYLRNDELSSQCRGKGSLLEFSSI 546

Query: 317  -------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 439
                               + G    T +    ++ L LSFN L   IP  LG++  L  
Sbjct: 547  RSEDLSRMPSKKLCNFTRMYMGSTEYTFNKNGSMIFLDLSFNQLDSEIPKELGNMFYLMI 606

Query: 440  LKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            + L  N+L G IP EL   K L  L L  N L
Sbjct: 607  MNLGHNLLSGAIPTELAGAKKLAVLDLSHNRL 638

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 57/145 (39%), Positives = 74/145 (51%), Gaps = 3/145 (2%)
 Frame = +2

Query: 2   SLFLSLEL---PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SL LSL      +P   G  S L+ L +  N   GE+P  +L  + GL+ L L +N  +G
Sbjct: 369 SLDLSLNYINGSIPESLGELSRLQDLIMWQNLLEGEIPA-SLSSIPGLEHLILDYNGLTG 427

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
            +P  L      L  + L+SN  SGPI P+      N L  L L NN FTGKIP  L +C
Sbjct: 428 SIPPELAKCK-QLNWISLASNRLSGPI-PSWLGKLSN-LAILKLSNNSFTGKIPAELGDC 484

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLS 427
             LV L L+ N L+G+IP  L   S
Sbjct: 485 KSLVWLDLNSNQLNGSIPPELAEQS 509

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 48/160 (30%), Positives = 77/160 (48%), Gaps = 3/160 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLK--MRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           L++L LSSN  +G+  +  ++   +  ++ LDL++N+ SG L +  TN S  L  LDLS 
Sbjct: 169 LDALDLSSNKIAGDADLRWMVGAGLGSVRWLDLAWNKISGGLSD-FTNCSG-LQYLDLSG 226

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           N  +G +                             LS C  L +L+LS N+L+G  P +
Sbjct: 227 NLIAGDVAA-------------------------AALSGCRSLRALNLSSNHLAGAFPPN 261

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMY-VKTLETLILDFN 529
           +  L+ L  L L  N   GE+P +    ++ L++L L FN
Sbjct: 262 IAGLTSLTALNLSNNNFSGEVPADAFTGLQQLQSLSLSFN 301

[16][TOP]
>UniRef100_Q76CZ4 Putative brassinosteroid-insensitive 1 n=1 Tax=Hordeum vulgare
           RepID=Q76CZ4_HORVU
          Length = 1118

 Score =  176 bits (445), Expect = 1e-42
 Identities = 91/168 (54%), Positives = 118/168 (70%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           PP     + L +L LS+NNFSGE+P D    ++ L+ L LSFN FSG +P+S+  L   L
Sbjct: 259 PPNIAGLTSLTALNLSNNNFSGEVPADAFTGLQQLQSLSLSFNHFSGSIPDSVAALP-DL 317

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             LDLSSNNFSG I  +LCQ+P + L+ LYLQNN  +G IP  +SNC++LVSL LS NY+
Sbjct: 318 EVLDLSSNNFSGSIPDSLCQDPNSRLRVLYLQNNYLSGSIPEAVSNCTDLVSLDLSLNYI 377

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +G+IP SLG LS+L+DL +W N+LEGEIP  L  +  LE LILD+N L
Sbjct: 378 NGSIPESLGELSRLQDLIMWQNLLEGEIPASLSSIPGLEHLILDYNGL 425

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 81/219 (36%), Positives = 106/219 (48%), Gaps = 47/219 (21%)
 Frame = +2

Query: 20  ELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN- 196
           E+P   F G    L+SL+LS N+FSG +P D++  +  L+VLDLS N FSG +P+SL   
Sbjct: 281 EVPADAFTG-LQQLQSLSLSFNHFSGSIP-DSVAALPDLEVLDLSSNNFSGSIPDSLCQD 338

Query: 197 --------------LSAS----------LLTLDLSSNNFSGPILPNLCQNPKNT------ 286
                         LS S          L++LDLS N  +G I  +L +  +        
Sbjct: 339 PNSRLRVLYLQNNYLSGSIPEAVSNCTDLVSLDLSLNYINGSIPESLGELSRLQDLIMWQ 398

Query: 287 ----------------LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
                           L+ L L  NG TG IPP L+ C +L  + L+ N LSG IPS LG
Sbjct: 399 NLLEGEIPASLSSIPGLEHLILDYNGLTGSIPPELAKCKQLNWISLASNRLSGPIPSWLG 458

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LS L  LKL  N   G+IP EL   K+L  L L+ N L
Sbjct: 459 KLSNLAILKLSNNSFTGKIPAELGDCKSLVWLDLNSNQL 497

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 65/212 (30%), Positives = 92/212 (43%), Gaps = 43/212 (20%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP    C  L  ++L+SN  SG +P   L K+  L +L LS N F+G++P  L +   S
Sbjct: 429  IPPELAKCKQLNWISLASNRLSGPIP-SWLGKLSNLAILKLSNNSFTGKIPAELGDCK-S 486

Query: 209  LLTLDLSSNNFSGPILPNLC-QNPKNTL------QELYLQNNG----------------- 316
            L+ LDL+SN  +G I P L  Q+ K T+        +YL+N+                  
Sbjct: 487  LVWLDLNSNQLNGSIPPELAEQSGKMTVGLIIGRPYVYLRNDELSSQCRGKGSLLEFSSI 546

Query: 317  -------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 439
                               + G    T +    ++ L LSFN L   IP  LG++  L  
Sbjct: 547  RSEDLSRMPSKKLCNFTRMYMGSTEYTFNKNGSMIFLDLSFNQLDSEIPKELGNMFYLMI 606

Query: 440  LKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            + L  N+L G IP EL   K L  L L  N L
Sbjct: 607  MNLGHNLLSGAIPTELAGAKKLAVLDLSHNRL 638

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 57/145 (39%), Positives = 74/145 (51%), Gaps = 3/145 (2%)
 Frame = +2

Query: 2   SLFLSLEL---PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SL LSL      +P   G  S L+ L +  N   GE+P  +L  + GL+ L L +N  +G
Sbjct: 369 SLDLSLNYINGSIPESLGELSRLQDLIMWQNLLEGEIPA-SLSSIPGLEHLILDYNGLTG 427

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
            +P  L      L  + L+SN  SGPI P+      N L  L L NN FTGKIP  L +C
Sbjct: 428 SIPPELAKCK-QLNWISLASNRLSGPI-PSWLGKLSN-LAILKLSNNSFTGKIPAELGDC 484

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLS 427
             LV L L+ N L+G+IP  L   S
Sbjct: 485 KSLVWLDLNSNQLNGSIPPELAEQS 509

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 48/160 (30%), Positives = 77/160 (48%), Gaps = 3/160 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLK--MRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           L++L LSSN  +G+  +  ++   +  ++ LDL++N+ SG L +  TN S  L  LDLS 
Sbjct: 169 LDALDLSSNKIAGDADLRWMVGAGLGSVRWLDLAWNKISGGLSD-FTNCSG-LQYLDLSG 226

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           N  +G +                             LS C  L +L+LS N+L+G  P +
Sbjct: 227 NLIAGDVAA-------------------------AALSGCRSLRALNLSSNHLAGAFPPN 261

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMY-VKTLETLILDFN 529
           +  L+ L  L L  N   GE+P +    ++ L++L L FN
Sbjct: 262 IAGLTSLTALNLSNNNFSGEVPADAFTGLQQLQSLSLSFN 301

[17][TOP]
>UniRef100_Q0ZA03 Brassinosteroid-insensitive 1 n=1 Tax=Triticum aestivum
           RepID=Q0ZA03_WHEAT
          Length = 1124

 Score =  174 bits (440), Expect = 5e-42
 Identities = 90/168 (53%), Positives = 116/168 (69%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           PP     + L +L LS+NNFSGE+P D    ++ L+ L LSFN FSG +P+S+  L   L
Sbjct: 265 PPNIAGLTSLTALNLSNNNFSGEVPADAFTGLQQLQSLSLSFNHFSGSIPDSVAALP-DL 323

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             LDLSSNNFSG I   LCQ+P + L+ LYLQNN  +G IP  +SNC++LVSL LS NY+
Sbjct: 324 EVLDLSSNNFSGTIPSTLCQDPNSRLRVLYLQNNYLSGSIPEAVSNCTDLVSLDLSLNYI 383

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +G+IP SLG L +L+DL +W N+LEGEIP  L  +  LE LILD+N L
Sbjct: 384 NGSIPESLGELGRLQDLIMWQNLLEGEIPASLSSIPGLEHLILDYNGL 431

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 81/219 (36%), Positives = 106/219 (48%), Gaps = 47/219 (21%)
 Frame = +2

Query: 20  ELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN- 196
           E+P   F G    L+SL+LS N+FSG +P D++  +  L+VLDLS N FSG +P +L   
Sbjct: 287 EVPADAFTG-LQQLQSLSLSFNHFSGSIP-DSVAALPDLEVLDLSSNNFSGTIPSTLCQD 344

Query: 197 --------------LSAS----------LLTLDLSSNNFSGPILPNL-----------CQ 271
                         LS S          L++LDLS N  +G I  +L            Q
Sbjct: 345 PNSRLRVLYLQNNYLSGSIPEAVSNCTDLVSLDLSLNYINGSIPESLGELGRLQDLIMWQ 404

Query: 272 N------PKNT-----LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           N      P +      L+ L L  NG TG IPP L+ C +L  + L+ N LSG IP  LG
Sbjct: 405 NLLEGEIPASLSSIPGLEHLILDYNGLTGSIPPELAKCKQLNWISLASNRLSGPIPPWLG 464

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LS L  L+L  N   G+IP EL   K+L  L L+ N L
Sbjct: 465 KLSNLAILELSNNSFTGQIPAELGDCKSLVWLDLNSNQL 503

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 55/145 (37%), Positives = 73/145 (50%), Gaps = 3/145 (2%)
 Frame = +2

Query: 2   SLFLSLEL---PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SL LSL      +P   G    L+ L +  N   GE+P  +L  + GL+ L L +N  +G
Sbjct: 375 SLDLSLNYINGSIPESLGELGRLQDLIMWQNLLEGEIPA-SLSSIPGLEHLILDYNGLTG 433

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
            +P  L      L  + L+SN  SGPI P L     + L  L L NN FTG+IP  L +C
Sbjct: 434 SIPPELAKCK-QLNWISLASNRLSGPIPPWL--GKLSNLAILELSNNSFTGQIPAELGDC 490

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLS 427
             LV L L+ N L+G+IP  L   S
Sbjct: 491 KSLVWLDLNSNQLNGSIPPQLAEQS 515

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 48/160 (30%), Positives = 77/160 (48%), Gaps = 3/160 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLK--MRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           L++L LSSN  +G+  +  ++   +  ++ LDL++N+ SG L +  TN S  L  LDLS 
Sbjct: 175 LDALDLSSNKIAGDADLRWMVGAGLGSVRWLDLAWNKISGGLSD-FTNCSG-LQYLDLSG 232

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           N  +G +                             LS C  L +L+LS N+L+G  P +
Sbjct: 233 NLIAGDVAAG-------------------------ALSGCRSLRALNLSSNHLAGAFPPN 267

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMY-VKTLETLILDFN 529
           +  L+ L  L L  N   GE+P +    ++ L++L L FN
Sbjct: 268 IAGLTSLTALNLSNNNFSGEVPADAFTGLQQLQSLSLSFN 307

[18][TOP]
>UniRef100_Q942F3 Os01g0718300 protein n=2 Tax=Oryza sativa Japonica Group
           RepID=Q942F3_ORYSJ
          Length = 1121

 Score =  171 bits (434), Expect = 2e-41
 Identities = 90/168 (53%), Positives = 115/168 (68%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           PP     + L +L LS+NNFSGELP +   K++ L  L LSFN F+G +P+++ +L   L
Sbjct: 262 PPDIAGLTSLNALNLSNNNFSGELPGEAFAKLQQLTALSLSFNHFNGSIPDTVASLP-EL 320

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             LDLSSN FSG I  +LCQ+P + L  LYLQNN  TG IP  +SNC+ LVSL LS NY+
Sbjct: 321 QQLDLSSNTFSGTIPSSLCQDPNSKLHLLYLQNNYLTGGIPDAVSNCTSLVSLDLSLNYI 380

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +G+IP+SLG L  L+DL LW N LEGEIP  L  ++ LE LILD+N L
Sbjct: 381 NGSIPASLGDLGNLQDLILWQNELEGEIPASLSRIQGLEHLILDYNGL 428

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 55/145 (37%), Positives = 75/145 (51%), Gaps = 3/145 (2%)
 Frame = +2

Query: 2   SLFLSLEL---PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SL LSL      +P   G    L+ L L  N   GE+P  +L +++GL+ L L +N  +G
Sbjct: 372 SLDLSLNYINGSIPASLGDLGNLQDLILWQNELEGEIPA-SLSRIQGLEHLILDYNGLTG 430

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
            +P  L   +  L  + L+SN  SGPI   L     + L  L L NN F+G IPP L +C
Sbjct: 431 SIPPELAKCT-KLNWISLASNRLSGPIPSWL--GKLSYLAILKLSNNSFSGPIPPELGDC 487

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLS 427
             LV L L+ N L+G+IP  L   S
Sbjct: 488 QSLVWLDLNSNQLNGSIPKELAKQS 512

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 59/193 (30%), Positives = 80/193 (41%), Gaps = 42/193 (21%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+P + G  S L  L LS+N+FSG +P + L   + L  LDL+ N+ +G +P+ L   S 
Sbjct: 455  PIPSWLGKLSYLAILKLSNNSFSGPIPPE-LGDCQSLVWLDLNSNQLNGSIPKELAKQSG 513

Query: 206  SL------------LTLDLSSNNFSGP--------ILPN---------LCQ--------- 271
             +            L  D  S+   G         I P+         LC          
Sbjct: 514  KMNVGLIVGRPYVYLRNDELSSECRGKGSLLEFTSIRPDDLSRMPSKKLCNFTRMYVGST 573

Query: 272  ----NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 439
                N   ++  L L  N     IP  L +   L+ ++L  N LSGTIPS L    KL  
Sbjct: 574  EYTFNKNGSMIFLDLSYNQLDSAIPGELGDMFYLMIMNLGHNLLSGTIPSRLAEAKKLAV 633

Query: 440  LKLWLNMLEGEIP 478
            L L  N LEG IP
Sbjct: 634  LDLSYNQLEGPIP 646

[19][TOP]
>UniRef100_A2WUH7 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2WUH7_ORYSI
          Length = 993

 Score =  171 bits (434), Expect = 2e-41
 Identities = 90/168 (53%), Positives = 115/168 (68%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           PP     + L +L LS+NNFSGELP +   K++ L  L LSFN F+G +P+++ +L   L
Sbjct: 175 PPDIAGLTSLNALNLSNNNFSGELPGEAFAKLQQLTALSLSFNHFNGSIPDTVASLP-EL 233

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             LDLSSN FSG I  +LCQ+P + L  LYLQNN  TG IP  +SNC+ LVSL LS NY+
Sbjct: 234 QQLDLSSNTFSGTIPSSLCQDPNSKLHLLYLQNNYLTGGIPDAVSNCTSLVSLDLSLNYI 293

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +G+IP+SLG L  L+DL LW N LEGEIP  L  ++ LE LILD+N L
Sbjct: 294 NGSIPASLGDLGNLQDLILWQNELEGEIPASLSRIQGLEHLILDYNGL 341

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 60/161 (37%), Positives = 80/161 (49%), Gaps = 8/161 (4%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRG-LKVLDLSFNEFSGELPESLTNLSA 205
           +P    S   L+ L LSSN FSG +P          L +L L  N  +G +P++++N + 
Sbjct: 223 IPDTVASLPELQQLDLSSNTFSGTIPSSLCQDPNSKLHLLYLQNNYLTGGIPDAVSNCT- 281

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SL++LDLS N  +G I  +L       LQ+L L  N   G+IP +LS    L  L L +N
Sbjct: 282 SLVSLDLSLNYINGSIPASL--GDLGNLQDLILWQNELEGEIPASLSRIQGLEHLILDYN 339

Query: 386 YL-------SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            L       SG IP  LG    L  L L  N L G IP+EL
Sbjct: 340 GLTVSNNSFSGPIPPELGDCQSLVWLDLNSNQLNGSIPKEL 380

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 52/175 (29%), Positives = 72/175 (41%), Gaps = 24/175 (13%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDL------------------ 151
           P+PP  G C  L  L L+SN  +G +P + L K  G   + L                  
Sbjct: 351 PIPPELGDCQSLVWLDLNSNQLNGSIPKE-LAKQSGKMNVGLIVGRPYVYLRNDELSSEC 409

Query: 152 ----SFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNN 313
               S  EF+   P+ L+ + +  L       NF+   + +     N   ++  L L  N
Sbjct: 410 RGKGSLLEFTSIRPDDLSRMPSKKLC------NFTRMYVGSTEYTFNKNGSMIFLDLSYN 463

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
                IP  L +   L+ ++L  N LSGTIPS L    KL  L L  N LEG IP
Sbjct: 464 QLDSAIPGELGDMFYLMIMNLGHNLLSGTIPSRLAEAKKLAVLDLSYNQLEGPIP 518

[20][TOP]
>UniRef100_C5XIB8 Putative uncharacterized protein Sb03g032990 n=1 Tax=Sorghum
           bicolor RepID=C5XIB8_SORBI
          Length = 1120

 Score =  169 bits (429), Expect = 9e-41
 Identities = 89/170 (52%), Positives = 117/170 (68%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P PP   + + L +L LS+NNFS ELP D   +++ LK L LSFN F+G +P+SL  L  
Sbjct: 258 PFPPDVAALTSLAALNLSNNNFSSELPADAFTELQQLKALSLSFNHFNGTIPDSLAALP- 316

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  LDLSSN+FSG I  ++CQ P ++L+ LYLQNN  +G IP ++SNC+ L SL LS N
Sbjct: 317 ELDVLDLSSNSFSGTIPSSICQGPNSSLRMLYLQNNYLSGAIPESISNCTRLQSLDLSLN 376

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            ++GT+P+SLG L +LRDL LW N+L GEIP  L  +  LE LILD+N L
Sbjct: 377 NINGTLPASLGKLGELRDLILWQNLLVGEIPASLESLDKLEHLILDYNGL 426

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 64/212 (30%), Positives = 89/212 (41%), Gaps = 43/212 (20%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP    C  L  ++L+SN  SG +P   L ++  L +L LS N FSG +P  L N   S
Sbjct: 430  IPPELSKCKDLNWISLASNQLSGPIPA-WLGQLSNLAILKLSNNSFSGPIPAELGNCQ-S 487

Query: 209  LLTLDLSSNNFSGPILPNLC-QNPKNTL------QELYLQNNG----------------- 316
            L+ LDL+SN  +G I   L  Q+ K  +        +YL+N+                  
Sbjct: 488  LVWLDLNSNQLNGSIPAELAKQSGKMNVGLVIGRPYVYLRNDELSSECHGKGSLLEFTSI 547

Query: 317  -------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 439
                               + G    T +    ++ L LSFN L   IP  LG++  L  
Sbjct: 548  RPEELSRMPSKKLCNFTRVYMGSTEYTFNKNGSMIFLDLSFNQLDSEIPKELGNMFYLMI 607

Query: 440  LKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            + L  N+L G IP EL   K L  L L  N L
Sbjct: 608  MNLGHNLLSGVIPPELAGAKKLAVLDLSHNQL 639

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 58/193 (30%), Positives = 78/193 (40%), Gaps = 42/193 (21%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+P + G  S L  L LS+N+FSG +P + L   + L  LDL+ N+ +G +P  L   S 
Sbjct: 453  PIPAWLGQLSNLAILKLSNNSFSGPIPAE-LGNCQSLVWLDLNSNQLNGSIPAELAKQSG 511

Query: 206  S-------------LLTLDLSSN-NFSGPILP---------------NLCQ--------- 271
                          L   +LSS  +  G +L                 LC          
Sbjct: 512  KMNVGLVIGRPYVYLRNDELSSECHGKGSLLEFTSIRPEELSRMPSKKLCNFTRVYMGST 571

Query: 272  ----NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 439
                N   ++  L L  N    +IP  L N   L+ ++L  N LSG IP  L    KL  
Sbjct: 572  EYTFNKNGSMIFLDLSFNQLDSEIPKELGNMFYLMIMNLGHNLLSGVIPPELAGAKKLAV 631

Query: 440  LKLWLNMLEGEIP 478
            L L  N LEG IP
Sbjct: 632  LDLSHNQLEGPIP 644

[21][TOP]
>UniRef100_C5XI29 Putative uncharacterized protein Sb03g012040 n=1 Tax=Sorghum
           bicolor RepID=C5XI29_SORBI
          Length = 918

 Score =  151 bits (381), Expect = 3e-35
 Identities = 88/160 (55%), Positives = 107/160 (66%), Gaps = 1/160 (0%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L +L LS+NNFSGE+P +  L +  L+ L+LSFN F G +PE +T L   L  LDLSSN 
Sbjct: 189 LTTLNLSNNNFSGEIPGNAFLHLPKLRTLNLSFNYFDGSIPEVVTMLP-ELEILDLSSNL 247

Query: 239 FSGPILPNLCQ-NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
            SG I   LC  N  + LQ LYLQNN  TG I   +S+C+ LVSL LS NY++GTIPSSL
Sbjct: 248 LSGIIPGTLCSTNTSSKLQVLYLQNNYLTGGISEAISSCTGLVSLDLSLNYINGTIPSSL 307

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G L  LRDL LW N L+GEIP  L  + +LE LILD+N L
Sbjct: 308 GMLPGLRDLVLWQNALDGEIPASLSRMLSLEYLILDYNAL 347

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 60/146 (41%), Positives = 73/146 (50%), Gaps = 3/146 (2%)
 Frame = +2

Query: 2   SLFLSLEL---PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SL LSL      +P   G    L  L L  N   GE+P  +L +M  L+ L L +N   G
Sbjct: 291 SLDLSLNYINGTIPSSLGMLPGLRDLVLWQNALDGEIPA-SLSRMLSLEYLILDYNALVG 349

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
            +P  L N +  L  + L+SN  SGP LP       N LQ L L NN FTG IPP L +C
Sbjct: 350 SIPSGLANCT-ELKWMSLASNRLSGP-LPTWLGQLVN-LQVLRLGNNSFTGPIPPELGDC 406

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSK 430
             L+ L LS N L G IPS L   S+
Sbjct: 407 RSLLWLDLSGNQLKGHIPSELAKQSR 432

[22][TOP]
>UniRef100_B9HJL5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HJL5_POPTR
          Length = 1134

 Score =  136 bits (342), Expect = 1e-30
 Identities = 79/170 (46%), Positives = 107/170 (62%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P  F  CS L++L LS+NN SG  P   L  +  L+ L +S+N  SG  P S+++   
Sbjct: 290 PIPVSFSPCSWLQTLDLSNNNISGPFPDSILQNLGSLERLLISYNLISGLFPASVSSCK- 348

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SL  LDLSSN FSG I P++C    + L+EL L +N   G+IP  LS CS+L +L LS N
Sbjct: 349 SLKVLDLSSNRFSGTIPPDICPGAAS-LEELRLPDNLIEGEIPAQLSQCSKLKTLDLSIN 407

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +L+G+IP+ LG+L  L  L  W N LEG+IP EL   K L+ LIL+ N+L
Sbjct: 408 FLNGSIPAELGNLENLEQLIAWYNGLEGKIPPELGKCKNLKDLILNNNNL 457

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 72/195 (36%), Positives = 99/195 (50%), Gaps = 26/195 (13%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   +C+ L++L LS N  +GE+P  +L ++  L+ LDLS N  SG +P  L N   S
Sbjct: 218 IPPSLSNCTNLKTLNLSFNMITGEIPR-SLGELGSLQRLDLSHNHISGWIPSELGNACNS 276

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL--------------- 343
           LL L LS NN SGPI  +   +P + LQ L L NN  +G  P ++               
Sbjct: 277 LLELKLSYNNISGPIPVSF--SPCSWLQTLDLSNNNISGPFPDSILQNLGSLERLLISYN 334

Query: 344 ----------SNCSELVSLHLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQELM 490
                     S+C  L  L LS N  SGTIP  +    + L +L+L  N++EGEIP +L 
Sbjct: 335 LISGLFPASVSSCKSLKVLDLSSNRFSGTIPPDICPGAASLEELRLPDNLIEGEIPAQLS 394

Query: 491 YVKTLETLILDFNDL 535
               L+TL L  N L
Sbjct: 395 QCSKLKTLDLSINFL 409

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 65/160 (40%), Positives = 87/160 (54%), Gaps = 1/160 (0%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L LSS    G +P     K   L  ++LS N  S  LP+ L   S  +  LDLS NN
Sbjct: 129 LQQLQLSSTGLEGPVPEKFFSKNPNLVYVNLSHNNLSS-LPDDLLLNSDKVQALDLSYNN 187

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           F+G I     +N  N+L +L L  N     IPP+LSNC+ L +L+LSFN ++G IP SLG
Sbjct: 188 FTGSISGLRVENSCNSLSQLDLSGNFLMDSIPPSLSNCTNLKTLNLSFNMITGEIPRSLG 247

Query: 419 SLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFNDL 535
            L  L+ L L  N + G IP EL     +L  L L +N++
Sbjct: 248 ELGSLQRLDLSHNHISGWIPSELGNACNSLLELKLSYNNI 287

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 72/190 (37%), Positives = 89/190 (46%), Gaps = 22/190 (11%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P    SC  L+ L LSSN FSG +P D       L+ L L  N   GE+P  L+  S  L
Sbjct: 341 PASVSSCKSLKVLDLSSNRFSGTIPPDICPGAASLEELRLPDNLIEGEIPAQLSQCS-KL 399

Query: 212 LTLDLSSNNFSGPI------LPNLCQ----------------NPKNTLQELYLQNNGFTG 325
            TLDLS N  +G I      L NL Q                     L++L L NN  +G
Sbjct: 400 KTLDLSINFLNGSIPAELGNLENLEQLIAWYNGLEGKIPPELGKCKNLKDLILNNNNLSG 459

Query: 326 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            IP  L +CS L  + L+ N  +G IP   G LS+L  L+L  N L GEIP EL    +L
Sbjct: 460 IIPVELFSCSNLEWISLTSNQFTGKIPREFGLLSRLAVLQLANNSLSGEIPTELGNCSSL 519

Query: 506 ETLILDFNDL 535
             L L+ N L
Sbjct: 520 VWLDLNSNKL 529

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 61/159 (38%), Positives = 82/159 (51%), Gaps = 2/159 (1%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           +E  +P     CS L++L LS N  +G +P + L  +  L+ L   +N   G++P  L  
Sbjct: 385 IEGEIPAQLSQCSKLKTLDLSINFLNGSIPAE-LGNLENLEQLIAWYNGLEGKIPPELGK 443

Query: 197 LSASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
              +L  L L++NN SG I   L  C N    L+ + L +N FTGKIP      S L  L
Sbjct: 444 CK-NLKDLILNNNNLSGIIPVELFSCSN----LEWISLTSNQFTGKIPREFGLLSRLAVL 498

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            L+ N LSG IP+ LG+ S L  L L  N L GEIP  L
Sbjct: 499 QLANNSLSGEIPTELGNCSSLVWLDLNSNKLTGEIPPRL 537

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 46/134 (34%), Positives = 64/134 (47%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +PP  G C  L+ L L++NN SG +P++ L     L+ + L+ N+F+G++P     
Sbjct: 433 LEGKIPPELGKCKNLKDLILNNNNLSGIIPVE-LFSCSNLEWISLTSNQFTGKIPREFGL 491

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
           LS                            L  L L NN  +G+IP  L NCS LV L L
Sbjct: 492 LSR---------------------------LAVLQLANNSLSGEIPTELGNCSSLVWLDL 524

Query: 377 SFNYLSGTIPSSLG 418
           + N L+G IP  LG
Sbjct: 525 NSNKLTGEIPPRLG 538

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 65/210 (30%), Positives = 86/210 (40%), Gaps = 41/210 (19%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-TNLSA 205
            +P  FG  S L  L L++N+ SGE+P + L     L  LDL+ N+ +GE+P  L   L A
Sbjct: 485  IPREFGLLSRLAVLQLANNSLSGEIPTE-LGNCSSLVWLDLNSNKLTGEIPPRLGRQLGA 543

Query: 206  SLLTLDLSSNN-------------------FSGPILPNLCQNPK---------------- 280
              L+  LS N                    F+G     L Q P                 
Sbjct: 544  KALSGILSGNTLVFVRNVGNSCKGVGGLLEFAGIKAERLLQVPTLKTCDFTRLYSGAVLS 603

Query: 281  -----NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
                  TL+ L L  N   GKIP  +     L  L L+ N LSG IP+SLG L  L    
Sbjct: 604  LFTQYQTLEYLDLSYNELRGKIPDEIGEMMALQVLELAHNQLSGEIPASLGQLKNLGVFD 663

Query: 446  LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
               N L+G+IP     +  L  + L  N+L
Sbjct: 664  ASHNRLQGQIPDSFSNLSFLVQIDLSNNEL 693

[23][TOP]
>UniRef100_Q9ZPS9 Serine/threonine-protein kinase BRI1-like 2 n=2 Tax=Arabidopsis
           thaliana RepID=BRL2_ARATH
          Length = 1143

 Score =  136 bits (342), Expect = 1e-30
 Identities = 78/169 (46%), Positives = 103/169 (60%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    SCS L+SL LS+NN SG  P   L     L++L LS N  SG+ P S++    S
Sbjct: 293 IPESLSSCSWLQSLDLSNNNISGPFPNTILRSFGSLQILLLSNNLISGDFPTSISACK-S 351

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L   D SSN FSG I P+LC    + L+EL L +N  TG+IPP +S CSEL ++ LS NY
Sbjct: 352 LRIADFSSNRFSGVIPPDLCPGAAS-LEELRLPDNLVTGEIPPAISQCSELRTIDLSLNY 410

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GTIP  +G+L KL     W N + GEIP E+  ++ L+ LIL+ N L
Sbjct: 411 LNGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGKLQNLKDLILNNNQL 459

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 66/171 (38%), Positives = 92/171 (53%), Gaps = 5/171 (2%)
 Frame = +2

Query: 38  FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA--SL 211
           FF   S L S+ LS NNF+G+LP D  L  + L+ LDLS+N  +G +      LS+  S+
Sbjct: 147 FFSKYSNLISITLSYNNFTGKLPNDLFLSSKKLQTLDLSYNNITGPISGLTIPLSSCVSM 206

Query: 212 LTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
             LD S N+ SG I  +L  C N    L+ L L  N F G+IP +      L SL LS N
Sbjct: 207 TYLDFSGNSISGYISDSLINCTN----LKSLNLSYNNFDGQIPKSFGELKLLQSLDLSHN 262

Query: 386 YLSGTIPSSLGSLSK-LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G IP  +G   + L++L+L  N   G IP+ L     L++L L  N++
Sbjct: 263 RLTGWIPPEIGDTCRSLQNLRLSYNNFTGVIPESLSSCSWLQSLDLSNNNI 313

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 64/161 (39%), Positives = 85/161 (52%), Gaps = 3/161 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L LSS+   G LP +   K   L  + LS+N F+G+LP  L   S  L TLDLS NN
Sbjct: 129 LTHLELSSSGLIGTLPENFFSKYSNLISITLSYNNFTGKLPNDLFLSSKKLQTLDLSYNN 188

Query: 239 FSGPILPNLCQNPKNTLQELYL--QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
            +GPI   L     + +   YL    N  +G I  +L NC+ L SL+LS+N   G IP S
Sbjct: 189 ITGPI-SGLTIPLSSCVSMTYLDFSGNSISGYISDSLINCTNLKSLNLSYNNFDGQIPKS 247

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFND 532
            G L  L+ L L  N L G IP E+    ++L+ L L +N+
Sbjct: 248 FGELKLLQSLDLSHNRLTGWIPPEIGDTCRSLQNLRLSYNN 288

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 65/190 (34%), Positives = 87/190 (45%), Gaps = 22/190 (11%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P    +C  L     SSN FSG +P D       L+ L L  N  +GE+P +++  S  L
Sbjct: 343 PTSISACKSLRIADFSSNRFSGVIPPDLCPGAASLEELRLPDNLVTGEIPPAISQCS-EL 401

Query: 212 LTLDLSSNNFSGPILPNLCQNPK----------------------NTLQELYLQNNGFTG 325
            T+DLS N  +G I P +    K                        L++L L NN  TG
Sbjct: 402 RTIDLSLNYLNGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGKLQNLKDLILNNNQLTG 461

Query: 326 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
           +IPP   NCS +  +  + N L+G +P   G LS+L  L+L  N   GEIP EL    TL
Sbjct: 462 EIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSRLAVLQLGNNNFTGEIPPELGKCTTL 521

Query: 506 ETLILDFNDL 535
             L L+ N L
Sbjct: 522 VWLDLNTNHL 531

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 48/130 (36%), Positives = 73/130 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   LE      NN +GE+P + + K++ LK L L+ N+ +GE+P    N S +
Sbjct: 415 IPPEIGNLQKLEQFIAWYNNIAGEIPPE-IGKLQNLKDLILNNNQLTGEIPPEFFNCS-N 472

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +  +  +SN  +G +  +      + L  L L NN FTG+IPP L  C+ LV L L+ N+
Sbjct: 473 IEWVSFTSNRLTGEVPKDF--GILSRLAVLQLGNNNFTGEIPPELGKCTTLVWLDLNTNH 530

Query: 389 LSGTIPSSLG 418
           L+G IP  LG
Sbjct: 531 LTGEIPPRLG 540

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 60/168 (35%), Positives = 83/168 (49%), Gaps = 3/168 (1%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F S   L  L LS N F        LL +  L  L+LS +   G LPE+  +  ++L+++
Sbjct: 99  FTSLDSLSVLKLSENFFVLNSTSLLLLPLT-LTHLELSSSGLIGTLPENFFSKYSNLISI 157

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP---TLSNCSELVSLHLSFNYL 391
            LS NNF+G  LPN        LQ L L  N  TG I      LS+C  +  L  S N +
Sbjct: 158 TLSYNNFTGK-LPNDLFLSSKKLQTLDLSYNNITGPISGLTIPLSSCVSMTYLDFSGNSI 216

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           SG I  SL + + L+ L L  N  +G+IP+    +K L++L L  N L
Sbjct: 217 SGYISDSLINCTNLKSLNLSYNNFDGQIPKSFGELKLLQSLDLSHNRL 264

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 63/190 (33%), Positives = 87/190 (45%), Gaps = 21/190 (11%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLD--LSFN-------------- 160
            +PP  G C+ L  L L++N+ +GE+P   L +  G K L   LS N              
Sbjct: 511  IPPELGKCTTLVWLDLNTNHLTGEIP-PRLGRQPGSKALSGLLSGNTMAFVRNVGNSCKG 569

Query: 161  -----EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 325
                 EFSG  PE L  +  SL + D +   +SGPIL    +    T++ L L  N   G
Sbjct: 570  VGGLVEFSGIRPERLLQIP-SLKSCDFT-RMYSGPILSLFTRY--QTIEYLDLSYNQLRG 625

Query: 326  KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            KIP  +     L  L LS N LSG IP ++G L  L       N L+G+IP+    +  L
Sbjct: 626  KIPDEIGEMIALQVLELSHNQLSGEIPFTIGQLKNLGVFDASDNRLQGQIPESFSNLSFL 685

Query: 506  ETLILDFNDL 535
              + L  N+L
Sbjct: 686  VQIDLSNNEL 695

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 32/75 (42%), Positives = 46/75 (61%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L+ L LS N  SGE+P  T+ +++ L V D S N   G++PES +NLS  
Sbjct: 627 IPDEIGEMIALQVLELSHNQLSGEIPF-TIGQLKNLGVFDASDNRLQGQIPESFSNLSF- 684

Query: 209 LLTLDLSSNNFSGPI 253
           L+ +DLS+N  +GPI
Sbjct: 685 LVQIDLSNNELTGPI 699

[24][TOP]
>UniRef100_C7SI08 Brassinosteroid receptor-like protein n=1 Tax=Thellungiella
           halophila RepID=C7SI08_THEHA
          Length = 1143

 Score =  133 bits (335), Expect = 7e-30
 Identities = 77/169 (45%), Positives = 102/169 (60%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    SCS L+ L LS+NN SG  P   L     L++L LS N  SGE P SL+    S
Sbjct: 295 IPDSLSSCSWLQILDLSNNNISGPFPDKILRSFGSLQILLLSNNLISGEFPSSLSACK-S 353

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L   D SSN FSG I P+LC    + L+EL + +N  TG+IPP +S CSEL ++ LS NY
Sbjct: 354 LRIADFSSNRFSGVIPPDLCPGAAS-LEELRIPDNLVTGQIPPEISQCSELRTIDLSLNY 412

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GTIP  +G+L KL     W N + G+IP E+  ++ L+ LIL+ N L
Sbjct: 413 LNGTIPPEIGNLQKLEQFIAWYNNISGKIPPEIGKLQNLKDLILNNNQL 461

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 70/172 (40%), Positives = 94/172 (54%), Gaps = 1/172 (0%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L +PL     SC  L  L  S N+ SG +P D+L+    LK L+LS+N F G++P+S   
Sbjct: 198 LTIPL----SSCLSLSFLDFSGNSISGYIP-DSLINCTNLKSLNLSYNNFDGQIPKSFGE 252

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
           L  SL +LDLS N  +G I P +  +   +LQ L +  N  TG IP +LS+CS L  L L
Sbjct: 253 LK-SLQSLDLSHNRLTGWIPPEI-GDACGSLQNLRVSYNNITGVIPDSLSSCSWLQILDL 310

Query: 377 SFNYLSGTIPSS-LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           S N +SG  P   L S   L+ L L  N++ GE P  L   K+L   I DF+
Sbjct: 311 SNNNISGPFPDKILRSFGSLQILLLSNNLISGEFPSSLSACKSLR--IADFS 360

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 66/171 (38%), Positives = 90/171 (52%), Gaps = 5/171 (2%)
 Frame = +2

Query: 38  FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA--SL 211
           FF   S L S+ LS NNF+G LP D  L  + L+ LDLS+N  +G +      LS+  SL
Sbjct: 149 FFPKYSNLISITLSYNNFTGNLPKDVFLGGKKLQTLDLSYNNITGSISGLTIPLSSCLSL 208

Query: 212 LTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
             LD S N+ SG I  +L  C N    L+ L L  N F G+IP +      L SL LS N
Sbjct: 209 SFLDFSGNSISGYIPDSLINCTN----LKSLNLSYNNFDGQIPKSFGELKSLQSLDLSHN 264

Query: 386 YLSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G IP  +G +   L++L++  N + G IP  L     L+ L L  N++
Sbjct: 265 RLTGWIPPEIGDACGSLQNLRVSYNNITGVIPDSLSSCSWLQILDLSNNNI 315

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 63/190 (33%), Positives = 86/190 (45%), Gaps = 22/190 (11%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P    +C  L     SSN FSG +P D       L+ L +  N  +G++P  ++  S  L
Sbjct: 345 PSSLSACKSLRIADFSSNRFSGVIPPDLCPGAASLEELRIPDNLVTGQIPPEISQCS-EL 403

Query: 212 LTLDLSSNNFSGPILPNLCQNPK----------------------NTLQELYLQNNGFTG 325
            T+DLS N  +G I P +    K                        L++L L NN  TG
Sbjct: 404 RTIDLSLNYLNGTIPPEIGNLQKLEQFIAWYNNISGKIPPEIGKLQNLKDLILNNNQLTG 463

Query: 326 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
           +IPP   NCS +  +  + N L+G +P   G LS+L  L+L  N   GEIP EL    TL
Sbjct: 464 EIPPEFFNCSNIEWISFTSNRLTGEVPREFGILSRLAVLQLGNNNFTGEIPSELGKCTTL 523

Query: 506 ETLILDFNDL 535
             L L+ N L
Sbjct: 524 VWLDLNTNHL 533

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 47/130 (36%), Positives = 71/130 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   LE      NN SG++P + + K++ LK L L+ N+ +GE+P    N S +
Sbjct: 417 IPPEIGNLQKLEQFIAWYNNISGKIPPE-IGKLQNLKDLILNNNQLTGEIPPEFFNCS-N 474

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +  +  +SN  +G +         + L  L L NN FTG+IP  L  C+ LV L L+ N+
Sbjct: 475 IEWISFTSNRLTGEVPREF--GILSRLAVLQLGNNNFTGEIPSELGKCTTLVWLDLNTNH 532

Query: 389 LSGTIPSSLG 418
           L+G IP  LG
Sbjct: 533 LTGEIPPRLG 542

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 60/168 (35%), Positives = 84/168 (50%), Gaps = 3/168 (1%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F S   L  L LS N F        LL +  L  L+LS +   G LPE      ++L+++
Sbjct: 101 FTSLDSLSVLKLSENFFVLNSTSLLLLPL-SLTHLELSSSGLIGILPEIFFPKYSNLISI 159

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP---TLSNCSELVSLHLSFNYL 391
            LS NNF+G +  ++    K  LQ L L  N  TG I      LS+C  L  L  S N +
Sbjct: 160 TLSYNNFTGNLPKDVFLGGKK-LQTLDLSYNNITGSISGLTIPLSSCLSLSFLDFSGNSI 218

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           SG IP SL + + L+ L L  N  +G+IP+    +K+L++L L  N L
Sbjct: 219 SGYIPDSLINCTNLKSLNLSYNNFDGQIPKSFGELKSLQSLDLSHNRL 266

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 63/212 (29%), Positives = 84/212 (39%), Gaps = 43/212 (20%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  FG  S L  L L +NNF+GE+P + L K   L  LDL+ N  +GE+P  L     S
Sbjct: 489  VPREFGILSRLAVLQLGNNNFTGEIPSE-LGKCTTLVWLDLNTNHLTGEIPPRLGRQPGS 547

Query: 209  LLTLDLSSNN-------------------------------------------FSGPILP 259
                 L S N                                           +SGPIL 
Sbjct: 548  KALSGLLSGNTMAFVRNVGNSCKGVGGLVEFAGIRPERLLQIPSLKSCDFTRMYSGPILS 607

Query: 260  NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 439
               +    T++ L L  N   GKIP  +     L  L LS N LSG IP ++G L  L  
Sbjct: 608  LFTRY--QTIEYLDLSYNQLRGKIPDEIGEMIALQVLELSHNQLSGEIPFTIGQLKNLGV 665

Query: 440  LKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
                 N L+G+IP+    +  L  + L  N+L
Sbjct: 666  FDASDNRLQGQIPESFSNLSFLVQIDLSNNEL 697

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 32/75 (42%), Positives = 46/75 (61%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L+ L LS N  SGE+P  T+ +++ L V D S N   G++PES +NLS  
Sbjct: 629 IPDEIGEMIALQVLELSHNQLSGEIPF-TIGQLKNLGVFDASDNRLQGQIPESFSNLSF- 686

Query: 209 LLTLDLSSNNFSGPI 253
           L+ +DLS+N  +GPI
Sbjct: 687 LVQIDLSNNELTGPI 701

[25][TOP]
>UniRef100_B9HVQ5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HVQ5_POPTR
          Length = 1135

 Score =  133 bits (335), Expect = 7e-30
 Identities = 77/170 (45%), Positives = 104/170 (61%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P     CSLL++L LS+NN SG  P   L  +  L+ L LS+N  SG  P S++    
Sbjct: 291 PVPVSLSPCSLLQTLDLSNNNISGPFPDSILQNLASLERLLLSYNLISGSFPASISYCK- 349

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SL  +DLSSN FSG I P++C    + L+EL L +N   G+IP  LS CS+L +L  S N
Sbjct: 350 SLKIVDLSSNRFSGTIPPDICPGAAS-LEELRLPDNLIIGEIPAQLSQCSKLKTLDFSIN 408

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +L+G+IP+ LG L  L  L  W N LEG+IP EL   + L+ LIL+ N+L
Sbjct: 409 FLNGSIPAELGKLENLEQLIAWYNSLEGKIPPELGKCRNLKDLILNNNNL 458

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 61/143 (42%), Positives = 77/143 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L L      G +P +   K   L   +LS N  S  LP+ L   S  + TLDLS NN
Sbjct: 129 LQQLQLCYTGLEGPVPENFFSKNPNLVYANLSHNNLSELLPDDLLLNSDKVQTLDLSYNN 188

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           F+G       +N  N+L +L L  N     IPPTLSNC+ L +L+LSFN L+G IP S G
Sbjct: 189 FTGSFSGLKIENSCNSLSQLDLSGNHLMDSIPPTLSNCTNLKNLNLSFNMLTGEIPRSFG 248

Query: 419 SLSKLRDLKLWLNMLEGEIPQEL 487
            LS L+ L L  N + G IP EL
Sbjct: 249 KLSSLQRLDLSHNHITGWIPSEL 271

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 59/154 (38%), Positives = 88/154 (57%), Gaps = 1/154 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   +C+ L++L LS N  +GE+P  +  K+  L+ LDLS N  +G +P  L N   S
Sbjct: 219 IPPTLSNCTNLKNLNLSFNMLTGEIPR-SFGKLSSLQRLDLSHNHITGWIPSELGNACNS 277

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPT-LSNCSELVSLHLSFN 385
           LL L +S NN SGP+  +L  +P + LQ L L NN  +G  P + L N + L  L LS+N
Sbjct: 278 LLELKISYNNISGPVPVSL--SPCSLLQTLDLSNNNISGPFPDSILQNLASLERLLLSYN 335

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            +SG+ P+S+     L+ + L  N   G IP ++
Sbjct: 336 LISGSFPASISYCKSLKIVDLSSNRFSGTIPPDI 369

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 72/200 (36%), Positives = 96/200 (48%), Gaps = 26/200 (13%)
 Frame = +2

Query: 8   FLSLELPLPP-FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE 184
           +  LE P+P  FF     L    LS NN S  LP D LL    ++ LDLS+N F+G    
Sbjct: 136 YTGLEGPVPENFFSKNPNLVYANLSHNNLSELLPDDLLLNSDKVQTLDLSYNNFTGSFSG 195

Query: 185 -SLTNLSASLLTLDLSSNNFSGPILPNL--CQNPKN--------------------TLQE 295
             + N   SL  LDLS N+    I P L  C N KN                    +LQ 
Sbjct: 196 LKIENSCNSLSQLDLSGNHLMDSIPPTLSNCTNLKNLNLSFNMLTGEIPRSFGKLSSLQR 255

Query: 296 LYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 472
           L L +N  TG IP  L N C+ L+ L +S+N +SG +P SL   S L+ L L  N + G 
Sbjct: 256 LDLSHNHITGWIPSELGNACNSLLELKISYNNISGPVPVSLSPCSLLQTLDLSNNNISGP 315

Query: 473 IPQELMY-VKTLETLILDFN 529
            P  ++  + +LE L+L +N
Sbjct: 316 FPDSILQNLASLERLLLSYN 335

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 59/155 (38%), Positives = 80/155 (51%), Gaps = 2/155 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P     CS L++L  S N  +G +P + L K+  L+ L   +N   G++P  L     +
Sbjct: 390 IPAQLSQCSKLKTLDFSINFLNGSIPAE-LGKLENLEQLIAWYNSLEGKIPPELGKCR-N 447

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           L  L L++NN SG I   L  C N    L+ + L +N FTG+IP      S L  L L+ 
Sbjct: 448 LKDLILNNNNLSGIIPVELFRCTN----LEWISLTSNQFTGEIPREFGLLSRLAVLQLAN 503

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N LSG IP+ LG+ S L  L L  N L GEIP  L
Sbjct: 504 NSLSGEIPTELGNCSSLVWLDLNSNKLTGEIPPRL 538

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 48/135 (35%), Positives = 66/135 (48%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SLE  +PP  G C  L+ L L++NN SG +P++ L +   L+ + L+ N+F+GE+P    
Sbjct: 433 SLEGKIPPELGKCRNLKDLILNNNNLSGIIPVE-LFRCTNLEWISLTSNQFTGEIPREFG 491

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            LS                            L  L L NN  +G+IP  L NCS LV L 
Sbjct: 492 LLSR---------------------------LAVLQLANNSLSGEIPTELGNCSSLVWLD 524

Query: 374 LSFNYLSGTIPSSLG 418
           L+ N L+G IP  LG
Sbjct: 525 LNSNKLTGEIPPRLG 539

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 54/166 (32%), Positives = 88/166 (53%), Gaps = 3/166 (1%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMR-GLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           S  +L +L LS N F+  +   +LL +   L+ L L +    G +PE+  + + +L+  +
Sbjct: 101 SLDMLSALNLSLNLFT--VSSTSLLHLPYALQQLQLCYTGLEGPVPENFFSKNPNLVYAN 158

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL--SNCSELVSLHLSFNYLSG 397
           LS NN S  +  +L  N  + +Q L L  N FTG        ++C+ L  L LS N+L  
Sbjct: 159 LSHNNLSELLPDDLLLN-SDKVQTLDLSYNNFTGSFSGLKIENSCNSLSQLDLSGNHLMD 217

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +IP +L + + L++L L  NML GEIP+    + +L+ L L  N +
Sbjct: 218 SIPPTLSNCTNLKNLNLSFNMLTGEIPRSFGKLSSLQRLDLSHNHI 263

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 65/212 (30%), Positives = 87/212 (41%), Gaps = 43/212 (20%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-TNLSA 205
            +P  FG  S L  L L++N+ SGE+P + L     L  LDL+ N+ +GE+P  L   L A
Sbjct: 486  IPREFGLLSRLAVLQLANNSLSGEIPTE-LGNCSSLVWLDLNSNKLTGEIPPRLGRQLGA 544

Query: 206  SLLTLDLSSNN------------------------------------------FSGPILP 259
              L+  LS N                                           +SG +L 
Sbjct: 545  KALSGILSGNTLVFVRNVGNSCKGVGGLLEFAGIKAERLLQVPTFKTCDFTIMYSGAVLS 604

Query: 260  NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 439
               Q    TL+ L L  N   GKIP  + +   L  L LS N LSG IP+SLG L  L  
Sbjct: 605  RFTQY--QTLEYLDLSYNELRGKIPDEIGDMMALQVLELSHNQLSGEIPASLGQLKNLGV 662

Query: 440  LKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
                 N L+G+IP     +  L  + L  N+L
Sbjct: 663  FDASHNRLQGQIPDSFSNLSFLVQIDLSSNEL 694

[26][TOP]
>UniRef100_B9S7D4 Serine/threonine-protein kinase bri1, putative n=1 Tax=Ricinus
           communis RepID=B9S7D4_RICCO
          Length = 1140

 Score =  128 bits (321), Expect = 3e-28
 Identities = 76/176 (43%), Positives = 104/176 (59%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F ++   +P  F +CS L+ L LS+NN +G  P   L  +  L+ L LS+N  SG  P S
Sbjct: 290 FNNISGSIPISFSTCSWLQVLDLSNNNITGPFPDSILQNLSSLERLLLSYNLISGSFPVS 349

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           ++    +L  +DLSSN FSG I P +C    + L+EL + +N   G+IP  LS CS+L S
Sbjct: 350 ISYCK-NLRVVDLSSNKFSGIIPPEICPGAAS-LEELRMPDNLIVGEIPAQLSQCSKLKS 407

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  S NYL+G+IP+ LG L  L  L  W N LEG+IP EL   + L+ LIL+ N L
Sbjct: 408 LDFSINYLNGSIPAELGKLGNLEQLIAWYNGLEGKIPAELGKCRNLKDLILNNNHL 463

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 67/161 (41%), Positives = 89/161 (55%), Gaps = 2/161 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L LSS    G +P +   K      ++LS N  +G LP+ L + S  L  LDLS NN
Sbjct: 133 LQHLELSSAVLLGVVPENFFSKYPNFVYVNLSHNNLTGSLPDDLLSYSDKLQVLDLSYNN 192

Query: 239 FSGPILP-NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           F+G I    + Q+  N+L +L L  N     IPP+LSNC+ L SL+LS N L+G IP S 
Sbjct: 193 FTGSISGFKIDQSSCNSLWQLDLSGNHLEYFIPPSLSNCTNLKSLNLSSNMLTGEIPRSF 252

Query: 416 GSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFNDL 535
           G LS L+ L L  N L G IP EL     +L  + L FN++
Sbjct: 253 GELSSLQRLDLSHNHLTGWIPSELGNACSSLLEVKLSFNNI 293

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 66/160 (41%), Positives = 89/160 (55%), Gaps = 3/160 (1%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +PP   +C+ L+SL LSSN  +GE+P  +  ++  L+ LDLS N  +G +P  L N
Sbjct: 220 LEYFIPPSLSNCTNLKSLNLSSNMLTGEIPR-SFGELSSLQRLDLSHNHLTGWIPSELGN 278

Query: 197 LSASLLTLDLSSNNFSG--PILPNLCQNPKNTLQELYLQNNGFTGKIPPT-LSNCSELVS 367
             +SLL + LS NN SG  PI  + C    + LQ L L NN  TG  P + L N S L  
Sbjct: 279 ACSSLLEVKLSFNNISGSIPISFSTC----SWLQVLDLSNNNITGPFPDSILQNLSSLER 334

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           L LS+N +SG+ P S+     LR + L  N   G IP E+
Sbjct: 335 LLLSYNLISGSFPVSISYCKNLRVVDLSSNKFSGIIPPEI 374

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 69/190 (36%), Positives = 95/190 (50%), Gaps = 26/190 (13%)
 Frame = +2

Query: 38  FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA--SL 211
           FF        + LS NN +G LP D L     L+VLDLS+N F+G +     + S+  SL
Sbjct: 151 FFSKYPNFVYVNLSHNNLTGSLPDDLLSYSDKLQVLDLSYNNFTGSISGFKIDQSSCNSL 210

Query: 212 LTLDLSSNNFSGPILPNL--CQNPKN--------------------TLQELYLQNNGFTG 325
             LDLS N+    I P+L  C N K+                    +LQ L L +N  TG
Sbjct: 211 WQLDLSGNHLEYFIPPSLSNCTNLKSLNLSSNMLTGEIPRSFGELSSLQRLDLSHNHLTG 270

Query: 326 KIPPTLSN-CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY-VK 499
            IP  L N CS L+ + LSFN +SG+IP S  + S L+ L L  N + G  P  ++  + 
Sbjct: 271 WIPSELGNACSSLLEVKLSFNNISGSIPISFSTCSWLQVLDLSNNNITGPFPDSILQNLS 330

Query: 500 TLETLILDFN 529
           +LE L+L +N
Sbjct: 331 SLERLLLSYN 340

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 66/170 (38%), Positives = 85/170 (50%), Gaps = 2/170 (1%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P      + LE L +  N   GE+P   L +   LK LD S N  +G +P  L  L  +L
Sbjct: 372 PEICPGAASLEELRMPDNLIVGEIPAQ-LSQCSKLKSLDFSINYLNGSIPAELGKLG-NL 429

Query: 212 LTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
             L    N   G I   L  C+N    L++L L NN  TG+IP  L +CS L  + L+ N
Sbjct: 430 EQLIAWYNGLEGKIPAELGKCRN----LKDLILNNNHLTGEIPVELFDCSNLEWISLTSN 485

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +SG IPS  G LS+L  L+L  N L GEIP+EL    +L  L L  N L
Sbjct: 486 QISGKIPSEFGLLSRLAVLQLGNNSLSGEIPRELGNCSSLVWLDLGSNRL 535

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 57/155 (36%), Positives = 77/155 (49%), Gaps = 2/155 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P     CS L+SL  S N  +G +P + L K+  L+ L   +N   G++P  L     +
Sbjct: 395 IPAQLSQCSKLKSLDFSINYLNGSIPAE-LGKLGNLEQLIAWYNGLEGKIPAELGKCR-N 452

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           L  L L++N+ +G I   L  C N    L+ + L +N  +GKIP      S L  L L  
Sbjct: 453 LKDLILNNNHLTGEIPVELFDCSN----LEWISLTSNQISGKIPSEFGLLSRLAVLQLGN 508

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N LSG IP  LG+ S L  L L  N L GEIP  L
Sbjct: 509 NSLSGEIPRELGNCSSLVWLDLGSNRLTGEIPPRL 543

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 67/195 (34%), Positives = 86/195 (44%), Gaps = 21/195 (10%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLD-------LSFN---- 160
            SL   +P   G+CS L  L L SN  +GE+P   L +  G K L        L F     
Sbjct: 510  SLSGEIPRELGNCSSLVWLDLGSNRLTGEIP-PRLGRQLGAKALGGIPSGNTLVFVRNVG 568

Query: 161  ----------EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN 310
                      EF+G   E L     +L T D +   ++GP+L    Q    TL+ L L N
Sbjct: 569  NSCQGVGGLLEFAGIRSERLLQFP-TLKTCDFT-RLYTGPVLSLFTQY--QTLEYLDLSN 624

Query: 311  NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM 490
            N   GKIP  +     L  L LS+N LSG IP SLG L  L       N L+GEIP    
Sbjct: 625  NQLRGKIPDEMGEMMALQVLVLSYNQLSGEIPPSLGQLKNLGVFDASHNRLQGEIPDSFS 684

Query: 491  YVKTLETLILDFNDL 535
             +  L  + L +N+L
Sbjct: 685  NLSFLVQIDLSYNEL 699

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 51/130 (39%), Positives = 66/130 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    LE L    N   G++P + L K R LK L L+ N  +GE+P  L + S +
Sbjct: 419 IPAELGKLGNLEQLIAWYNGLEGKIPAE-LGKCRNLKDLILNNNHLTGEIPVELFDCS-N 476

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + L+SN  SG I         + L  L L NN  +G+IP  L NCS LV L L  N 
Sbjct: 477 LEWISLTSNQISGKIPSEF--GLLSRLAVLQLGNNSLSGEIPRELGNCSSLVWLDLGSNR 534

Query: 389 LSGTIPSSLG 418
           L+G IP  LG
Sbjct: 535 LTGEIPPRLG 544

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 69/238 (28%), Positives = 91/238 (38%), Gaps = 65/238 (27%)
 Frame = +2

Query: 17   LELPLPPFFGSCSLLESLALSSNNFSGELPMD------------TLLKMRG--------- 133
            LE  +P   G C  L+ L L++N+ +GE+P++            T  ++ G         
Sbjct: 439  LEGKIPAELGKCRNLKDLILNNNHLTGEIPVELFDCSNLEWISLTSNQISGKIPSEFGLL 498

Query: 134  --LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP---------------- 259
              L VL L  N  SGE+P  L N S SL+ LDL SN  +G I P                
Sbjct: 499  SRLAVLQLGNNSLSGEIPRELGNCS-SLVWLDLGSNRLTGEIPPRLGRQLGAKALGGIPS 557

Query: 260  -----------NLCQNPKNTLQ------ELYLQ---------NNGFTGKIPPTLSNCSEL 361
                       N CQ     L+      E  LQ            +TG +    +    L
Sbjct: 558  GNTLVFVRNVGNSCQGVGGLLEFAGIRSERLLQFPTLKTCDFTRLYTGPVLSLFTQYQTL 617

Query: 362  VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              L LS N L G IP  +G +  L+ L L  N L GEIP  L  +K L       N L
Sbjct: 618  EYLDLSNNQLRGKIPDEMGEMMALQVLVLSYNQLSGEIPPSLGQLKNLGVFDASHNRL 675

[27][TOP]
>UniRef100_C6FF68 ATP binding/protein serine/threonine kinase n=2 Tax=Glycine max
           RepID=C6FF68_SOYBN
          Length = 1173

 Score =  127 bits (320), Expect = 4e-28
 Identities = 75/176 (42%), Positives = 101/176 (57%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F ++   +PP F SCS L+ L +S+NN SG+LP      +  L+ L L  N  +G+ P S
Sbjct: 323 FNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSS 382

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           L++    L  +D SSN   G I  +LC    + L+EL + +N  TG+IP  LS CS+L +
Sbjct: 383 LSSCK-KLKIVDFSSNKIYGSIPRDLCPGAVS-LEELRMPDNLITGEIPAELSKCSKLKT 440

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  S NYL+GTIP  LG L  L  L  W N LEG IP +L   K L+ LIL+ N L
Sbjct: 441 LDFSLNYLNGTIPDELGELENLEQLIAWFNSLEGSIPPKLGQCKNLKDLILNNNHL 496

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 66/161 (40%), Positives = 86/161 (53%), Gaps = 2/161 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           LE L +  N  +GE+P + L K   LK LD S N  +G +P+ L  L  +L  L    N+
Sbjct: 414 LEELRMPDNLITGEIPAE-LSKCSKLKTLDFSLNYLNGTIPDELGELE-NLEQLIAWFNS 471

Query: 239 FSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
             G I P L  C+N    L++L L NN  TG IP  L NCS L  + L+ N LS  IP  
Sbjct: 472 LEGSIPPKLGQCKN----LKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRK 527

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            G L++L  L+L  N L GEIP EL   ++L  L L+ N L
Sbjct: 528 FGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKL 568

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 63/164 (38%), Positives = 90/164 (54%), Gaps = 1/164 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMR-GLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           S  +L  L +S N+FS  +   +LL +   L  LDLSF   +G +PE+L +   +L+ ++
Sbjct: 141 SLDMLSVLKMSLNSFS--VNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVN 198

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           LS NN +GPI  N  QN  + LQ L L  N  +G I      C  L+ L LS N LS +I
Sbjct: 199 LSYNNLTGPIPENFFQN-SDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSI 257

Query: 404 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           P SL + + L+ L L  NM+ G+IP+    +  L+TL L  N L
Sbjct: 258 PLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQL 301

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 62/172 (36%), Positives = 86/172 (50%), Gaps = 2/172 (1%)
 Frame = +2

Query: 26  PLPP-FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           P+P   F  C  L  + LS NN +G +P +       L+VLDLS+N  SG +   L    
Sbjct: 182 PVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPI-FGLKMEC 240

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
            SLL LDLS N  S  I   L  +   +L+ L L NN  +G IP      ++L +L LS 
Sbjct: 241 ISLLQLDLSGNRLSDSI--PLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSH 298

Query: 383 NYLSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N L+G IPS  G + + L +LKL  N + G IP        L+ L +  N++
Sbjct: 299 NQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNM 350

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 66/216 (30%), Positives = 86/216 (39%), Gaps = 43/216 (19%)
 Frame = +2

Query: 17   LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-T 193
            L   +P  FG  + L  L L +N+ +GE+P + L   R L  LDL+ N+ +GE+P  L  
Sbjct: 520  LSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSE-LANCRSLVWLDLNSNKLTGEIPPRLGR 578

Query: 194  NLSASLLTLDLSSNN------------------------------------------FSG 247
             L A  L   LS N                                           +SG
Sbjct: 579  QLGAKSLFGILSGNTLVFVRNVGNSCKGVGGLLEFSGIRPERLLQVPTLRTCDFARLYSG 638

Query: 248  PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS 427
            P+L    +    TL+ L L  N   GKIP    +   L  L LS N LSG IPSSLG L 
Sbjct: 639  PVLSQFTKY--QTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLK 696

Query: 428  KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L       N L+G IP     +  L  + L  N+L
Sbjct: 697  NLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNEL 732

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 48/137 (35%), Positives = 65/137 (47%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F SLE  +PP  G C  L+ L L++N+ +G +P++ L     L+ + L+ NE S E+P  
Sbjct: 469 FNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIE-LFNCSNLEWISLTSNELSWEIPRK 527

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
                  LLT                       L  L L NN  TG+IP  L+NC  LV 
Sbjct: 528 F-----GLLT----------------------RLAVLQLGNNSLTGEIPSELANCRSLVW 560

Query: 368 LHLSFNYLSGTIPSSLG 418
           L L+ N L+G IP  LG
Sbjct: 561 LDLNSNKLTGEIPPRLG 577

[28][TOP]
>UniRef100_A7P416 Chromosome chr1 scaffold_5, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7P416_VITVI
          Length = 1134

 Score =  125 bits (315), Expect = 1e-27
 Identities = 71/169 (42%), Positives = 98/169 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  F SCS L  L L++NN SG  P   L  +  L+ L LS+N  SG  P S+++   +
Sbjct: 292 IPASFSSCSWLRLLNLANNNISGPFPDSILQSLASLETLLLSYNNISGAFPASISSCQ-N 350

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +D SSN  SG I P++C    + L+EL + +N  +G+IP  LS CS L ++  S NY
Sbjct: 351 LKVVDFSSNKLSGFIPPDICPGAAS-LEELRIPDNLISGEIPAELSQCSRLKTIDFSLNY 409

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IP  +G L  L  L  W N L+GEIP EL   + L+ LIL+ N+L
Sbjct: 410 LKGPIPPQIGRLENLEQLIAWFNALDGEIPPELGKCRNLKDLILNNNNL 458

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 69/193 (35%), Positives = 94/193 (48%), Gaps = 28/193 (14%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG---------------- 172
           F     L S  L+ NN +G LP D LL    L+VLDLS+N  +G                
Sbjct: 148 FSKLPNLVSATLALNNLTGSLPDDLLLNSDKLQVLDLSYNNLTGSISGLKIENSCTSLVV 207

Query: 173 ----------ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
                      LP S++N + SL TL+LS NN +G I P+        LQ L L  N  T
Sbjct: 208 LDLSGNNLMDSLPSSISNCT-SLNTLNLSYNNLTGEIPPSF--GGLKNLQRLDLSRNRLT 264

Query: 323 GKIPPTLSN-CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY-V 496
           G +P  L N C  L  + LS N ++G IP+S  S S LR L L  N + G  P  ++  +
Sbjct: 265 GWMPSELGNTCGSLQEIDLSNNNITGLIPASFSSCSWLRLLNLANNNISGPFPDSILQSL 324

Query: 497 KTLETLILDFNDL 535
            +LETL+L +N++
Sbjct: 325 ASLETLLLSYNNI 337

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 68/194 (35%), Positives = 89/194 (45%), Gaps = 26/194 (13%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P    SC  L+ +  SSN  SG +P D       L+ L +  N  SGE+P  L+  S  L
Sbjct: 342 PASISSCQNLKVVDFSSNKLSGFIPPDICPGAASLEELRIPDNLISGEIPAELSQCSR-L 400

Query: 212 LTLDLSSNNFSGPILPNL--------------------------CQNPKNTLQELYLQNN 313
            T+D S N   GPI P +                          C+N    L++L L NN
Sbjct: 401 KTIDFSLNYLKGPIPPQIGRLENLEQLIAWFNALDGEIPPELGKCRN----LKDLILNNN 456

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
              GKIP  L NC  L  + L+ N L+G IP   G LS+L  L+L  N L G+IP+EL  
Sbjct: 457 NLGGKIPSELFNCGNLEWISLTSNGLTGQIPPEFGLLSRLAVLQLGNNSLSGQIPRELAN 516

Query: 494 VKTLETLILDFNDL 535
             +L  L L+ N L
Sbjct: 517 CSSLVWLDLNSNRL 530

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 66/193 (34%), Positives = 95/193 (49%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    +C+ L +L LS NN +GE+P  +   ++ L+ LDLS N  +G +P  L N   S
Sbjct: 219 LPSSISNCTSLNTLNLSYNNLTGEIP-PSFGGLKNLQRLDLSRNRLTGWMPSELGNTCGS 277

Query: 209 LLTLDLSSNNFSGPI-----------LPNLCQN------PKNTLQE------LYLQNNGF 319
           L  +DLS+NN +G I           L NL  N      P + LQ       L L  N  
Sbjct: 278 LQEIDLSNNNITGLIPASFSSCSWLRLLNLANNNISGPFPDSILQSLASLETLLLSYNNI 337

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQELMYV 496
           +G  P ++S+C  L  +  S N LSG IP  +    + L +L++  N++ GEIP EL   
Sbjct: 338 SGAFPASISSCQNLKVVDFSSNKLSGFIPPDICPGAASLEELRIPDNLISGEIPAELSQC 397

Query: 497 KTLETLILDFNDL 535
             L+T+    N L
Sbjct: 398 SRLKTIDFSLNYL 410

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 62/164 (37%), Positives = 86/164 (52%), Gaps = 1/164 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           SC+ L  L LS NN    LP  ++     L  L+LS+N  +GE+P S   L  +L  LDL
Sbjct: 201 SCTSLVVLDLSGNNLMDSLP-SSISNCTSLNTLNLSYNNLTGEIPPSFGGLK-NLQRLDL 258

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
           S N  +G  +P+   N   +LQE+ L NN  TG IP + S+CS L  L+L+ N +SG  P
Sbjct: 259 SRNRLTG-WMPSELGNTCGSLQEIDLSNNNITGLIPASFSSCSWLRLLNLANNNISGPFP 317

Query: 407 SS-LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            S L SL+ L  L L  N + G  P  +   + L+ +    N L
Sbjct: 318 DSILQSLASLETLLLSYNNISGAFPASISSCQNLKVVDFSSNKL 361

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 55/143 (38%), Positives = 74/143 (51%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L LSS    G +P +   K+  L    L+ N  +G LP+ L   S  L  LDLS NN
Sbjct: 129 LTQLDLSSAGLVGLVPENLFSKLPNLVSATLALNNLTGSLPDDLLLNSDKLQVLDLSYNN 188

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G I     +N   +L  L L  N     +P ++SNC+ L +L+LS+N L+G IP S G
Sbjct: 189 LTGSISGLKIENSCTSLVVLDLSGNNLMDSLPSSISNCTSLNTLNLSYNNLTGEIPPSFG 248

Query: 419 SLSKLRDLKLWLNMLEGEIPQEL 487
            L  L+ L L  N L G +P EL
Sbjct: 249 GLKNLQRLDLSRNRLTGWMPSEL 271

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 54/134 (40%), Positives = 71/134 (52%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L+ P+PP  G    LE L    N   GE+P + L K R LK L L+ N   G++P  L N
Sbjct: 410 LKGPIPPQIGRLENLEQLIAWFNALDGEIPPE-LGKCRNLKDLILNNNNLGGKIPSELFN 468

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
              +L  + L+SN  +G I P       + L  L L NN  +G+IP  L+NCS LV L L
Sbjct: 469 CG-NLEWISLTSNGLTGQIPPEF--GLLSRLAVLQLGNNSLSGQIPRELANCSSLVWLDL 525

Query: 377 SFNYLSGTIPSSLG 418
           + N L+G IP  LG
Sbjct: 526 NSNRLTGEIPPRLG 539

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 57/155 (36%), Positives = 75/155 (48%), Gaps = 2/155 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P     CS L+++  S N   G +P   + ++  L+ L   FN   GE+P  L     +
Sbjct: 390 IPAELSQCSRLKTIDFSLNYLKGPIPPQ-IGRLENLEQLIAWFNALDGEIPPELGKCR-N 447

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           L  L L++NN  G I   L  C N    L+ + L +NG TG+IPP     S L  L L  
Sbjct: 448 LKDLILNNNNLGGKIPSELFNCGN----LEWISLTSNGLTGQIPPEFGLLSRLAVLQLGN 503

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N LSG IP  L + S L  L L  N L GEIP  L
Sbjct: 504 NSLSGQIPRELANCSSLVWLDLNSNRLTGEIPPRL 538

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 67/210 (31%), Positives = 85/210 (40%), Gaps = 41/210 (19%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-TNLSA 205
            +PP FG  S L  L L +N+ SG++P + L     L  LDL+ N  +GE+P  L   L A
Sbjct: 486  IPPEFGLLSRLAVLQLGNNSLSGQIPRE-LANCSSLVWLDLNSNRLTGEIPPRLGRQLGA 544

Query: 206  SLLTLDLSSNN-------------------FSGPILPNLCQNPK---------------- 280
              L+  LS N                    F+G     L Q P                 
Sbjct: 545  KSLSGILSGNTLAFVRNLGNSCKGVGGLLEFAGIRPERLLQIPTLKTCDFTRMYSGAVLS 604

Query: 281  -----NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
                  TL+ L L  N   GKIP  +     L  L LS N LSG IPSSLG L  L    
Sbjct: 605  LFTKYQTLEYLDLSYNELRGKIPDEIGGMVALQVLELSHNQLSGEIPSSLGQLRNLGVFD 664

Query: 446  LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
               N L+G IP     +  L  + L +N+L
Sbjct: 665  ASHNRLQGHIPDSFSNLSFLVQIDLSYNEL 694

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 60/169 (35%), Positives = 85/169 (50%), Gaps = 6/169 (3%)
 Frame = +2

Query: 47  SCSLLESLALSSN----NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 214
           S  +L  L+LS N    N +G L +       GL  LDLS     G +PE+L +   +L+
Sbjct: 101 SLDMLSVLSLSGNLFYVNSTGLLQLPV-----GLTQLDLSSAGLVGLVPENLFSKLPNLV 155

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL--SNCSELVSLHLSFNY 388
           +  L+ NN +G +  +L  N  + LQ L L  N  TG I      ++C+ LV L LS N 
Sbjct: 156 SATLALNNLTGSLPDDLLLN-SDKLQVLDLSYNNLTGSISGLKIENSCTSLVVLDLSGNN 214

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  ++PSS+ + + L  L L  N L GEIP     +K L+ L L  N L
Sbjct: 215 LMDSLPSSISNCTSLNTLNLSYNNLTGEIPPSFGGLKNLQRLDLSRNRL 263

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 72/243 (29%), Positives = 97/243 (39%), Gaps = 67/243 (27%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTL---------LKMRG--------- 133
            F +L+  +PP  G C  L+ L L++NN  G++P +           L   G         
Sbjct: 431  FNALDGEIPPELGKCRNLKDLILNNNNLGGKIPSELFNCGNLEWISLTSNGLTGQIPPEF 490

Query: 134  -----LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQN-------- 274
                 L VL L  N  SG++P  L N S SL+ LDL+SN  +G I P L +         
Sbjct: 491  GLLSRLAVLQLGNNSLSGQIPRELANCS-SLVWLDLNSNRLTGEIPPRLGRQLGAKSLSG 549

Query: 275  --PKNTLQELYLQNNG-----------FTGKIP------PTLSNC--------------- 352
                NTL   +++N G           F G  P      PTL  C               
Sbjct: 550  ILSGNTL--AFVRNLGNSCKGVGGLLEFAGIRPERLLQIPTLKTCDFTRMYSGAVLSLFT 607

Query: 353  --SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDF 526
                L  L LS+N L G IP  +G +  L+ L+L  N L GEIP  L  ++ L       
Sbjct: 608  KYQTLEYLDLSYNELRGKIPDEIGGMVALQVLELSHNQLSGEIPSSLGQLRNLGVFDASH 667

Query: 527  NDL 535
            N L
Sbjct: 668  NRL 670

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 44/115 (38%), Positives = 63/115 (54%)
 Frame = +2

Query: 89  FSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLC 268
           +SG + +    K + L+ LDLS+NE  G++P+ +  + A L  L+LS N  SG I  +L 
Sbjct: 598 YSGAV-LSLFTKYQTLEYLDLSYNELRGKIPDEIGGMVA-LQVLELSHNQLSGEIPSSLG 655

Query: 269 QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 433
           Q     L      +N   G IP + SN S LV + LS+N L+G IP+  G LS L
Sbjct: 656 Q--LRNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSYNELTGQIPTR-GQLSTL 707

[29][TOP]
>UniRef100_C5XPD3 Putative uncharacterized protein Sb03g005800 n=1 Tax=Sorghum
           bicolor RepID=C5XPD3_SORBI
          Length = 1053

 Score =  124 bits (311), Expect = 4e-27
 Identities = 81/169 (47%), Positives = 101/169 (59%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           L P  G+ S L  L L SN FSG +P  +L ++R L  LDLS N FSG LP +L++ + S
Sbjct: 92  LSPAIGNLSSLRVLDLDSNGFSGNIP-GSLGRLRHLHTLDLSRNAFSGSLPTNLSSCT-S 149

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+TL L  NN SG I   L    K+ L+EL LQNN FTG+IP +L+N + L  L L+FN 
Sbjct: 150 LITLVLDFNNLSGNIPSELGDKLKH-LKELSLQNNSFTGRIPASLANLTSLSLLDLAFNL 208

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L GTIP  LG L  LR L L  N L GE P  L  + +LE L +  N L
Sbjct: 209 LEGTIPKGLGVLKDLRGLALAFNNLSGETPISLYNLSSLEILQIQSNML 257

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 69/191 (36%), Positives = 100/191 (52%), Gaps = 22/191 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L  +   S N  G +P  ++ K++ L+ LD + N  +G +P  +  LS  
Sbjct: 438 IPSSIGNLSKLAFVYAHSANLEGPIPT-SIGKLKSLQALDFAMNHLNGSIPREIFQLS-- 494

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC------------ 352
           L+ LDLSSN+ SGP LP+   + +N L +L+L  N  +G+IP ++ NC            
Sbjct: 495 LIYLDLSSNSLSGP-LPSQIGSLQN-LNQLFLSGNQLSGEIPESIGNCVVLQDLWLGNNF 552

Query: 353 ----------SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
                       L +L+LS N LSGTIP +LGS+S L  L L  N L G IP  L  + +
Sbjct: 553 FNGSIPQYLNKGLTTLNLSMNRLSGTIPGALGSISGLEQLCLAHNNLSGPIPTVLQNLTS 612

Query: 503 LETLILDFNDL 535
           L  L L FN+L
Sbjct: 613 LFKLDLSFNNL 623

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 68/194 (35%), Positives = 94/194 (48%), Gaps = 25/194 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    SC+ L +L L  NN SG +P +   K++ LK L L  N F+G +P SL NL+ S
Sbjct: 140 LPTNLSSCTSLITLVLDFNNLSGNIPSELGDKLKHLKELSLQNNSFTGRIPASLANLT-S 198

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDL+ N   G I   L       L+ L L  N  +G+ P +L N S L  L +  N 
Sbjct: 199 LSLLDLAFNLLEGTIPKGL--GVLKDLRGLALAFNNLSGETPISLYNLSSLEILQIQSNM 256

Query: 389 LSG-------------------------TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
           LSG                         TIP+SL +L+ L++L L  NML G +P+ +  
Sbjct: 257 LSGSIPTDIGNMFPSMRGLGLFTNRFTGTIPTSLSNLTSLQELHLADNMLSGYVPRTIGR 316

Query: 494 VKTLETLILDFNDL 535
           ++ L+ L L  N L
Sbjct: 317 LRALQKLYLYKNML 330

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 60/146 (41%), Positives = 82/146 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + + L  L L+ N   G +P   L  ++ L+ L L+FN  SGE P SL NLS S
Sbjct: 189 IPASLANLTSLSLLDLAFNLLEGTIPKG-LGVLKDLRGLALAFNNLSGETPISLYNLS-S 246

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L + SN  SG I P    N   +++ L L  N FTG IP +LSN + L  LHL+ N 
Sbjct: 247 LEILQIQSNMLSGSI-PTDIGNMFPSMRGLGLFTNRFTGTIPTSLSNLTSLQELHLADNM 305

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLE 466
           LSG +P ++G L  L+ L L+ NML+
Sbjct: 306 LSGYVPRTIGRLRALQKLYLYKNMLQ 331

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 62/176 (35%), Positives = 91/176 (51%), Gaps = 8/176 (4%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           LS E P+  +  + S LE L + SN  SG +P D       ++ L L  N F+G +P SL
Sbjct: 233 LSGETPISLY--NLSSLEILQIQSNMLSGSIPTDIGNMFPSMRGLGLFTNRFTGTIPTSL 290

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY-----LQNNGFTG-KIPPTLSNC 352
           +NL+ SL  L L+ N  SG +   +       LQ+LY     LQ N + G +   +LSNC
Sbjct: 291 SNLT-SLQELHLADNMLSGYVPRTI--GRLRALQKLYLYKNMLQANDWEGWEFITSLSNC 347

Query: 353 SELVSLHLSFNY-LSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETL 514
           S+L  L ++ N  L+G +PSS+ +LS  L+ L      + G IP  +  +  LE L
Sbjct: 348 SQLQQLQINNNADLTGLLPSSIVNLSTNLQLLHFGATGIWGSIPSTIGNLVGLEFL 403

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 36/90 (40%), Positives = 47/90 (52%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
           C+  +  +  L L ++G TG + P + N S L  L L  N  SG IP SLG L  L  L 
Sbjct: 71  CRGTRPRVVALSLPSHGLTGVLSPAIGNLSSLRVLDLDSNGFSGNIPGSLGRLRHLHTLD 130

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N   G +P  L    +L TL+LDFN+L
Sbjct: 131 LSRNAFSGSLPTNLSSCTSLITLVLDFNNL 160

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 43/154 (27%), Positives = 77/154 (50%), Gaps = 1/154 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSN-NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           +CS L+ L +++N + +G LP   +     L++L        G +P ++ NL   L  L 
Sbjct: 346 NCSQLQQLQINNNADLTGLLPSSIVNLSTNLQLLHFGATGIWGSIPSTIGNL-VGLEFLG 404

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
            +  + SG I  ++       L  + L N+  +G+IP ++ N S+L  ++     L G I
Sbjct: 405 ANDASISGVIPDSI--GKLGNLSGVSLYNSNLSGQIPSSIGNLSKLAFVYAHSANLEGPI 462

Query: 404 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
           P+S+G L  L+ L   +N L G IP+E+  +  +
Sbjct: 463 PTSIGKLKSLQALDFAMNHLNGSIPREIFQLSLI 496

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 50/159 (31%), Positives = 78/159 (49%), Gaps = 6/159 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDL-----SFNEFSG-ELPESL 190
           +P    + + L+ L L+ N  SG +P  T+ ++R L+ L L       N++ G E   SL
Sbjct: 286 IPTSLSNLTSLQELHLADNMLSGYVPR-TIGRLRALQKLYLYKNMLQANDWEGWEFITSL 344

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           +N S  L  L +++N     +LP+   N    LQ L+    G  G IP T+ N   L  L
Sbjct: 345 SNCS-QLQQLQINNNADLTGLLPSSIVNLSTNLQLLHFGATGIWGSIPSTIGNLVGLEFL 403

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
             +   +SG IP S+G L  L  + L+ + L G+IP  +
Sbjct: 404 GANDASISGVIPDSIGKLGNLSGVSLYNSNLSGQIPSSI 442

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 49/155 (31%), Positives = 77/155 (49%), Gaps = 1/155 (0%)
 Frame = +2

Query: 74  LSSNNFSGELPMDTLLKMRGLKVLDLSFN-EFSGELPESLTNLSASLLTLDLSSNNFSGP 250
           L +N++ G   + +L     L+ L ++ N + +G LP S+ NLS +L  L   +    G 
Sbjct: 330 LQANDWEGWEFITSLSNCSQLQQLQINNNADLTGLLPSSIVNLSTNLQLLHFGATGIWGS 389

Query: 251 ILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK 430
           I P+   N    L+ L   +   +G IP ++     L  + L  + LSG IPSS+G+LSK
Sbjct: 390 I-PSTIGNLVG-LEFLGANDASISGVIPDSIGKLGNLSGVSLYNSNLSGQIPSSIGNLSK 447

Query: 431 LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  +      LEG IP  +  +K+L+ L    N L
Sbjct: 448 LAFVYAHSANLEGPIPTSIGKLKSLQALDFAMNHL 482

[30][TOP]
>UniRef100_UPI0001983F66 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983F66
          Length = 1185

 Score =  123 bits (308), Expect = 1e-26
 Identities = 71/179 (39%), Positives = 108/179 (60%), Gaps = 3/179 (1%)
 Frame = +2

Query: 2   SLFL---SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SLFL   S    +PP  G+ S+LE+L L  N+  G +P + + K+  +K+LD+  N+  G
Sbjct: 150 SLFLGNNSFTGTIPPSIGNMSMLETLGLGGNHLQGNIP-EEIGKLSTMKILDIQSNQLVG 208

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
            +P ++ N+S SL  + L+ N+ SG +  ++C +  + L+ + L  N FTG IP  LS C
Sbjct: 209 AIPSAIFNIS-SLQEIALTYNSLSGDLPSSMCNHELSALRGIRLSANRFTGPIPSNLSKC 267

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            EL +L+LSFN  +G IP S+ SL+KL  L L  N L G IP+E+ ++ +LE L L  N
Sbjct: 268 GELQTLYLSFNKFTGGIPRSIDSLTKLTMLSLAANSLSGTIPEEISFLPSLEYLYLRSN 326

 Score =  102 bits (253), Expect = 2e-20
 Identities = 62/175 (35%), Positives = 90/175 (51%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           L L   +PP  G+ S L SL LSSNNF G +P++ + ++  L  ++L +N  SG++P S 
Sbjct: 84  LGLRGTIPPDLGNLSFLVSLDLSSNNFHGPVPVE-VGQLTSLLSMNLQYNLLSGQIPPSF 142

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            NL                           N LQ L+L NN FTG IPP++ N S L +L
Sbjct: 143 GNL---------------------------NRLQSLFLGNNSFTGTIPPSIGNMSMLETL 175

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N+L G IP  +G LS ++ L +  N L G IP  +  + +L+ + L +N L
Sbjct: 176 GLGGNHLQGNIPEEIGKLSTMKILDIQSNQLVGAIPSAIFNISSLQEIALTYNSL 230

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 66/171 (38%), Positives = 99/171 (57%), Gaps = 7/171 (4%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           G+C+ L  L LSSN+ +GE+P + +  +  L VL++  N  +G +P  + N+S S+++  
Sbjct: 387 GNCTSLRELYLSSNDLTGEVPCE-IGSLCTLNVLNIEDNSLTGHIPFQIFNIS-SMVSGS 444

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           L+ NN SG + PN      N L+ L L+ N  +G IP ++ N S+L SL   +N L+G+I
Sbjct: 445 LTRNNLSGNLPPNFGSYLPN-LENLILEINWLSGIIPSSIGNASKLRSLDFGYNMLTGSI 503

Query: 404 PSSLGSLSKLRDLKLWLNMLEGE-IPQELMYV------KTLETLILDFNDL 535
           P +LGSL  L  L L +N L+GE   QEL ++      K L  L L FN L
Sbjct: 504 PHALGSLRFLERLNLGVNNLKGESYIQELSFLTSLTNCKRLRILYLSFNPL 554

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 70/203 (34%), Positives = 100/203 (49%), Gaps = 29/203 (14%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMR-GLKVLDLSFNEFSGELPESL 190
           S   P+P      S L+++ L  N FSG +P+D +   R  L+++ L  N F+G +   +
Sbjct: 327 SFTSPIPSAIFKISTLKAIDLGKNGFSGSMPLDIMCAHRPSLQLIGLDSNRFTGTIHGGI 386

Query: 191 TNLSASLLTLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL 361
            N + SL  L LSSN+ +G +   + +LC     TL  L +++N  TG IP  + N S +
Sbjct: 387 GNCT-SLRELYLSSNDLTGEVPCEIGSLC-----TLNVLNIEDNSLTGHIPFQIFNISSM 440

Query: 362 VS-------------------------LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLE 466
           VS                         L L  N+LSG IPSS+G+ SKLR L    NML 
Sbjct: 441 VSGSLTRNNLSGNLPPNFGSYLPNLENLILEINWLSGIIPSSIGNASKLRSLDFGYNMLT 500

Query: 467 GEIPQELMYVKTLETLILDFNDL 535
           G IP  L  ++ LE L L  N+L
Sbjct: 501 GSIPHALGSLRFLERLNLGVNNL 523

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 61/195 (31%), Positives = 97/195 (49%), Gaps = 25/195 (12%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNL 199
           P+P     C  L++L LS N F+G +P  +D+L K   L +L L+ N  SG +PE ++ L
Sbjct: 259 PIPSNLSKCGELQTLYLSFNKFTGGIPRSIDSLTK---LTMLSLAANSLSGTIPEEISFL 315

Query: 200 SA-----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN 310
            +                       +L  +DL  N FSG +  ++    + +LQ + L +
Sbjct: 316 PSLEYLYLRSNSFTSPIPSAIFKISTLKAIDLGKNGFSGSMPLDIMCAHRPSLQLIGLDS 375

Query: 311 NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM 490
           N FTG I   + NC+ L  L+LS N L+G +P  +GSL  L  L +  N L G IP ++ 
Sbjct: 376 NRFTGTIHGGIGNCTSLRELYLSSNDLTGEVPCEIGSLCTLNVLNIEDNSLTGHIPFQIF 435

Query: 491 YVKTLETLILDFNDL 535
            + ++ +  L  N+L
Sbjct: 436 NISSMVSGSLTRNNL 450

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 60/171 (35%), Positives = 92/171 (53%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP FG+ + L+SL L +N+F+G +P  ++  M  L+ L L  N   G +PE +  LS +
Sbjct: 138 IPPSFGNLNRLQSLFLGNNSFTGTIP-PSIGNMSMLETLGLGGNHLQGNIPEEIGKLS-T 195

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN--CSELVSLHLSF 382
           +  LD+ SN   G I P+   N  ++LQE+ L  N  +G +P ++ N   S L  + LS 
Sbjct: 196 MKILDIQSNQLVGAI-PSAIFNI-SSLQEIALTYNSLSGDLPSSMCNHELSALRGIRLSA 253

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N  +G IPS+L    +L+ L L  N   G IP+ +  +  L  L L  N L
Sbjct: 254 NRFTGPIPSNLSKCGELQTLYLSFNKFTGGIPRSIDSLTKLTMLSLAANSL 304

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 60/169 (35%), Positives = 84/169 (49%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP  G    L+ L L SN   G +P D + ++R L  L L+ N+ SG +P  L  L+  
Sbjct: 607  IPPSIGQLQKLQGLYLPSNKLQGSIPND-ICQLRNLGELFLTNNQLSGSIPACLGELTF- 664

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L L SN  +  I P+   +  + L  L + +N   G +P  + N   LV + LS N 
Sbjct: 665  LRHLYLGSNKLNSTI-PSTLWSLIHILS-LDMSSNFLVGYLPSDMGNLKVLVKIDLSRNQ 722

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG IPS++G L  L  L L  N  EG I      +K+LE + L  N L
Sbjct: 723  LSGEIPSNIGGLQDLTSLSLAHNRFEGPILHSFSNLKSLEFMDLSDNAL 771

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 55/167 (32%), Positives = 90/167 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ S L  L+L++N+ +G +P  ++ +++ L+ L L  N+  G +P  +  L  +
Sbjct: 583  IPTEIGNLSNLYLLSLNNNDLTGTIP-PSIGQLQKLQGLYLPSNKLQGSIPNDICQLR-N 640

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L L++N  SG I    C      L+ LYL +N     IP TL +   ++SL +S N+
Sbjct: 641  LGELFLTNNQLSGSI--PACLGELTFLRHLYLGSNKLNSTIPSTLWSLIHILSLDMSSNF 698

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L G +PS +G+L  L  + L  N L GEIP  +  ++ L +L L  N
Sbjct: 699  LVGYLPSDMGNLKVLVKIDLSRNQLSGEIPSNIGGLQDLTSLSLAHN 745

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 64/176 (36%), Positives = 82/176 (46%), Gaps = 7/176 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE-------LPES 187
           +P   G+ S L SL    N  +G +P   L  +R L+ L+L  N   GE          S
Sbjct: 479 IPSSIGNASKLRSLDFGYNMLTGSIP-HALGSLRFLERLNLGVNNLKGESYIQELSFLTS 537

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           LTN    L  L LS N   G ILP    N   +LQ          G IP  + N S L  
Sbjct: 538 LTNCKR-LRILYLSFNPLIG-ILPISIGNLSTSLQRFEANTCKLKGNIPTEIGNLSNLYL 595

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L L+ N L+GTIP S+G L KL+ L L  N L+G IP ++  ++ L  L L  N L
Sbjct: 596 LSLNNNDLTGTIPPSIGQLQKLQGLYLPSNKLQGSIPNDICQLRNLGELFLTNNQL 651

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 69/221 (31%), Positives = 95/221 (42%), Gaps = 52/221 (23%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMD------TLLKMRGLKVLDLSFNEFSGELPESL 190
            +P   GS   LE L L  NN  GE  +       +L   + L++L LSFN   G LP S+
Sbjct: 503  IPHALGSLRFLERLNLGVNNLKGESYIQELSFLTSLTNCKRLRILYLSFNPLIGILPISI 562

Query: 191  TNLSASL------------------------LTLDLSSNNFSGPILPNLCQN-------- 274
             NLS SL                          L L++N+ +G I P++ Q         
Sbjct: 563  GNLSTSLQRFEANTCKLKGNIPTEIGNLSNLYLLSLNNNDLTGTIPPSIGQLQKLQGLYL 622

Query: 275  PKNTLQ--------------ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
            P N LQ              EL+L NN  +G IP  L   + L  L+L  N L+ TIPS+
Sbjct: 623  PSNKLQGSIPNDICQLRNLGELFLTNNQLSGSIPACLGELTFLRHLYLGSNKLNSTIPST 682

Query: 413  LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L SL  +  L +  N L G +P ++  +K L  + L  N L
Sbjct: 683  LWSLIHILSLDMSSNFLVGYLPSDMGNLKVLVKIDLSRNQL 723

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 51/133 (38%), Positives = 68/133 (51%), Gaps = 3/133 (2%)
 Frame = +2

Query: 17   LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVL---DLSFNEFSGELPES 187
            L   +P    S   + SL +SSN   G LP D    M  LKVL   DLS N+ SGE+P +
Sbjct: 675  LNSTIPSTLWSLIHILSLDMSSNFLVGYLPSD----MGNLKVLVKIDLSRNQLSGEIPSN 730

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
            +  L   L +L L+ N F GPIL +       +L+ + L +N   G+IP +L     L  
Sbjct: 731  IGGLQ-DLTSLSLAHNRFEGPILHSFSN--LKSLEFMDLSDNALFGEIPKSLEGLVYLKY 787

Query: 368  LHLSFNYLSGTIP 406
            L +SFN L G IP
Sbjct: 788  LDVSFNGLYGEIP 800

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 34/88 (38%), Positives = 45/88 (51%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
           C   +  +  L L N G  G IPP L N S LVSL LS N   G +P  +G L+ L  + 
Sbjct: 69  CNAQQQRVIALDLSNLGLRGTIPPDLGNLSFLVSLDLSSNNFHGPVPVEVGQLTSLLSMN 128

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFN 529
           L  N+L G+IP     +  L++L L  N
Sbjct: 129 LQYNLLSGQIPPSFGNLNRLQSLFLGNN 156

[31][TOP]
>UniRef100_A2YU68 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2YU68_ORYSI
          Length = 1215

 Score =  122 bits (306), Expect = 2e-26
 Identities = 71/169 (42%), Positives = 96/169 (56%), Gaps = 2/169 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP-ESLTNLSA 205
           LP  FG C  L+ L L +N  SG+     +  +  L+VL L FN  +G  P  +L +   
Sbjct: 369 LPASFGQCRFLQVLDLGNNQLSGDFVETVITNISSLRVLRLPFNNITGANPLPALASRCP 428

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  +DL SN F G I+P+LC +  + L++L L NN   G +P +LSNC  L S+ LSFN
Sbjct: 429 LLEVIDLGSNEFDGEIMPDLCSSLPS-LRKLLLPNNYINGTVPSSLSNCVNLESIDLSFN 487

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT-LETLILDFN 529
            L G IP  +  L KL DL LW N L GEIP +  +  T LETL++ +N
Sbjct: 488 LLVGQIPPEILFLPKLVDLVLWANNLSGEIPDKFCFNSTALETLVISYN 536

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 70/193 (36%), Positives = 94/193 (48%), Gaps = 23/193 (11%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN--- 196
           PLP     C LLE + L SN F GE+  D    +  L+ L L  N  +G +P SL+N   
Sbjct: 419 PLPALASRCPLLEVIDLGSNEFDGEIMPDLCSSLPSLRKLLLPNNYINGTVPSSLSNCVN 478

Query: 197 -----LSASLLT---------------LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNG 316
                LS +LL                L L +NN SG I    C N    L+ L +  N 
Sbjct: 479 LESIDLSFNLLVGQIPPEILFLPKLVDLVLWANNLSGEIPDKFCFN-STALETLVISYNS 537

Query: 317 FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
           FTG IP +++ C  L+ L L+ N L+G+IPS  G+L  L  L+L  N L G++P EL   
Sbjct: 538 FTGNIPESITRCVNLIWLSLAGNNLTGSIPSGFGNLQNLAILQLNKNSLSGKVPAELGSC 597

Query: 497 KTLETLILDFNDL 535
             L  L L+ N+L
Sbjct: 598 SNLIWLDLNSNEL 610

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 60/155 (38%), Positives = 79/155 (50%), Gaps = 2/155 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    +C  LES+ LS N   G++P + L   + L  L L  N  SGE+P+     S +
Sbjct: 469 VPSSLSNCVNLESIDLSFNLLVGQIPPEILFLPK-LVDLVLWANNLSGEIPDKFCFNSTA 527

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           L TL +S N+F+G I  ++  C N    L  L L  N  TG IP    N   L  L L+ 
Sbjct: 528 LETLVISYNSFTGNIPESITRCVN----LIWLSLAGNNLTGSIPSGFGNLQNLAILQLNK 583

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N LSG +P+ LGS S L  L L  N L G IP +L
Sbjct: 584 NSLSGKVPAELGSCSNLIWLDLNSNELTGTIPPQL 618

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 68/222 (30%), Positives = 102/222 (45%), Gaps = 53/222 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNF-SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           LP     C  LE+L +S N   SG +P   L++++ L+ L L+ N F+GE+ + L+ L  
Sbjct: 295 LPWSLVDCRRLEALDMSGNKLLSGPIPT-FLVELQALRRLSLAGNRFTGEISDKLSILCK 353

Query: 206 SLLTLDLSS------------------------NNFSGPILPNLCQN---------PKNT 286
           +L+ LDLSS                        N  SG  +  +  N         P N 
Sbjct: 354 TLVELDLSSNKLIGSLPASFGQCRFLQVLDLGNNQLSGDFVETVITNISSLRVLRLPFNN 413

Query: 287 ----------------LQELYLQNNGFTGKIPPTLSNCSELVSLH---LSFNYLSGTIPS 409
                           L+ + L +N F G+I P L  CS L SL    L  NY++GT+PS
Sbjct: 414 ITGANPLPALASRCPLLEVIDLGSNEFDGEIMPDL--CSSLPSLRKLLLPNNYINGTVPS 471

Query: 410 SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           SL +   L  + L  N+L G+IP E++++  L  L+L  N+L
Sbjct: 472 SLSNCVNLESIDLSFNLLVGQIPPEILFLPKLVDLVLWANNL 513

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 59/211 (27%), Positives = 89/211 (42%), Gaps = 42/211 (19%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P     C  L  L+L+ NN +G +P      ++ L +L L+ N  SG++P  L + S +
Sbjct: 542  IPESITRCVNLIWLSLAGNNLTGSIPSG-FGNLQNLAILQLNKNSLSGKVPAELGSCS-N 599

Query: 209  LLTLDLSSNNFSGPILPNLCQNPK-------NTLQELYLQNNG----------------- 316
            L+ LDL+SN  +G I P L            +  Q  +L+N                   
Sbjct: 600  LIWLDLNSNELTGTIPPQLAAQAGLITGAIVSGKQFAFLRNEAGNICPGAGVLFEFLDIR 659

Query: 317  ------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 442
                              +TG    T  N   ++ L LS+N L+GTIP+S G+++ L  L
Sbjct: 660  PDRLANFPAVHLCSSTRIYTGTTVYTFRNNGSMIFLDLSYNSLTGTIPASFGNMTYLEVL 719

Query: 443  KLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  N L G IP     +K +  L L  N L
Sbjct: 720  NLGHNELTGAIPDAFTGLKGIGALDLSHNHL 750

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 57/152 (37%), Positives = 77/152 (50%), Gaps = 6/152 (3%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNF-SGELPMDTLLKMRGLKVLDLSFNE-FSGELPESLTNLSASLL 214
           FG C+ L  L  S N   S  LP  +L+  R L+ LD+S N+  SG +P  L  L A L 
Sbjct: 274 FGGCANLTLLDWSYNRLRSTGLPW-SLVDCRRLEALDMSGNKLLSGPIPTFLVELQA-LR 331

Query: 215 TLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L L+ N F+G I   L  LC+    TL EL L +N   G +P +   C  L  L L  N
Sbjct: 332 RLSLAGNRFTGEISDKLSILCK----TLVELDLSSNKLIGSLPASFGQCRFLQVLDLGNN 387

Query: 386 YLSGT-IPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LSG  + + + ++S LR L+L  N + G  P
Sbjct: 388 QLSGDFVETVITNISSLRVLRLPFNNITGANP 419

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 45/119 (37%), Positives = 63/119 (52%)
 Frame = +2

Query: 50  CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
           C+L+E + +SSN F+G LP   L    GL+ L+LS N  +G           SL  LD+S
Sbjct: 132 CALVE-VDISSNTFNGTLPRAFLASCGGLQTLNLSRNSLTG----GGYPFPPSLRRLDMS 186

Query: 230 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            N  S   L N      + +Q L L  N FTG +P  L+ C+E+  L LS+N +SG +P
Sbjct: 187 WNQLSDAGLLNYSLTGCHGIQYLNLSANQFTGSLPG-LAPCTEVSVLDLSWNLMSGVLP 244

 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 50/148 (33%), Positives = 70/148 (47%), Gaps = 8/148 (5%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA---SLLTLDLS 229
           + +L LS  + SG L +D LL +  L+ LDL  N F G+L    +   A   +L+ +D+S
Sbjct: 81  VRALDLSGMSLSGRLRLDALLALSALRRLDLRGNAFHGDLSRHGSPRRAAPCALVEVDIS 140

Query: 230 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTG---KIPPTLSNCSELVSLHLSFNYLS-- 394
           SN F+G  LP         LQ L L  N  TG     PP+L        L +S+N LS  
Sbjct: 141 SNTFNG-TLPRAFLASCGGLQTLNLSRNSLTGGGYPFPPSLRR------LDMSWNQLSDA 193

Query: 395 GTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           G +  SL     ++ L L  N   G +P
Sbjct: 194 GLLNYSLTGCHGIQYLNLSANQFTGSLP 221

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 65/216 (30%), Positives = 86/216 (39%), Gaps = 50/216 (23%)
 Frame = +2

Query: 38  FFGSCSLLESLALSSNNFSG----------ELPMD------------TLLKMRGLKVLDL 151
           F  SC  L++L LS N+ +G           L M             +L    G++ L+L
Sbjct: 152 FLASCGGLQTLNLSRNSLTGGGYPFPPSLRRLDMSWNQLSDAGLLNYSLTGCHGIQYLNL 211

Query: 152 SFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI 331
           S N+F+G LP        S+L  DLS N  SG + P         L  L +  N F+  I
Sbjct: 212 SANQFTGSLPGLAPCTEVSVL--DLSWNLMSGVLPPRFVAMAPANLTYLSIAGNNFSMDI 269

Query: 332 --------------------------PPTLSNCSELVSLHLSFN-YLSGTIPSSLGSLSK 430
                                     P +L +C  L +L +S N  LSG IP+ L  L  
Sbjct: 270 SDYEFGGCANLTLLDWSYNRLRSTGLPWSLVDCRRLEALDMSGNKLLSGPIPTFLVELQA 329

Query: 431 LRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFNDL 535
           LR L L  N   GEI  +L +  KTL  L L  N L
Sbjct: 330 LRRLSLAGNRFTGEISDKLSILCKTLVELDLSSNKL 365

[32][TOP]
>UniRef100_Q6ZCZ2 Os08g0342300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6ZCZ2_ORYSJ
          Length = 1214

 Score =  122 bits (305), Expect = 2e-26
 Identities = 71/169 (42%), Positives = 96/169 (56%), Gaps = 2/169 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP-ESLTNLSA 205
           LP  FG C  L+ L L +N  SG+     +  +  L+VL L FN  +G  P  +L +   
Sbjct: 369 LPASFGQCRFLQVLDLGNNQLSGDFVETVITNISSLRVLRLPFNNITGANPLPALASRCP 428

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  +DL SN F G I+P+LC +  + L++L L NN   G +P +LSNC  L S+ LSFN
Sbjct: 429 LLEVIDLGSNEFDGEIMPDLCSSLPS-LRKLLLPNNYINGTVPSSLSNCVNLESIDLSFN 487

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT-LETLILDFN 529
            L G IP  +  L KL DL LW N L GEIP +  +  T LETL++ +N
Sbjct: 488 LLVGQIPPEILFLLKLVDLVLWANNLSGEIPDKFCFNSTALETLVISYN 536

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 70/193 (36%), Positives = 94/193 (48%), Gaps = 23/193 (11%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN--- 196
           PLP     C LLE + L SN F GE+  D    +  L+ L L  N  +G +P SL+N   
Sbjct: 419 PLPALASRCPLLEVIDLGSNEFDGEIMPDLCSSLPSLRKLLLPNNYINGTVPSSLSNCVN 478

Query: 197 -----LSASLLT---------------LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNG 316
                LS +LL                L L +NN SG I    C N    L+ L +  N 
Sbjct: 479 LESIDLSFNLLVGQIPPEILFLLKLVDLVLWANNLSGEIPDKFCFN-STALETLVISYNS 537

Query: 317 FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
           FTG IP +++ C  L+ L L+ N L+G+IPS  G+L  L  L+L  N L G++P EL   
Sbjct: 538 FTGNIPESITRCVNLIWLSLAGNNLTGSIPSGFGNLQNLAILQLNKNSLSGKVPAELGSC 597

Query: 497 KTLETLILDFNDL 535
             L  L L+ N+L
Sbjct: 598 SNLIWLDLNSNEL 610

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 61/157 (38%), Positives = 81/157 (51%), Gaps = 4/157 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF--NEFSGELPESLTNLS 202
           +P    +C  LES+ LS N   G++P + L     LK++DL    N  SGE+P+     S
Sbjct: 469 VPSSLSNCVNLESIDLSFNLLVGQIPPEILFL---LKLVDLVLWANNLSGEIPDKFCFNS 525

Query: 203 ASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            +L TL +S N+F+G I  ++  C N    L  L L  N  TG IP    N   L  L L
Sbjct: 526 TALETLVISYNSFTGNIPESITRCVN----LIWLSLAGNNLTGSIPSGFGNLQNLAILQL 581

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           + N LSG +P+ LGS S L  L L  N L G IP +L
Sbjct: 582 NKNSLSGKVPAELGSCSNLIWLDLNSNELTGTIPPQL 618

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 68/222 (30%), Positives = 102/222 (45%), Gaps = 53/222 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNF-SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           LP     C  LE+L +S N   SG +P   L++++ L+ L L+ N F+GE+ + L+ L  
Sbjct: 295 LPRSLVDCRRLEALDMSGNKLLSGPIPT-FLVELQALRRLSLAGNRFTGEISDKLSILCK 353

Query: 206 SLLTLDLSS------------------------NNFSGPILPNLCQN---------PKNT 286
           +L+ LDLSS                        N  SG  +  +  N         P N 
Sbjct: 354 TLVELDLSSNQLIGSLPASFGQCRFLQVLDLGNNQLSGDFVETVITNISSLRVLRLPFNN 413

Query: 287 ----------------LQELYLQNNGFTGKIPPTLSNCSELVSLH---LSFNYLSGTIPS 409
                           L+ + L +N F G+I P L  CS L SL    L  NY++GT+PS
Sbjct: 414 ITGANPLPALASRCPLLEVIDLGSNEFDGEIMPDL--CSSLPSLRKLLLPNNYINGTVPS 471

Query: 410 SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           SL +   L  + L  N+L G+IP E++++  L  L+L  N+L
Sbjct: 472 SLSNCVNLESIDLSFNLLVGQIPPEILFLLKLVDLVLWANNL 513

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 59/211 (27%), Positives = 89/211 (42%), Gaps = 42/211 (19%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P     C  L  L+L+ NN +G +P      ++ L +L L+ N  SG++P  L + S +
Sbjct: 542  IPESITRCVNLIWLSLAGNNLTGSIPSG-FGNLQNLAILQLNKNSLSGKVPAELGSCS-N 599

Query: 209  LLTLDLSSNNFSGPILPNLCQNPK-------NTLQELYLQNNG----------------- 316
            L+ LDL+SN  +G I P L            +  Q  +L+N                   
Sbjct: 600  LIWLDLNSNELTGTIPPQLAAQAGLITGAIVSGKQFAFLRNEAGNICPGAGVLFEFLDIR 659

Query: 317  ------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 442
                              +TG    T  N   ++ L LS+N L+GTIP+S G+++ L  L
Sbjct: 660  PDRLANFPAVHLCSSTRIYTGTTVYTFRNNGSMIFLDLSYNSLTGTIPASFGNMTYLEVL 719

Query: 443  KLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  N L G IP     +K +  L L  N L
Sbjct: 720  NLGHNELTGAIPDAFTGLKGIGALDLSHNHL 750

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 54/151 (35%), Positives = 74/151 (49%), Gaps = 5/151 (3%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE-FSGELPESLTNLSASLLT 217
           FG C+ L  L  S N         +L+  R L+ LD+S N+  SG +P  L  L A L  
Sbjct: 274 FGGCANLTLLDWSYNRLRSTGLPRSLVDCRRLEALDMSGNKLLSGPIPTFLVELQA-LRR 332

Query: 218 LDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L L+ N F+G I   L  LC+    TL EL L +N   G +P +   C  L  L L  N 
Sbjct: 333 LSLAGNRFTGEISDKLSILCK----TLVELDLSSNQLIGSLPASFGQCRFLQVLDLGNNQ 388

Query: 389 LSGT-IPSSLGSLSKLRDLKLWLNMLEGEIP 478
           LSG  + + + ++S LR L+L  N + G  P
Sbjct: 389 LSGDFVETVITNISSLRVLRLPFNNITGANP 419

 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 50/166 (30%), Positives = 76/166 (45%), Gaps = 26/166 (15%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA---SLLTLDLS 229
           + +L LS  + SG L +D LL +  L+ LDL  N F G+L    +   A   +L+ +D+S
Sbjct: 81  VRALDLSGMSLSGRLRLDALLALSALRRLDLRGNAFHGDLSRHGSPRRAAPCALVEVDIS 140

Query: 230 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTG---KIPP--------------------T 340
           SN F+G  LP         LQ L L  N  TG     PP                    +
Sbjct: 141 SNTFNG-TLPRAFLASCGGLQTLNLSRNSLTGGGYPFPPSLRRLDMSRNQLSDAGLLNYS 199

Query: 341 LSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           L+ C  +  L+LS N  +G++P  L   +++  L L  N++ G +P
Sbjct: 200 LTGCHGIQYLNLSANQFTGSLP-GLAPCTEVSVLDLSWNLMSGVLP 244

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 65/216 (30%), Positives = 86/216 (39%), Gaps = 50/216 (23%)
 Frame = +2

Query: 38  FFGSCSLLESLALSSNNFSG----------ELPMD------------TLLKMRGLKVLDL 151
           F  SC  L++L LS N+ +G           L M             +L    G++ L+L
Sbjct: 152 FLASCGGLQTLNLSRNSLTGGGYPFPPSLRRLDMSRNQLSDAGLLNYSLTGCHGIQYLNL 211

Query: 152 SFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI 331
           S N+F+G LP        S+L  DLS N  SG + P         L  L +  N F+  I
Sbjct: 212 SANQFTGSLPGLAPCTEVSVL--DLSWNLMSGVLPPRFVAMAPANLTYLSIAGNNFSMDI 269

Query: 332 --------------------------PPTLSNCSELVSLHLSFN-YLSGTIPSSLGSLSK 430
                                     P +L +C  L +L +S N  LSG IP+ L  L  
Sbjct: 270 SDYEFGGCANLTLLDWSYNRLRSTGLPRSLVDCRRLEALDMSGNKLLSGPIPTFLVELQA 329

Query: 431 LRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFNDL 535
           LR L L  N   GEI  +L +  KTL  L L  N L
Sbjct: 330 LRRLSLAGNRFTGEISDKLSILCKTLVELDLSSNQL 365

[33][TOP]
>UniRef100_A3BS52 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3BS52_ORYSJ
          Length = 1214

 Score =  122 bits (305), Expect = 2e-26
 Identities = 71/169 (42%), Positives = 96/169 (56%), Gaps = 2/169 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP-ESLTNLSA 205
           LP  FG C  L+ L L +N  SG+     +  +  L+VL L FN  +G  P  +L +   
Sbjct: 369 LPASFGQCRFLQVLDLGNNQLSGDFVETVITNISSLRVLRLPFNNITGANPLPALASRCP 428

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  +DL SN F G I+P+LC +  + L++L L NN   G +P +LSNC  L S+ LSFN
Sbjct: 429 LLEVIDLGSNEFDGEIMPDLCSSLPS-LRKLLLPNNYINGTVPSSLSNCVNLESIDLSFN 487

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT-LETLILDFN 529
            L G IP  +  L KL DL LW N L GEIP +  +  T LETL++ +N
Sbjct: 488 LLVGQIPPEILFLLKLVDLVLWANNLSGEIPDKFCFNSTALETLVISYN 536

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 70/193 (36%), Positives = 94/193 (48%), Gaps = 23/193 (11%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN--- 196
           PLP     C LLE + L SN F GE+  D    +  L+ L L  N  +G +P SL+N   
Sbjct: 419 PLPALASRCPLLEVIDLGSNEFDGEIMPDLCSSLPSLRKLLLPNNYINGTVPSSLSNCVN 478

Query: 197 -----LSASLLT---------------LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNG 316
                LS +LL                L L +NN SG I    C N    L+ L +  N 
Sbjct: 479 LESIDLSFNLLVGQIPPEILFLLKLVDLVLWANNLSGEIPDKFCFN-STALETLVISYNS 537

Query: 317 FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
           FTG IP +++ C  L+ L L+ N L+G+IPS  G+L  L  L+L  N L G++P EL   
Sbjct: 538 FTGNIPESITRCVNLIWLSLAGNNLTGSIPSGFGNLQNLAILQLNKNSLSGKVPAELGSC 597

Query: 497 KTLETLILDFNDL 535
             L  L L+ N+L
Sbjct: 598 SNLIWLDLNSNEL 610

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 61/157 (38%), Positives = 81/157 (51%), Gaps = 4/157 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF--NEFSGELPESLTNLS 202
           +P    +C  LES+ LS N   G++P + L     LK++DL    N  SGE+P+     S
Sbjct: 469 VPSSLSNCVNLESIDLSFNLLVGQIPPEILFL---LKLVDLVLWANNLSGEIPDKFCFNS 525

Query: 203 ASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            +L TL +S N+F+G I  ++  C N    L  L L  N  TG IP    N   L  L L
Sbjct: 526 TALETLVISYNSFTGNIPESITRCVN----LIWLSLAGNNLTGSIPSGFGNLQNLAILQL 581

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           + N LSG +P+ LGS S L  L L  N L G IP +L
Sbjct: 582 NKNSLSGKVPAELGSCSNLIWLDLNSNELTGTIPPQL 618

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 68/222 (30%), Positives = 102/222 (45%), Gaps = 53/222 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNF-SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           LP     C  LE+L +S N   SG +P   L++++ L+ L L+ N F+GE+ + L+ L  
Sbjct: 295 LPRSLVDCRRLEALDMSGNKLLSGPIPT-FLVELQALRRLSLAGNRFTGEISDKLSILCK 353

Query: 206 SLLTLDLSS------------------------NNFSGPILPNLCQN---------PKNT 286
           +L+ LDLSS                        N  SG  +  +  N         P N 
Sbjct: 354 TLVELDLSSNQLIGSLPASFGQCRFLQVLDLGNNQLSGDFVETVITNISSLRVLRLPFNN 413

Query: 287 ----------------LQELYLQNNGFTGKIPPTLSNCSELVSLH---LSFNYLSGTIPS 409
                           L+ + L +N F G+I P L  CS L SL    L  NY++GT+PS
Sbjct: 414 ITGANPLPALASRCPLLEVIDLGSNEFDGEIMPDL--CSSLPSLRKLLLPNNYINGTVPS 471

Query: 410 SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           SL +   L  + L  N+L G+IP E++++  L  L+L  N+L
Sbjct: 472 SLSNCVNLESIDLSFNLLVGQIPPEILFLLKLVDLVLWANNL 513

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 59/211 (27%), Positives = 89/211 (42%), Gaps = 42/211 (19%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P     C  L  L+L+ NN +G +P      ++ L +L L+ N  SG++P  L + S +
Sbjct: 542  IPESITRCVNLIWLSLAGNNLTGSIPSG-FGNLQNLAILQLNKNSLSGKVPAELGSCS-N 599

Query: 209  LLTLDLSSNNFSGPILPNLCQNPK-------NTLQELYLQNNG----------------- 316
            L+ LDL+SN  +G I P L            +  Q  +L+N                   
Sbjct: 600  LIWLDLNSNELTGTIPPQLAAQAGLITGAIVSGKQFAFLRNEAGNICPGAGVLFEFLDIR 659

Query: 317  ------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 442
                              +TG    T  N   ++ L LS+N L+GTIP+S G+++ L  L
Sbjct: 660  PDRLANFPAVHLCSSTRIYTGTTVYTFRNNGSMIFLDLSYNSLTGTIPASFGNMTYLEVL 719

Query: 443  KLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  N L G IP     +K +  L L  N L
Sbjct: 720  NLGHNELTGAIPDAFTGLKGIGALDLSHNHL 750

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 54/151 (35%), Positives = 74/151 (49%), Gaps = 5/151 (3%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE-FSGELPESLTNLSASLLT 217
           FG C+ L  L  S N         +L+  R L+ LD+S N+  SG +P  L  L A L  
Sbjct: 274 FGGCANLTLLDWSYNRLRSTGLPRSLVDCRRLEALDMSGNKLLSGPIPTFLVELQA-LRR 332

Query: 218 LDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L L+ N F+G I   L  LC+    TL EL L +N   G +P +   C  L  L L  N 
Sbjct: 333 LSLAGNRFTGEISDKLSILCK----TLVELDLSSNQLIGSLPASFGQCRFLQVLDLGNNQ 388

Query: 389 LSGT-IPSSLGSLSKLRDLKLWLNMLEGEIP 478
           LSG  + + + ++S LR L+L  N + G  P
Sbjct: 389 LSGDFVETVITNISSLRVLRLPFNNITGANP 419

 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 50/166 (30%), Positives = 76/166 (45%), Gaps = 26/166 (15%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA---SLLTLDLS 229
           + +L LS  + SG L +D LL +  L+ LDL  N F G+L    +   A   +L+ +D+S
Sbjct: 81  VRALDLSGMSLSGRLRLDALLALSALRGLDLRGNAFHGDLSRHGSPRRAAPCALVEVDIS 140

Query: 230 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTG---KIPP--------------------T 340
           SN F+G  LP         LQ L L  N  TG     PP                    +
Sbjct: 141 SNTFNG-TLPRAFLASCGGLQTLNLSRNSLTGGGYPFPPSLRRLDMSRNQLSDAGLLNYS 199

Query: 341 LSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           L+ C  +  L+LS N  +G++P  L   +++  L L  N++ G +P
Sbjct: 200 LTGCHGIQYLNLSANQFTGSLP-GLAPCTEVSVLDLSWNLMSGVLP 244

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 65/216 (30%), Positives = 86/216 (39%), Gaps = 50/216 (23%)
 Frame = +2

Query: 38  FFGSCSLLESLALSSNNFSG----------ELPMD------------TLLKMRGLKVLDL 151
           F  SC  L++L LS N+ +G           L M             +L    G++ L+L
Sbjct: 152 FLASCGGLQTLNLSRNSLTGGGYPFPPSLRRLDMSRNQLSDAGLLNYSLTGCHGIQYLNL 211

Query: 152 SFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI 331
           S N+F+G LP        S+L  DLS N  SG + P         L  L +  N F+  I
Sbjct: 212 SANQFTGSLPGLAPCTEVSVL--DLSWNLMSGVLPPRFVAMAPANLTYLSIAGNNFSMDI 269

Query: 332 --------------------------PPTLSNCSELVSLHLSFN-YLSGTIPSSLGSLSK 430
                                     P +L +C  L +L +S N  LSG IP+ L  L  
Sbjct: 270 SDYEFGGCANLTLLDWSYNRLRSTGLPRSLVDCRRLEALDMSGNKLLSGPIPTFLVELQA 329

Query: 431 LRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFNDL 535
           LR L L  N   GEI  +L +  KTL  L L  N L
Sbjct: 330 LRRLSLAGNRFTGEISDKLSILCKTLVELDLSSNQL 365

[34][TOP]
>UniRef100_B9SG85 Receptor protein kinase CLAVATA1, putative n=1 Tax=Ricinus communis
           RepID=B9SG85_RICCO
          Length = 1054

 Score =  120 bits (302), Expect = 5e-26
 Identities = 76/168 (45%), Positives = 101/168 (60%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GSC LLE L LS NNFSGE+P D+   ++GL  L+L  N  SGE+PESL  +  S
Sbjct: 110 IPSQLGSCRLLEYLDLSLNNFSGEIP-DSFKYLQGLSFLNLYSNSLSGEIPESLFRV-LS 167

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + L++NNFSG I PN   N    L EL+L  N  +G IP ++ NCS L  L+L+ N+
Sbjct: 168 LEYVYLNTNNFSGSI-PNTVGNLSQVL-ELWLYGNQLSGAIPESIGNCSRLQMLYLNENH 225

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L G++P +L +L  L +L L+ N  +G IP      K L  L L FND
Sbjct: 226 LVGSLPETLTNLESLVNLFLYRNSFKGNIPLGFGNCKNLSVLDLSFND 273

 Score =  111 bits (278), Expect = 3e-23
 Identities = 75/192 (39%), Positives = 104/192 (54%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELP-----MDTLLKM------------------RGLK 139
           +P   G+CS L+ L L+ N+  G LP     +++L+ +                  + L 
Sbjct: 206 IPESIGNCSRLQMLYLNENHLVGSLPETLTNLESLVNLFLYRNSFKGNIPLGFGNCKNLS 265

Query: 140 VLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
           VLDLSFN+FSG LP  L N S+SL TL +  +N  G I  +  Q  K  L  L L  N  
Sbjct: 266 VLDLSFNDFSGGLPPDLGN-SSSLTTLVIVHSNLVGSIPSSFGQLDK--LSHLDLSENRL 322

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           +G+IPP LSNC  L SL L  N L G IP  LG L++L+DL+L+ N L GEIP  +  + 
Sbjct: 323 SGRIPPELSNCKSLKSLKLYKNQLEGEIPGELGMLTELQDLELFSNHLSGEIPINIWRIP 382

Query: 500 TLETLILDFNDL 535
           +LE +++  N L
Sbjct: 383 SLEYVLVYNNSL 394

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 60/169 (35%), Positives = 84/169 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G  S L  L  ++N F GE+P +  L  + L+VL++  N   G +P  +   S +
Sbjct: 422 IPENLGVNSSLLQLDFTNNKFKGEIPPNLCLGKQ-LRVLNMGRNHLQGSIPSDVGRCS-T 479

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS NN SG  LP    NP  +L  + +  N   G IPP+L NC  L  +  S N 
Sbjct: 480 LWRLILSQNNLSGA-LPKFAVNP--SLSHIDISKNNIAGPIPPSLGNCPGLSYIDFSMNK 536

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +G I   LG+L +L  + L  N LEG +P +L Y   L    + FN L
Sbjct: 537 FTGLISPDLGNLVQLELVDLSYNQLEGSLPSQLSYWSRLYKFDVGFNSL 585

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 61/163 (37%), Positives = 92/163 (56%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           S S++ +L LS N  SG+L  + +  +  L+ LDLS N FSG +P  L +    L  LDL
Sbjct: 68  SRSVVVTLELSGNAISGQLGPE-IAHLSHLQTLDLSNNSFSGHIPSQLGSCRL-LEYLDL 125

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
           S NNFSG I  +        L  L L +N  +G+IP +L     L  ++L+ N  SG+IP
Sbjct: 126 SLNNFSGEIPDSF--KYLQGLSFLNLYSNSLSGEIPESLFRVLSLEYVYLNTNNFSGSIP 183

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +++G+LS++ +L L+ N L G IP+ +     L+ L L+ N L
Sbjct: 184 NTVGNLSQVLELWLYGNQLSGAIPESIGNCSRLQMLYLNENHL 226

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 62/171 (36%), Positives = 82/171 (47%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L+  +P   G CS L  L LS NN SG LP   +     L  +D+S N  +G +P SL N
Sbjct: 466 LQGSIPSDVGRCSTLWRLILSQNNLSGALPKFAVNP--SLSHIDISKNNIAGPIPPSLGN 523

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
               L  +D S N F+G I P+L    +  L+ + L  N   G +P  LS  S L    +
Sbjct: 524 CPG-LSYIDFSMNKFTGLISPDLGNLVQ--LELVDLSYNQLEGSLPSQLSYWSRLYKFDV 580

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            FN L+G+IP SL + + L  L L  N   G IP  L   K L  L +  N
Sbjct: 581 GFNSLNGSIPLSLRNWTNLSTLILRQNQFIGGIPLFLPEFKELTDLQIGGN 631

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 61/193 (31%), Positives = 91/193 (47%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG    L  L LS N  SG +P + L   + LK L L  N+  GE+P  L  L+  
Sbjct: 302 IPSSFGQLDKLSHLDLSENRLSGRIPPE-LSNCKSLKSLKLYKNQLEGEIPGELGMLT-E 359

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+L SN+ SG I  N+ + P  +L+ + + NN  +G++P  ++   +L ++ L  N 
Sbjct: 360 LQDLELFSNHLSGEIPINIWRIP--SLEYVLVYNNSLSGELPCDMTELKQLKNISLFDNQ 417

Query: 389 LSGTIPSSLGSLS------------------------KLRDLKLWLNMLEGEIPQELMYV 496
             G IP +LG  S                        +LR L +  N L+G IP ++   
Sbjct: 418 FFGVIPENLGVNSSLLQLDFTNNKFKGEIPPNLCLGKQLRVLNMGRNHLQGSIPSDVGRC 477

Query: 497 KTLETLILDFNDL 535
            TL  LIL  N+L
Sbjct: 478 STLWRLILSQNNL 490

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/114 (43%), Positives = 64/114 (56%), Gaps = 1/114 (0%)
 Frame = +2

Query: 194 NLSASLL-TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           NLS S++ TL+LS N  SG + P +     + LQ L L NN F+G IP  L +C  L  L
Sbjct: 66  NLSRSVVVTLELSGNAISGQLGPEIAH--LSHLQTLDLSNNSFSGHIPSQLGSCRLLEYL 123

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            LS N  SG IP S   L  L  L L+ N L GEIP+ L  V +LE + L+ N+
Sbjct: 124 DLSLNNFSGEIPDSFKYLQGLSFLNLYSNSLSGEIPESLFRVLSLEYVYLNTNN 177

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 36/91 (39%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query: 266 CQN-PKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 442
           C N  ++ +  L L  N  +G++ P +++ S L +L LS N  SG IPS LGS   L  L
Sbjct: 64  CDNLSRSVVVTLELSGNAISGQLGPEIAHLSHLQTLDLSNNSFSGHIPSQLGSCRLLEYL 123

Query: 443 KLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L LN   GEIP    Y++ L  L L  N L
Sbjct: 124 DLSLNNFSGEIPDSFKYLQGLSFLNLYSNSL 154

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 54/201 (26%), Positives = 82/201 (40%), Gaps = 46/201 (22%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS- 202
            P+PP  G+C  L  +  S N F+G +  D L  +  L+++DLS+N+  G LP  L+  S 
Sbjct: 516  PIPPSLGNCPGLSYIDFSMNKFTGLISPD-LGNLVQLELVDLSYNQLEGSLPSQLSYWSR 574

Query: 203  ----------------------ASLLTLDLSSNNFSGPI--------------------- 253
                                   +L TL L  N F G I                     
Sbjct: 575  LYKFDVGFNSLNGSIPLSLRNWTNLSTLILRQNQFIGGIPLFLPEFKELTDLQIGGNLLG 634

Query: 254  --LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS 427
              +P+   + +     L L +NG TG IP  L N  +L  L +S N L+GT+ ++L  + 
Sbjct: 635  GEIPSSIGSLRALQYALNLSSNGLTGVIPSGLGNLIKLERLDISNNNLTGTL-AALDRIH 693

Query: 428  KLRDLKLWLNMLEGEIPQELM 490
             +  +    N   G IP  +M
Sbjct: 694  TMVLVNTSYNHFTGPIPYTMM 714

[35][TOP]
>UniRef100_B9S566 Receptor protein kinase CLAVATA1, putative n=1 Tax=Ricinus communis
           RepID=B9S566_RICCO
          Length = 1126

 Score =  120 bits (300), Expect = 8e-26
 Identities = 74/169 (43%), Positives = 99/169 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+CS L  L L  N+ SG LP + L K++ L+ + L  N F G +PE + N   S
Sbjct: 265 IPPQLGNCSELVDLFLYENDLSGSLPPE-LGKLQKLEKMLLWQNNFDGTIPEEIGNCK-S 322

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS N FSG I P+      +TL+EL L NN  +G IPP LSN + L+ L L  N 
Sbjct: 323 LKIIDLSLNLFSGIIPPSF--GNLSTLEELMLSNNNISGSIPPVLSNATNLLQLQLDTNQ 380

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +SG+IP+ LG L++L     W N LEG IP +L   ++LE L L  N L
Sbjct: 381 ISGSIPAELGKLTQLTVFFAWQNKLEGSIPAQLAGCRSLEALDLSHNVL 429

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 69/173 (39%), Positives = 93/173 (53%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P     C  LE+L LS N  +G LP   L +++ L  L L  N+ SG +P  + N
Sbjct: 405 LEGSIPAQLAGCRSLEALDLSHNVLTGSLPPG-LFQLQNLTKLLLISNDISGSIPHEIGN 463

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S SL+ L L +N  SG I   +       L  L L +N  +G +P  + NC+EL  L+L
Sbjct: 464 CS-SLVRLRLINNKISGNIPKEI--GFLKDLSFLDLSDNHLSGMVPAEIGNCNELQMLNL 520

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           S N L GT+PSSL SL++L  L L LN   GEIP +   + +L  LIL  N L
Sbjct: 521 SNNTLQGTLPSSLSSLTRLEVLDLSLNRFVGEIPFDFGKLISLNRLILSKNSL 573

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 62/168 (36%), Positives = 94/168 (55%), Gaps = 1/168 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE-FSGELPESLTNLSA 205
           +P   G+C+ L++L +  N  SG+LP++ L ++  L+V+    N+   G++P+ L +   
Sbjct: 168 IPVEIGNCTNLKNLIIYDNYLSGKLPIE-LGRLSDLEVVRAGGNKNIEGKIPDELGDCK- 225

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L L+    SG I  +L     N LQ L +     +G IPP L NCSELV L L  N
Sbjct: 226 NLQVLGLADTKISGSIPASL--GNLNNLQTLSVYTTMLSGVIPPQLGNCSELVDLFLYEN 283

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            LSG++P  LG L KL  + LW N  +G IP+E+   K+L+ + L  N
Sbjct: 284 DLSGSLPPELGKLQKLEKMLLWQNNFDGTIPEEIGNCKSLKIIDLSLN 331

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 68/198 (34%), Positives = 94/198 (47%), Gaps = 23/198 (11%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           + + LP P    S   LE L LS  N +G +P D +     L +LD+S N   G +P S+
Sbjct: 90  VDIALPFPSNLSSLIYLEKLILSGVNLTGTIPPD-IGDCTKLTLLDVSSNSLVGTIPPSI 148

Query: 191 TNLSASLLTLDLSSNNFSG--PILPNLCQNPKNTL-QELYLQ------------------ 307
            NL  +L  L L+SN  +G  P+    C N KN +  + YL                   
Sbjct: 149 GNLK-NLQDLILNSNQITGEIPVEIGNCTNLKNLIIYDNYLSGKLPIELGRLSDLEVVRA 207

Query: 308 --NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
             N    GKIP  L +C  L  L L+   +SG+IP+SLG+L+ L+ L ++  ML G IP 
Sbjct: 208 GGNKNIEGKIPDELGDCKNLQVLGLADTKISGSIPASLGNLNNLQTLSVYTTMLSGVIPP 267

Query: 482 ELMYVKTLETLILDFNDL 535
           +L     L  L L  NDL
Sbjct: 268 QLGNCSELVDLFLYENDL 285

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 65/170 (38%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+CS L  L L +N  SG +P +    ++ L  LDLS N  SG +P  + N +  
Sbjct: 457 IPHEIGNCSSLVRLRLINNKISGNIPKEIGF-LKDLSFLDLSDNHLSGMVPAEIGNCN-E 514

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+LS+N   G +  +L    +  L+ L L  N F G+IP        L  L LS N 
Sbjct: 515 LQMLNLSNNTLQGTLPSSLSSLTR--LEVLDLSLNRFVGEIPFDFGKLISLNRLILSKNS 572

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE-TLILDFNDL 535
           LSG IPSSLG  S L+ L L  N L G IP E+  ++ L+  L L +N L
Sbjct: 573 LSGAIPSSLGHCSSLQLLDLSSNELSGIIPVEMFDIEGLDIALNLSWNAL 622

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 59/160 (36%), Positives = 80/160 (50%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L+  LP    S + LE L LS N F GE+P D   K+  L  L LS N  SG +P SL 
Sbjct: 524 TLQGTLPSSLSSLTRLEVLDLSLNRFVGEIPFD-FGKLISLNRLILSKNSLSGAIPSSLG 582

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           + S SL  LDLSSN  SG I+P    + +     L L  N  +G IP  +S  ++L  L 
Sbjct: 583 HCS-SLQLLDLSSNELSG-IIPVEMFDIEGLDIALNLSWNALSGMIPLQISALNKLSILD 640

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
           LS N L G +  +L  L  +  L +  N   G +P   ++
Sbjct: 641 LSHNKLGGDL-LALAELENIVSLNISYNNFTGYLPDSKLF 679

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 41/109 (37%), Positives = 61/109 (55%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ +D  S + + P   NL  +    L++L L     TG IPP + +C++L  L +S N 
Sbjct: 82  VIEIDFQSVDIALPFPSNL--SSLIYLEKLILSGVNLTGTIPPDIGDCTKLTLLDVSSNS 139

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L GTIP S+G+L  L+DL L  N + GEIP E+     L+ LI+  N L
Sbjct: 140 LVGTIPPSIGNLKNLQDLILNSNQITGEIPVEIGNCTNLKNLIIYDNYL 188

[36][TOP]
>UniRef100_B9N5J5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N5J5_POPTR
          Length = 1193

 Score =  120 bits (300), Expect = 8e-26
 Identities = 73/169 (43%), Positives = 99/169 (58%), Gaps = 2/169 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP  F SCS + SL L +N  SG+     + K++ LK L + FN  +G +P SLT  +  
Sbjct: 348 LPQTFASCSSMRSLNLGNNLLSGDFLSTVVSKLQSLKYLYVPFNNITGTVPLSLTKCT-Q 406

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNT-LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           L  LDLSSN F+G +   LC +   T LQ+L L +N  +G +PP L +C  L S+ LSFN
Sbjct: 407 LEVLDLSSNAFTGDVPSKLCSSSNPTALQKLLLADNYLSGNVPPELGSCKNLRSIDLSFN 466

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFN 529
            L G IP  + +L  L DL +W N L GEIP+ + +    LETLIL+ N
Sbjct: 467 NLIGPIPMEVWTLPNLLDLVMWANNLTGEIPEGICVNGGNLETLILNNN 515

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 61/159 (38%), Positives = 93/159 (58%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L L+ N  SG +P + L   + L+ +DLSFN   G +P  +  L  +LL L + +NN
Sbjct: 434 LQKLLLADNYLSGNVPPE-LGSCKNLRSIDLSFNNLIGPIPMEVWTLP-NLLDLVMWANN 491

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G I   +C N  N L+ L L NN  TG IP ++ NC+ ++ + LS N L+G IP+ +G
Sbjct: 492 LTGEIPEGICVNGGN-LETLILNNNLITGSIPQSIGNCTNMIWVSLSSNRLTGEIPAGIG 550

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +L  L  L++  N L G+IP EL   ++L  L L+ N+L
Sbjct: 551 NLVDLAVLQMGNNSLTGQIPPELGKCRSLIWLDLNSNNL 589

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 69/167 (41%), Positives = 90/167 (53%), Gaps = 4/167 (2%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES-LTNLSASLLTLD 223
           +C  L  L  S N  +G+L   T    + L +LDLS+N FSGE+P + + +   SL  LD
Sbjct: 180 TCQNLNLLNFSDNKLTGKLGA-TPSSCKSLSILDLSYNPFSGEIPPTFVADSPPSLKYLD 238

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK-IPPTLSNCSELVSLHLSFNYLSGT 400
           LS NNFSG    +L     + L  L L  N  +G   P +L NC  L +L+LS N L   
Sbjct: 239 LSHNNFSGSF-SSLDFGHCSNLTWLSLSQNRLSGNGFPFSLRNCVLLQTLNLSRNELKFK 297

Query: 401 IPSSL-GSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFNDL 535
           IP SL GSL+ LR L L  N+  G+IP EL    +TL+ L L  N L
Sbjct: 298 IPGSLLGSLTNLRQLSLAHNLFYGDIPPELGQACRTLQELDLSANKL 344

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 51/157 (32%), Positives = 74/157 (47%), Gaps = 22/157 (14%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  GSC  L S+ LS NN  G +PM+ +  +  L  L +  N  +GE+PE +     +
Sbjct: 448 VPPELGSCKNLRSIDLSFNNLIGPIPME-VWTLPNLLDLVMWANNLTGEIPEGICVNGGN 506

Query: 209 LLTLDLSSNNFSGPILPNL--CQN---------------PKNT-----LQELYLQNNGFT 322
           L TL L++N  +G I  ++  C N               P        L  L + NN  T
Sbjct: 507 LETLILNNNLITGSIPQSIGNCTNMIWVSLSSNRLTGEIPAGIGNLVDLAVLQMGNNSLT 566

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 433
           G+IPP L  C  L+ L L+ N L+G +P  L   + L
Sbjct: 567 GQIPPELGKCRSLIWLDLNSNNLTGPLPPELADQAGL 603

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 64/198 (32%), Positives = 81/198 (40%), Gaps = 43/198 (21%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDL-------------- 151
            SL   +PP  G C  L  L L+SNN +G LP + L    GL V  +              
Sbjct: 564  SLTGQIPPELGKCRSLIWLDLNSNNLTGPLPPE-LADQAGLVVPGIVSGKQFAFVRNEGG 622

Query: 152  -------SFNEFSGELPESLTNL----------------------SASLLTLDLSSNNFS 244
                      EF G   E L NL                      + S++ LDL+ N+ S
Sbjct: 623  TSCRGAGGLVEFQGIRAERLENLPMAHSCSTTRIYSGMTVYTFTTNGSMIFLDLAYNSLS 682

Query: 245  GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
            G I  N      + LQ L L +N  TG IP +      +  L LS N L G +P SLG+L
Sbjct: 683  GDIPQNF--GSMSYLQVLNLGHNKLTGNIPDSFGGLKAIGVLDLSHNDLQGFLPGSLGTL 740

Query: 425  SKLRDLKLWLNMLEGEIP 478
            S L DL +  N L G IP
Sbjct: 741  SFLSDLDVSNNNLTGPIP 758

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 65/192 (33%), Positives = 80/192 (41%), Gaps = 29/192 (15%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMR-GLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           SC +LE++ LSSNN S  LP ++ L+    L  ++LS N  SG           SLL LD
Sbjct: 108 SC-VLETIDLSSNNLSDPLPRNSFLESCIHLSYVNLSHNSISG----GTLRFGPSLLQLD 162

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           LS N  S         +    L  L   +N  TGK+  T S+C  L  L LS+N  SG I
Sbjct: 163 LSRNTISDSTWLTYSLSTCQNLNLLNFSDNKLTGKLGATPSSCKSLSILDLSYNPFSGEI 222

Query: 404 P-------------------------SSL--GSLSKLRDLKLWLNMLEGE-IPQELMYVK 499
           P                         SSL  G  S L  L L  N L G   P  L    
Sbjct: 223 PPTFVADSPPSLKYLDLSHNNFSGSFSSLDFGHCSNLTWLSLSQNRLSGNGFPFSLRNCV 282

Query: 500 TLETLILDFNDL 535
            L+TL L  N+L
Sbjct: 283 LLQTLNLSRNEL 294

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 46/114 (40%), Positives = 60/114 (52%), Gaps = 3/114 (2%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
            SL   +P  FGS S L+ L L  N  +G +P D+   ++ + VLDLS N+  G LP SL 
Sbjct: 680  SLSGDIPQNFGSMSYLQVLNLGHNKLTGNIP-DSFGGLKAIGVLDLSHNDLQGFLPGSLG 738

Query: 194  NLSASLLTLDLSSNNFSGPILP--NLCQNPKNTLQELYLQNNGFTG-KIPPTLS 346
             LS  L  LD+S+NN +GPI     L   P    Q  Y  N+G  G  +PP  S
Sbjct: 739  TLSF-LSDLDVSNNNLTGPIPSGGQLTTFP----QSRYENNSGLCGVPLPPCSS 787

[37][TOP]
>UniRef100_B8B440 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8B440_ORYSI
          Length = 1004

 Score =  119 bits (298), Expect = 1e-25
 Identities = 72/174 (41%), Positives = 106/174 (60%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SLE  +P  FG+ S L++L L+SN  +G++P  +L     L+ +DL  N+ +G +PESL 
Sbjct: 134 SLEGSIPSAFGNLSKLQTLVLTSNGLTGDIP-PSLGSSFSLRYVDLGNNDITGSIPESLA 192

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N S+SL  L L SNN SG +  +L     ++L  ++LQ N F G IP   +  S +  + 
Sbjct: 193 N-SSSLQVLRLMSNNLSGEVPKSLFNT--SSLTAIFLQQNSFVGSIPAIAAMSSPIKYIS 249

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N +SGTIP SLG+LS L +L+L  N L G IP+ L +++TLE L +  N+L
Sbjct: 250 LRDNCISGTIPPSLGNLSSLLELRLSKNNLVGSIPESLGHIRTLEILTMSVNNL 303

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 67/171 (39%), Positives = 86/171 (50%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFS-GELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           L PFFGS   LE L +S N    G+   M +L     L  L L  N F G LP S+ NLS
Sbjct: 379 LVPFFGSLPNLEELDVSYNMLEPGDWSFMTSLSNCSKLTQLMLDGNSFQGILPSSIGNLS 438

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           ++L  L L +N   GPI P +      +L  L++  N FTG IP T+ N + L  L  + 
Sbjct: 439 SNLEGLWLRNNKIYGPIPPEI--GNLKSLSILFMDYNLFTGTIPQTIGNLNNLTVLSFAQ 496

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N LSG IP   G+L +L D+KL  N   G IP  +     L+ L L  N L
Sbjct: 497 NKLSGHIPDVFGNLVQLTDIKLDGNNFSGRIPSSIGQCTQLQILNLAHNSL 547

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/168 (31%), Positives = 90/168 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG+   L  + L  NNFSG +P  ++ +   L++L+L+ N   G +P  +  +++ 
Sbjct: 503 IPDVFGNLVQLTDIKLDGNNFSGRIP-SSIGQCTQLQILNLAHNSLDGNIPSIIFKITSL 561

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              ++LS N  +G  +P+   N  N L +L + NN  +G+IP +L  C  L  L +  N+
Sbjct: 562 SQEMNLSHNYLTGG-MPDEVGNLIN-LNKLGISNNMLSGEIPSSLGQCVTLEYLEIQSNF 619

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             G IP S   L  ++++ +  N L G+IPQ L  + +L  L L FN+
Sbjct: 620 FVGGIPQSFMKLVSIKEMDISRNNLSGKIPQFLNSLSSLHDLNLSFNN 667

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 60/193 (31%), Positives = 90/193 (46%), Gaps = 23/193 (11%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+PP  G+   L  L +  N F+G +P  T+  +  L VL  + N+ SG +P+   NL  
Sbjct: 454  PIPPEIGNLKSLSILFMDYNLFTGTIPQ-TIGNLNNLTVLSFAQNKLSGHIPDVFGNL-V 511

Query: 206  SLLTLDLSSNNFSGPI-----------------------LPNLCQNPKNTLQELYLQNNG 316
             L  + L  NNFSG I                       +P++     +  QE+ L +N 
Sbjct: 512  QLTDIKLDGNNFSGRIPSSIGQCTQLQILNLAHNSLDGNIPSIIFKITSLSQEMNLSHNY 571

Query: 317  FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
             TG +P  + N   L  L +S N LSG IPSSLG    L  L++  N   G IPQ  M +
Sbjct: 572  LTGGMPDEVGNLINLNKLGISNNMLSGEIPSSLGQCVTLEYLEIQSNFFVGGIPQSFMKL 631

Query: 497  KTLETLILDFNDL 535
             +++ + +  N+L
Sbjct: 632  VSIKEMDISRNNL 644

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 59/171 (34%), Positives = 88/171 (51%), Gaps = 2/171 (1%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS- 202
           P+P    +   LE L L +N+F+G +P    L    L+ LD+S+N         +T+LS 
Sbjct: 355 PIPASLLNAYHLEMLYLGNNSFTGLVPFFGSLP--NLEELDVSYNMLEPGDWSFMTSLSN 412

Query: 203 -ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
            + L  L L  N+F G ILP+   N  + L+ L+L+NN   G IPP + N   L  L + 
Sbjct: 413 CSKLTQLMLDGNSFQG-ILPSSIGNLSSNLEGLWLRNNKIYGPIPPEIGNLKSLSILFMD 471

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           +N  +GTIP ++G+L+ L  L    N L G IP     +  L  + LD N+
Sbjct: 472 YNLFTGTIPQTIGNLNNLTVLSFAQNKLSGHIPDVFGNLVQLTDIKLDGNN 522

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 66/174 (37%), Positives = 90/174 (51%), Gaps = 1/174 (0%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           LS E+P   F  + S L ++ L  N+F G +P    +    +K + L  N  SG +P SL
Sbjct: 207 LSGEVPKSLF--NTSSLTAIFLQQNSFVGSIPAIAAMSSP-IKYISLRDNCISGTIPPSL 263

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            NLS SLL L LS NN  G I  +L      TL+ L +  N  +G +PP+L N S L  L
Sbjct: 264 GNLS-SLLELRLSKNNLVGSIPESL--GHIRTLEILTMSVNNLSGLVPPSLFNISSLTFL 320

Query: 371 HLSFNYLSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            +  N L G +PS +G +L+K++ L L  N   G IP  L+    LE L L  N
Sbjct: 321 AMGNNSLVGRLPSDIGYTLTKIQGLILPANKFVGPIPASLLNAYHLEMLYLGNN 374

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 55/151 (36%), Positives = 82/151 (54%), Gaps = 1/151 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGL-KVLDLSFNEFSGELPESLTNLSA 205
           +P   G C+ L+ L L+ N+  G +P   + K+  L + ++LS N  +G +P+ + NL  
Sbjct: 527 IPSSIGQCTQLQILNLAHNSLDGNIP-SIIFKITSLSQEMNLSHNYLTGGMPDEVGNL-I 584

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L +S+N  SG I  +L Q    TL+ L +Q+N F G IP +      +  + +S N
Sbjct: 585 NLNKLGISNNMLSGEIPSSLGQCV--TLEYLEIQSNFFVGGIPQSFMKLVSIKEMDISRN 642

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LSG IP  L SLS L DL L  N  +G IP
Sbjct: 643 NLSGKIPQFLNSLSSLHDLNLSFNNFDGVIP 673

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 69/218 (31%), Positives = 96/218 (44%), Gaps = 51/218 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ S L  L LS NN  G +P ++L  +R L++L +S N  SG +P SL N+S S
Sbjct: 259 IPPSLGNLSSLLELRLSKNNLVGSIP-ESLGHIRTLEILTMSVNNLSGLVPPSLFNIS-S 316

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP------------------ 334
           L  L + +N+  G  LP+        +Q L L  N F G IP                  
Sbjct: 317 LTFLAMGNNSLVGR-LPSDIGYTLTKIQGLILPANKFVGPIPASLLNAYHLEMLYLGNNS 375

Query: 335 --------------------------------PTLSNCSELVSLHLSFNYLSGTIPSSLG 418
                                            +LSNCS+L  L L  N   G +PSS+G
Sbjct: 376 FTGLVPFFGSLPNLEELDVSYNMLEPGDWSFMTSLSNCSKLTQLMLDGNSFQGILPSSIG 435

Query: 419 SL-SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           +L S L  L L  N + G IP E+  +K+L  L +D+N
Sbjct: 436 NLSSNLEGLWLRNNKIYGPIPPEIGNLKSLSILFMDYN 473

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 52/131 (39%), Positives = 71/131 (54%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           +DLS    +G +   + NL+ SL+TL LS+N+  G I P L    K  L+ L L  N   
Sbjct: 80  IDLSSEGITGTISPCIANLT-SLMTLQLSNNSLHGSIPPKLGLLRK--LRNLNLSMNSLE 136

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G IP    N S+L +L L+ N L+G IP SLGS   LR + L  N + G IP+ L    +
Sbjct: 137 GSIPSAFGNLSKLQTLVLTSNGLTGDIPPSLGSSFSLRYVDLGNNDITGSIPESLANSSS 196

Query: 503 LETLILDFNDL 535
           L+ L L  N+L
Sbjct: 197 LQVLRLMSNNL 207

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 45/109 (41%), Positives = 61/109 (55%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ +DLSS   +G I P  C     +L  L L NN   G IPP L    +L +L+LS N 
Sbjct: 77  VIAIDLSSEGITGTISP--CIANLTSLMTLQLSNNSLHGSIPPKLGLLRKLRNLNLSMNS 134

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G+IPS+ G+LSKL+ L L  N L G+IP  L    +L  + L  ND+
Sbjct: 135 LEGSIPSAFGNLSKLQTLVLTSNGLTGDIPPSLGSSFSLRYVDLGNNDI 183

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 43/123 (34%), Positives = 66/123 (53%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F   SL + + LS N  +G +P D +  +  L  L +S N  SGE+P SL     +L  L
Sbjct: 556 FKITSLSQEMNLSHNYLTGGMP-DEVGNLINLNKLGISNNMLSGEIPSSLGQC-VTLEYL 613

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
           ++ SN F G I  +  +    +++E+ +  N  +GKIP  L++ S L  L+LSFN   G 
Sbjct: 614 EIQSNFFVGGIPQSFMKLV--SIKEMDISRNNLSGKIPQFLNSLSSLHDLNLSFNNFDGV 671

Query: 401 IPS 409
           IP+
Sbjct: 672 IPT 674

[38][TOP]
>UniRef100_A7PVH8 Chromosome chr9 scaffold_33, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7PVH8_VITVI
          Length = 2202

 Score =  119 bits (298), Expect = 1e-25
 Identities = 71/185 (38%), Positives = 110/185 (59%), Gaps = 7/185 (3%)
 Frame = +2

Query: 2    SLFLSLEL-------PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN 160
            S  +SL+L       P+PP FG+ + L+SL L +N+F+G +P  ++  M  L+ LD+  N
Sbjct: 1261 SFLVSLDLSSNNFHGPIPPSFGNLNRLQSLFLGNNSFTGTIP-PSIGNMSMLETLDIQSN 1319

Query: 161  EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPT 340
            +  G +P ++ N+S SL  + L+ N+ SG +  ++C +  + L+ + L  N FTG IP  
Sbjct: 1320 QLVGAIPSAIFNIS-SLQEIALTYNSLSGDLPSSMCNHELSALRGIRLSANRFTGPIPSN 1378

Query: 341  LSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
            LS C EL +L+LSFN  +G IP S+ SL+KL  L L  N L G +P E+  + TL  L +
Sbjct: 1379 LSKCGELQTLYLSFNKFTGGIPRSIDSLTKLTMLSLAANSLSGTVPCEIGSLCTLNVLNI 1438

Query: 521  DFNDL 535
            + N L
Sbjct: 1439 EDNSL 1443

 Score =  106 bits (265), Expect = 9e-22
 Identities = 69/182 (37%), Positives = 104/182 (57%), Gaps = 4/182 (2%)
 Frame = +2

Query: 2    SLFL---SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
            SLFL   S    +PP  G+ S+LE+L + SN   G +P   +  +  L+ + L++N  SG
Sbjct: 1289 SLFLGNNSFTGTIPPSIGNMSMLETLDIQSNQLVGAIP-SAIFNISSLQEIALTYNSLSG 1347

Query: 173  ELPESLTNLSASLLT-LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN 349
            +LP S+ N   S L  + LS+N F+GPI  NL +  +  LQ LYL  N FTG IP ++ +
Sbjct: 1348 DLPSSMCNHELSALRGIRLSANRFTGPIPSNLSKCGE--LQTLYLSFNKFTGGIPRSIDS 1405

Query: 350  CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
             ++L  L L+ N LSGT+P  +GSL  L  L +  N L G IP ++  + ++ +  L  N
Sbjct: 1406 LTKLTMLSLAANSLSGTVPCEIGSLCTLNVLNIEDNSLTGHIPFQIFNISSMVSGSLTRN 1465

Query: 530  DL 535
            +L
Sbjct: 1466 NL 1467

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 69/200 (34%), Positives = 102/200 (51%), Gaps = 30/200 (15%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMR---------------------GL 136
            P+P     C  L++L LS N F+G +P  +D+L K+                       L
Sbjct: 1374 PIPSNLSKCGELQTLYLSFNKFTGGIPRSIDSLTKLTMLSLAANSLSGTVPCEIGSLCTL 1433

Query: 137  KVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNG 316
             VL++  N  +G +P  + N+S S+++  L+ NN SG + PN      N L+ L L+ N 
Sbjct: 1434 NVLNIEDNSLTGHIPFQIFNIS-SMVSGSLTRNNLSGNLPPNFGSYLPN-LENLILEINW 1491

Query: 317  FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE-IPQELMY 493
             +G IP ++ N S+L SL   +N L+G+IP +LGSL  L  L L +N L+GE   QEL +
Sbjct: 1492 LSGIIPSSIGNASKLRSLDFGYNMLTGSIPHALGSLRFLERLNLGVNNLKGESYIQELSF 1551

Query: 494  V------KTLETLILDFNDL 535
            +      K L  L L FN L
Sbjct: 1552 LTSLTNCKRLRILYLSFNPL 1571

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 69/199 (34%), Positives = 90/199 (45%), Gaps = 30/199 (15%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMD------TLLKMRGLKVLDLSFNEFSGELPESL 190
           +P   GS   LE+L L  NN +GE  +       +L   + L  LD++ N  SG LP S+
Sbjct: 318 IPHTLGSIRFLENLHLGGNNLTGESSIQELSFLTSLTNCKWLSTLDITLNPLSGILPTSI 377

Query: 191 TNLSASL------------------------LTLDLSSNNFSGPILPNLCQNPKNTLQEL 298
            NLS SL                          L L  N+  G I P++ Q  K  LQ L
Sbjct: 378 GNLSTSLERFRASACNLKGNIPTEIGNLGSLYLLFLDHNDLIGTIPPSIGQLQK--LQGL 435

Query: 299 YLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           +L +N   G IP  +     LV L L  N LSG+IP+ LG L+ LR + L  N L   IP
Sbjct: 436 HLSDNKLQGFIPNDICQLRNLVELFLENNQLSGSIPACLGELTFLRQVDLGSNKLNSTIP 495

Query: 479 QELMYVKTLETLILDFNDL 535
             L  +K + TL L  N L
Sbjct: 496 LTLWSLKDILTLDLSSNFL 514

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 62/167 (37%), Positives = 93/167 (55%), Gaps = 8/167 (4%)
 Frame = +2

Query: 59  LESLALSSNNFS-GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN 235
           L+ +AL+ N+ S GE+P + +  +  L VL +  N  +G +P  + N+S S+++  L  N
Sbjct: 206 LQEIALTYNSLSTGEVPCE-IGSLHTLNVLRIEDNRLTGYIPSQIFNIS-SMVSASLGRN 263

Query: 236 NFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           NFSG + PN   +  N L EL L  N  +G IP ++SN S+L  L +  N  +G+IP +L
Sbjct: 264 NFSGNLPPNFASHLPN-LDELLLGINRLSGIIPSSISNASKLTRLDVGGNAFTGSIPHTL 322

Query: 416 GSLSKLRDLKLWLNMLEGEIP-QELMYV------KTLETLILDFNDL 535
           GS+  L +L L  N L GE   QEL ++      K L TL +  N L
Sbjct: 323 GSIRFLENLHLGGNNLTGESSIQELSFLTSLTNCKWLSTLDITLNPL 369

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 58/175 (33%), Positives = 86/175 (49%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           L L   +PP  G+ S L SL LS NNF G L +  + ++  L+ ++L +N FSG++P S 
Sbjct: 70  LGLRGTIPPDLGNLSFLVSLDLSRNNFHG-LVLVEVDQLTSLQSINLQYNLFSGQIPPSF 128

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            NL                           N LQ L+L NN FT  IP ++ N S L +L
Sbjct: 129 GNL---------------------------NRLQSLFLGNNSFTRTIPLSIGNMSMLETL 161

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+ N+L G I   +  LS L+ L++  N L   IP  +  + +L+ + L +N L
Sbjct: 162 GLAGNHLQGNIREKIVKLSNLKILEIQSNHLVSAIPLAIFNIFSLQEIALTYNSL 216

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 54/131 (41%), Positives = 77/131 (58%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           LDLS     G +P  L NLS  L++LDLS NNF G +L  + Q    +LQ + LQ N F+
Sbjct: 65  LDLSNLGLRGTIPPDLGNLSF-LVSLDLSRNNFHGLVLVEVDQ--LTSLQSINLQYNLFS 121

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G+IPP+  N + L SL L  N  + TIP S+G++S L  L L  N L+G I ++++ +  
Sbjct: 122 GQIPPSFGNLNRLQSLFLGNNSFTRTIPLSIGNMSMLETLGLAGNHLQGNIREKIVKLSN 181

Query: 503 LETLILDFNDL 535
           L+ L +  N L
Sbjct: 182 LKILEIQSNHL 192

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 63/176 (35%), Positives = 84/176 (47%), Gaps = 7/176 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP-------ES 187
           +P    + S L  L +  N F+G +P  TL  +R L+ L L  N  +GE          S
Sbjct: 294 IPSSISNASKLTRLDVGGNAFTGSIP-HTLGSIRFLENLHLGGNNLTGESSIQELSFLTS 352

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           LTN    L TLD++ N  SG ILP    N   +L+          G IP  + N   L  
Sbjct: 353 LTNCKW-LSTLDITLNPLSG-ILPTSIGNLSTSLERFRASACNLKGNIPTEIGNLGSLYL 410

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L L  N L GTIP S+G L KL+ L L  N L+G IP ++  ++ L  L L+ N L
Sbjct: 411 LFLDHNDLIGTIPPSIGQLQKLQGLHLSDNKLQGFIPNDICQLRNLVELFLENNQL 466

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 60/169 (35%), Positives = 84/169 (49%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP  G    L+ L L SN   G +P D + ++R L  L L+ N+ SG +P  L  L+  
Sbjct: 1624 IPPSIGQLQKLQGLYLPSNKLQGSIPND-ICQLRNLGELFLTNNQLSGSIPACLGELTF- 1681

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L L SN  +  I P+   +  + L  L + +N   G +P  + N   LV + LS N 
Sbjct: 1682 LRHLYLGSNKLNSTI-PSTLWSLIHILS-LDMSSNFLVGYLPSDMGNLKVLVKIDLSRNQ 1739

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG IPS++G L  L  L L  N  EG I      +K+LE + L  N L
Sbjct: 1740 LSGEIPSNIGGLQDLTSLSLAHNRFEGPILHSFSNLKSLEFMDLSDNAL 1788

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 55/167 (32%), Positives = 90/167 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ S L  L+L++N+ +G +P  ++ +++ L+ L L  N+  G +P  +  L  +
Sbjct: 1600 IPTEIGNLSNLYLLSLNNNDLTGTIP-PSIGQLQKLQGLYLPSNKLQGSIPNDICQLR-N 1657

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L L++N  SG I    C      L+ LYL +N     IP TL +   ++SL +S N+
Sbjct: 1658 LGELFLTNNQLSGSI--PACLGELTFLRHLYLGSNKLNSTIPSTLWSLIHILSLDMSSNF 1715

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L G +PS +G+L  L  + L  N L GEIP  +  ++ L +L L  N
Sbjct: 1716 LVGYLPSDMGNLKVLVKIDLSRNQLSGEIPSNIGGLQDLTSLSLAHN 1762

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 64/176 (36%), Positives = 82/176 (46%), Gaps = 7/176 (3%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE-------LPES 187
            +P   G+ S L SL    N  +G +P   L  +R L+ L+L  N   GE          S
Sbjct: 1496 IPSSIGNASKLRSLDFGYNMLTGSIP-HALGSLRFLERLNLGVNNLKGESYIQELSFLTS 1554

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
            LTN    L  L LS N   G ILP    N   +LQ          G IP  + N S L  
Sbjct: 1555 LTNCKR-LRILYLSFNPLIG-ILPISIGNLSTSLQRFEANTCKLKGNIPTEIGNLSNLYL 1612

Query: 368  LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L L+ N L+GTIP S+G L KL+ L L  N L+G IP ++  ++ L  L L  N L
Sbjct: 1613 LSLNNNDLTGTIPPSIGQLQKLQGLYLPSNKLQGSIPNDICQLRNLGELFLTNNQL 1668

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 69/221 (31%), Positives = 95/221 (42%), Gaps = 52/221 (23%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMD------TLLKMRGLKVLDLSFNEFSGELPESL 190
            +P   GS   LE L L  NN  GE  +       +L   + L++L LSFN   G LP S+
Sbjct: 1520 IPHALGSLRFLERLNLGVNNLKGESYIQELSFLTSLTNCKRLRILYLSFNPLIGILPISI 1579

Query: 191  TNLSASL------------------------LTLDLSSNNFSGPILPNLCQN-------- 274
             NLS SL                          L L++N+ +G I P++ Q         
Sbjct: 1580 GNLSTSLQRFEANTCKLKGNIPTEIGNLSNLYLLSLNNNDLTGTIPPSIGQLQKLQGLYL 1639

Query: 275  PKNTLQ--------------ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
            P N LQ              EL+L NN  +G IP  L   + L  L+L  N L+ TIPS+
Sbjct: 1640 PSNKLQGSIPNDICQLRNLGELFLTNNQLSGSIPACLGELTFLRHLYLGSNKLNSTIPST 1699

Query: 413  LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L SL  +  L +  N L G +P ++  +K L  + L  N L
Sbjct: 1700 LWSLIHILSLDMSSNFLVGYLPSDMGNLKVLVKIDLSRNQL 1740

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 56/157 (35%), Positives = 75/157 (47%), Gaps = 5/157 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G  + L  + L SN  +  +P+ TL  ++ +  LDLS N     LP  + NL   
Sbjct: 470 IPACLGELTFLRQVDLGSNKLNSTIPL-TLWSLKDILTLDLSSNFLVSYLPSDMGNLKV- 527

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQ-----ELYLQNNGFTGKIPPTLSNCSELVSLH 373
           L+ +DLS N  S       C+ P N +       L L +N F G I  + SN   L  + 
Sbjct: 528 LVKIDLSRNQLS-------CEIPSNAVDLRDLISLSLAHNRFEGPILHSFSNLKSLEFMD 580

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
           LS N LSG IP SL  L  L+ L +  N L GEIP E
Sbjct: 581 LSDNALSGEIPKSLEGLVYLKYLNVSFNRLYGEIPTE 617

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 57/170 (33%), Positives = 82/170 (48%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSL-LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           LP   G+ S  LE    S+ N  G +P + +  +  L +L L  N+  G +P S+  L  
Sbjct: 373 LPTSIGNLSTSLERFRASACNLKGNIPTE-IGNLGSLYLLFLDHNDLIGTIPPSIGQLQ- 430

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  L LS N   G I  ++CQ     L EL+L+NN  +G IP  L   + L  + L  N
Sbjct: 431 KLQGLHLSDNKLQGFIPNDICQ--LRNLVELFLENNQLSGSIPACLGELTFLRQVDLGSN 488

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+ TIP +L SL  +  L L  N L   +P ++  +K L  + L  N L
Sbjct: 489 KLNSTIPLTLWSLKDILTLDLSSNFLVSYLPSDMGNLKVLVKIDLSRNQL 538

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 62/192 (32%), Positives = 87/192 (45%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS-- 202
           +PP  G    L+ L LS N   G +P D + ++R L  L L  N+ SG +P  L  L+  
Sbjct: 422 IPPSIGQLQKLQGLHLSDNKLQGFIPND-ICQLRNLVELFLENNQLSGSIPACLGELTFL 480

Query: 203 ---------------------ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                  +LTLDLSSN F    LP+   N K  L ++ L  N  
Sbjct: 481 RQVDLGSNKLNSTIPLTLWSLKDILTLDLSSN-FLVSYLPSDMGNLK-VLVKIDLSRNQL 538

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           + +IP    +  +L+SL L+ N   G I  S  +L  L  + L  N L GEIP+ L  + 
Sbjct: 539 SCEIPSNAVDLRDLISLSLAHNRFEGPILHSFSNLKSLEFMDLSDNALSGEIPKSLEGLV 598

Query: 500 TLETLILDFNDL 535
            L+ L + FN L
Sbjct: 599 YLKYLNVSFNRL 610

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 51/167 (30%), Positives = 85/167 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+   L  L L  N+  G +P  ++ +++ L+ L LS N+  G +P  +  L  +
Sbjct: 398 IPTEIGNLGSLYLLFLDHNDLIGTIP-PSIGQLQKLQGLHLSDNKLQGFIPNDICQLR-N 455

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L L +N  SG I    C      L+++ L +N     IP TL +  ++++L LS N+
Sbjct: 456 LVELFLENNQLSGSI--PACLGELTFLRQVDLGSNKLNSTIPLTLWSLKDILTLDLSSNF 513

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           L   +PS +G+L  L  + L  N L  EIP   + ++ L +L L  N
Sbjct: 514 LVSYLPSDMGNLKVLVKIDLSRNQLSCEIPSNAVDLRDLISLSLAHN 560

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 51/133 (38%), Positives = 68/133 (51%), Gaps = 3/133 (2%)
 Frame = +2

Query: 17   LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVL---DLSFNEFSGELPES 187
            L   +P    S   + SL +SSN   G LP D    M  LKVL   DLS N+ SGE+P +
Sbjct: 1692 LNSTIPSTLWSLIHILSLDMSSNFLVGYLPSD----MGNLKVLVKIDLSRNQLSGEIPSN 1747

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
            +  L   L +L L+ N F GPIL +       +L+ + L +N   G+IP +L     L  
Sbjct: 1748 IGGLQ-DLTSLSLAHNRFEGPILHSFSN--LKSLEFMDLSDNALFGEIPKSLEGLVYLKY 1804

Query: 368  LHLSFNYLSGTIP 406
            L +SFN L G IP
Sbjct: 1805 LDVSFNGLYGEIP 1817

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 38/90 (42%), Positives = 47/90 (52%)
 Frame = +2

Query: 266  CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
            C   +  +  L L N G  G IPP L N S LVSL LS N   G IP S G+L++L+ L 
Sbjct: 1232 CNAQQQRVIALDLSNLGLRGTIPPDLGNLSFLVSLDLSSNNFHGPIPPSFGNLNRLQSLF 1291

Query: 446  LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N   G IP  +  +  LETL +  N L
Sbjct: 1292 LGNNSFTGTIPPSIGNMSMLETLDIQSNQL 1321

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 38/126 (30%), Positives = 55/126 (43%), Gaps = 19/126 (15%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNL-------------------CQNPKNTLQELYLQNNGFTGKI 331
           L+ LDLS   F  P++  +                   C   + ++  L L N G  G I
Sbjct: 17  LIALDLSKKIFHIPVIDEVGHLHCLKATNIQFNQFKVSCNTQQQSVIALDLSNLGLRGTI 76

Query: 332 PPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLET 511
           PP L N S LVSL LS N   G +   +  L+ L+ + L  N+  G+IP     +  L++
Sbjct: 77  PPDLGNLSFLVSLDLSRNNFHGLVLVEVDQLTSLQSINLQYNLFSGQIPPSFGNLNRLQS 136

Query: 512 LILDFN 529
           L L  N
Sbjct: 137 LFLGNN 142

[39][TOP]
>UniRef100_Q9LJF3 Receptor-like protein kinase BRI1-like 3 n=1 Tax=Arabidopsis
           thaliana RepID=BRL3_ARATH
          Length = 1164

 Score =  117 bits (294), Expect = 4e-25
 Identities = 72/174 (41%), Positives = 98/174 (56%), Gaps = 2/174 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LP  F SC  L+SL L +N  SG+     + K+  +  L L FN  SG +P SLT
Sbjct: 313 SLTGQLPQSFTSCGSLQSLNLGNNKLSGDFLSTVVSKLSRITNLYLPFNNISGSVPISLT 372

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQ-NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           N S +L  LDLSSN F+G +    C     + L++L + NN  +G +P  L  C  L ++
Sbjct: 373 NCS-NLRVLDLSSNEFTGEVPSGFCSLQSSSVLEKLLIANNYLSGTVPVELGKCKSLKTI 431

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFN 529
            LSFN L+G IP  + +L KL DL +W N L G IP+ + +    LETLIL+ N
Sbjct: 432 DLSFNALTGLIPKEIWTLPKLSDLVMWANNLTGGIPESICVDGGNLETLILNNN 485

 Score =  107 bits (268), Expect = 4e-22
 Identities = 69/175 (39%), Positives = 102/175 (58%), Gaps = 3/175 (1%)
 Frame = +2

Query: 20  ELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL 199
           ++P   ++G+   L  L+L+ N +SGE+P +  L  R L+VLDLS N  +G+LP+S T+ 
Sbjct: 266 KIPGDDYWGNFQNLRQLSLAHNLYSGEIPPELSLLCRTLEVLDLSGNSLTGQLPQSFTS- 324

Query: 200 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
             SL +L+L +N  SG  L  +  +  + +  LYL  N  +G +P +L+NCS L  L LS
Sbjct: 325 CGSLQSLNLGNNKLSGDFLSTVV-SKLSRITNLYLPFNNISGSVPISLTNCSNLRVLDLS 383

Query: 380 FNYLSGTIPS---SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            N  +G +PS   SL S S L  L +  N L G +P EL   K+L+T+ L FN L
Sbjct: 384 SNEFTGEVPSGFCSLQSSSVLEKLLIANNYLSGTVPVELGKCKSLKTIDLSFNAL 438

 Score =  103 bits (258), Expect = 6e-21
 Identities = 65/163 (39%), Positives = 97/163 (59%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           S S+LE L +++N  SG +P++ L K + LK +DLSFN  +G +P+ +  L   L  L +
Sbjct: 400 SSSVLEKLLIANNYLSGTVPVE-LGKCKSLKTIDLSFNALTGLIPKEIWTLP-KLSDLVM 457

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            +NN +G I  ++C +  N L+ L L NN  TG +P ++S C+ ++ + LS N L+G IP
Sbjct: 458 WANNLTGGIPESICVDGGN-LETLILNNNLLTGSLPESISKCTNMLWISLSSNLLTGEIP 516

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             +G L KL  L+L  N L G IP EL   K L  L L+ N+L
Sbjct: 517 VGIGKLEKLAILQLGNNSLTGNIPSELGNCKNLIWLDLNSNNL 559

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 66/173 (38%), Positives = 89/173 (51%), Gaps = 8/173 (4%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES-LTNLSASLLT 217
           F +C  L S+  S N  +G+L        + +  +DLS N FS E+PE+ + +   SL  
Sbjct: 146 FSTCLNLVSVNFSHNKLAGKLKSSPSASNKRITTVDLSNNRFSDEIPETFIADFPNSLKH 205

Query: 218 LDLSSNNFSGP---ILPNLCQNPKNTLQELYLQNNGFTG-KIPPTLSNCSELVSLHLSFN 385
           LDLS NN +G    +   LC+N    L    L  N  +G + P +LSNC  L +L+LS N
Sbjct: 206 LDLSGNNVTGDFSRLSFGLCEN----LTVFSLSQNSISGDRFPVSLSNCKLLETLNLSRN 261

Query: 386 YLSGTIPSS--LGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFNDL 535
            L G IP     G+   LR L L  N+  GEIP EL +  +TLE L L  N L
Sbjct: 262 SLIGKIPGDDYWGNFQNLRQLSLAHNLYSGEIPPELSLLCRTLEVLDLSGNSL 314

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 45/125 (36%), Positives = 67/125 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L + +NN +G +P    +    L+ L L+ N  +G LPES++  + ++L + LSSN 
Sbjct: 452 LSDLVMWANNLTGGIPESICVDGGNLETLILNNNLLTGSLPESISKCT-NMLWISLSSNL 510

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G I   + +  K  L  L L NN  TG IP  L NC  L+ L L+ N L+G +P  L 
Sbjct: 511 LTGEIPVGIGKLEK--LAILQLGNNSLTGNIPSELGNCKNLIWLDLNSNNLTGNLPGELA 568

Query: 419 SLSKL 433
           S + L
Sbjct: 569 SQAGL 573

[40][TOP]
>UniRef100_UPI0000DF07A5 Os02g0610000 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000DF07A5
          Length = 1092

 Score =  117 bits (293), Expect = 5e-25
 Identities = 76/175 (43%), Positives = 97/175 (55%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           LSL   +    G+ + L++L  SSN+FSG+LP   L  +  LKVLDL  N     +PE L
Sbjct: 83  LSLSGTISSSLGNLTFLKALNFSSNHFSGKLP--PLNHLHRLKVLDLRHNSLRDTIPEGL 140

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            N S  L  LDLSSN+  G I   L       L  L L NN FTG IPPTL N + L  L
Sbjct: 141 ANCSR-LRVLDLSSNSLVGEIPTKL--GLLTNLSSLCLSNNSFTGTIPPTLGNITGLNYL 197

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N+L G+IP  LG LS L  L +++N + G +P EL  + +L+TL L  N L
Sbjct: 198 SLQINHLEGSIPRELGKLSDLLSLNIFMNNISGRLPHELFNLSSLQTLWLSDNML 252

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 60/165 (36%), Positives = 87/165 (52%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F +C+LL++L L+ N   G++P         L+ L+L  N F G +P S+ NL   L +L
Sbjct: 338 FANCTLLQALNLARNQIKGDIPSSIGNLSTNLQYLNLGVNHFVGVVPPSIGNLHG-LTSL 396

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
            LS NN  G I   +       L+ LYLQ N FTG IP ++ + + L+   L  N L G 
Sbjct: 397 WLSKNNLIGTIEEWV--GKLRNLELLYLQENNFTGSIPSSIGDLTNLIQFSLGKNSLDGQ 454

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           IP++LG+L +L  L    N L G IP  +  ++ L  L L  N+L
Sbjct: 455 IPANLGNLRQLDRLNFSYNNLHGSIPYNVGKLRNLVQLDLSHNNL 499

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 54/147 (36%), Positives = 73/147 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   L SL LS NN  G +  + + K+R L++L L  N F+G +P S+ +L+ +
Sbjct: 383 VPPSIGNLHGLTSLWLSKNNLIGTIE-EWVGKLRNLELLYLQENNFTGSIPSSIGDLT-N 440

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+   L  N+  G I  NL       L  L    N   G IP  +     LV L LS N 
Sbjct: 441 LIQFSLGKNSLDGQIPANL--GNLRQLDRLNFSYNNLHGSIPYNVGKLRNLVQLDLSHNN 498

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEG 469
           L G IPSS   L KL+ L L  N  +G
Sbjct: 499 LDGNIPSSFIKLQKLKHLDLSDNNFQG 525

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 65/177 (36%), Positives = 91/177 (51%), Gaps = 3/177 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G  + L SL LS+N+F+G +P  TL  + GL  L L  N   G +P  L 
Sbjct: 155 SLVGEIPTKLGLLTNLSSLCLSNNSFTGTIP-PTLGNITGLNYLSLQINHLEGSIPRELG 213

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK--IPPTLSNC-SELV 364
            LS  LL+L++  NN SG  LP+   N  ++LQ L+L +N   GK  +PP + +    L 
Sbjct: 214 KLS-DLLSLNIFMNNISGR-LPHELFN-LSSLQTLWLSDN-MLGKEALPPNIGDVLPNLQ 269

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L L+ N   G IP+SL + S L  + L  N   G++P  L  +  L  L L  N L
Sbjct: 270 FLSLARNMFEGHIPTSLINASGLWLIDLTNNNFYGQVPSYLSELANLSDLYLAGNHL 326

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 69/222 (31%), Positives = 100/222 (45%), Gaps = 53/222 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ + L  L+L  N+  G +P + L K+  L  L++  N  SG LP  L NLS S
Sbjct: 184 IPPTLGNITGLNYLSLQINHLEGSIPRE-LGKLSDLLSLNIFMNNISGRLPHELFNLS-S 241

Query: 209 LLTLDLSSNNFS--------GPILPNL-----CQN------PKNTLQE-----LYLQNNG 316
           L TL LS N           G +LPNL      +N      P + +       + L NN 
Sbjct: 242 LQTLWLSDNMLGKEALPPNIGDVLPNLQFLSLARNMFEGHIPTSLINASGLWLIDLTNNN 301

Query: 317 FTGKIPPTLS----------------------------NCSELVSLHLSFNYLSGTIPSS 412
           F G++P  LS                            NC+ L +L+L+ N + G IPSS
Sbjct: 302 FYGQVPSYLSELANLSDLYLAGNHLEASDNEKWLHAFANCTLLQALNLARNQIKGDIPSS 361

Query: 413 LGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +G+LS  L+ L L +N   G +P  +  +  L +L L  N+L
Sbjct: 362 IGNLSTNLQYLNLGVNHFVGVVPPSIGNLHGLTSLWLSKNNL 403

[41][TOP]
>UniRef100_Q6K6X6 Putative uncharacterized protein OJ1476_F05.7 n=1 Tax=Oryza sativa
           Japonica Group RepID=Q6K6X6_ORYSJ
          Length = 552

 Score =  117 bits (293), Expect = 5e-25
 Identities = 76/175 (43%), Positives = 97/175 (55%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           LSL   +    G+ + L++L  SSN+FSG+LP   L  +  LKVLDL  N     +PE L
Sbjct: 83  LSLSGTISSSLGNLTFLKALNFSSNHFSGKLP--PLNHLHRLKVLDLRHNSLRDTIPEGL 140

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            N S  L  LDLSSN+  G I   L       L  L L NN FTG IPPTL N + L  L
Sbjct: 141 ANCSR-LRVLDLSSNSLVGEIPTKL--GLLTNLSSLCLSNNSFTGTIPPTLGNITGLNYL 197

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N+L G+IP  LG LS L  L +++N + G +P EL  + +L+TL L  N L
Sbjct: 198 SLQINHLEGSIPRELGKLSDLLSLNIFMNNISGRLPHELFNLSSLQTLWLSDNML 252

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 62/176 (35%), Positives = 89/176 (50%), Gaps = 12/176 (6%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F +C+LL++L L+ N   G++P         L+ L+L  N F G +P S+ NL   L +L
Sbjct: 338 FANCTLLQALNLARNQIKGDIPSSIGNLSTNLQYLNLGVNHFVGVVPPSIGNLHG-LTSL 396

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPT------------LSNCSELV 364
            LS NN  G I   +       L+ LYLQ N FTG IP +            L N  +L 
Sbjct: 397 WLSKNNLIGTIEEWV--GKLRNLELLYLQENNFTGSIPSSIGNSLDGQIPANLGNLRQLD 454

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            L+ S+N L G+IP ++G L  L  L L  N L+G IP   + ++ L+ L L  N+
Sbjct: 455 RLNFSYNNLHGSIPYNVGKLRNLVQLDLSHNNLDGNIPSSFIKLQKLKHLDLSDNN 510

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 65/177 (36%), Positives = 91/177 (51%), Gaps = 3/177 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G  + L SL LS+N+F+G +P  TL  + GL  L L  N   G +P  L 
Sbjct: 155 SLVGEIPTKLGLLTNLSSLCLSNNSFTGTIP-PTLGNITGLNYLSLQINHLEGSIPRELG 213

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK--IPPTLSNC-SELV 364
            LS  LL+L++  NN SG  LP+   N  ++LQ L+L +N   GK  +PP + +    L 
Sbjct: 214 KLS-DLLSLNIFMNNISGR-LPHELFN-LSSLQTLWLSDN-MLGKEALPPNIGDVLPNLQ 269

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L L+ N   G IP+SL + S L  + L  N   G++P  L  +  L  L L  N L
Sbjct: 270 FLSLARNMFEGHIPTSLINASGLWLIDLTNNNFYGQVPSYLSELANLSDLYLAGNHL 326

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 65/209 (31%), Positives = 92/209 (44%), Gaps = 40/209 (19%)
 Frame = +2

Query: 29  LPPFFGSC-SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS- 202
           LPP  G     L+ L+L+ N F G +P  +L+   GL ++DL+ N F G++P  L+ L+ 
Sbjct: 257 LPPNIGDVLPNLQFLSLARNMFEGHIPT-SLINASGLWLIDLTNNNFYGQVPSYLSELAN 315

Query: 203 --------------------------ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 304
                                       L  L+L+ N   G I P+   N    LQ L L
Sbjct: 316 LSDLYLAGNHLEASDNEKWLHAFANCTLLQALNLARNQIKGDI-PSSIGNLSTNLQYLNL 374

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLN--------- 457
             N F G +PP++ N   L SL LS N L GTI   +G L  L  L L  N         
Sbjct: 375 GVNHFVGVVPPSIGNLHGLTSLWLSKNNLIGTIEEWVGKLRNLELLYLQENNFTGSIPSS 434

Query: 458 ---MLEGEIPQELMYVKTLETLILDFNDL 535
               L+G+IP  L  ++ L+ L   +N+L
Sbjct: 435 IGNSLDGQIPANLGNLRQLDRLNFSYNNL 463

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 69/222 (31%), Positives = 100/222 (45%), Gaps = 53/222 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ + L  L+L  N+  G +P + L K+  L  L++  N  SG LP  L NLS S
Sbjct: 184 IPPTLGNITGLNYLSLQINHLEGSIPRE-LGKLSDLLSLNIFMNNISGRLPHELFNLS-S 241

Query: 209 LLTLDLSSNNFS--------GPILPNL-----CQN------PKNTLQE-----LYLQNNG 316
           L TL LS N           G +LPNL      +N      P + +       + L NN 
Sbjct: 242 LQTLWLSDNMLGKEALPPNIGDVLPNLQFLSLARNMFEGHIPTSLINASGLWLIDLTNNN 301

Query: 317 FTGKIPPTLS----------------------------NCSELVSLHLSFNYLSGTIPSS 412
           F G++P  LS                            NC+ L +L+L+ N + G IPSS
Sbjct: 302 FYGQVPSYLSELANLSDLYLAGNHLEASDNEKWLHAFANCTLLQALNLARNQIKGDIPSS 361

Query: 413 LGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +G+LS  L+ L L +N   G +P  +  +  L +L L  N+L
Sbjct: 362 IGNLSTNLQYLNLGVNHFVGVVPPSIGNLHGLTSLWLSKNNL 403

[42][TOP]
>UniRef100_Q0IZA4 Os10g0114400 protein (Fragment) n=2 Tax=Oryza sativa Japonica Group
           RepID=Q0IZA4_ORYSJ
          Length = 1146

 Score =  117 bits (293), Expect = 5e-25
 Identities = 70/167 (41%), Positives = 93/167 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    SC  L  L +++NN SG +P   L  +  ++ L LS N  SG LP+++ +   +
Sbjct: 310 IPESLSSCHALRLLDVANNNVSGGIPAAVLGNLTAVESLLLSNNFISGSLPDTIAHCK-N 368

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L   DLSSN  SG +   LC +P   L+EL L +N   G IPP LSNCS L  +  S NY
Sbjct: 369 LRVADLSSNKISGALPAELC-SPGAALEELRLPDNLVAGTIPPGLSNCSRLRVIDFSINY 427

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           L G IP  LG L  L  L +W N L+G IP +L   + L TLIL+ N
Sbjct: 428 LRGPIPPELGRLRALEKLVMWFNGLDGRIPADLGQCRNLRTLILNNN 474

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 57/160 (35%), Positives = 90/160 (56%), Gaps = 1/160 (0%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L LS N F+G +P  +L    GL  L+LS+N  +G +PE +  + A L  LD+S N+
Sbjct: 222 LAVLDLSGNRFTGAIP-PSLSGCAGLTTLNLSYNGLAGAIPEGIGAI-AGLEVLDVSWNH 279

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS-L 415
            +G I P L +N   +L+ L + +N  +G IP +LS+C  L  L ++ N +SG IP++ L
Sbjct: 280 LTGAIPPGLGRNACASLRVLRVSSNNISGSIPESLSSCHALRLLDVANNNVSGGIPAAVL 339

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G+L+ +  L L  N + G +P  + + K L    L  N +
Sbjct: 340 GNLTAVESLLLSNNFISGSLPDTIAHCKNLRVADLSSNKI 379

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 73/214 (34%), Positives = 95/214 (44%), Gaps = 50/214 (23%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL- 220
           G+ + +ESL LS+N  SG LP DT+   + L+V DLS N+ SG LP  L +  A+L  L 
Sbjct: 340 GNLTAVESLLLSNNFISGSLP-DTIAHCKNLRVADLSSNKISGALPAELCSPGAALEELR 398

Query: 221 -----------------------DLSSNNFSGPILPNL---------------------- 265
                                  D S N   GPI P L                      
Sbjct: 399 LPDNLVAGTIPPGLSNCSRLRVIDFSINYLRGPIPPELGRLRALEKLVMWFNGLDGRIPA 458

Query: 266 ----CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 433
               C+N    L+ L L NN   G IP  L NC+ L  + L+ N ++GTI    G LS+L
Sbjct: 459 DLGQCRN----LRTLILNNNFIGGDIPVELFNCTGLEWVSLTSNQITGTIRPEFGRLSRL 514

Query: 434 RDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L+L  N L GEIP+EL    +L  L L+ N L
Sbjct: 515 AVLQLANNSLAGEIPRELGNCSSLMWLDLNSNRL 548

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 58/147 (39%), Positives = 79/147 (53%), Gaps = 4/147 (2%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L LS    +G LP   L     L  + L+ N  +GELP  L  L++++ + D+S NN
Sbjct: 151 LLQLDLSDGGLAGRLPDGFLACYPNLTDVSLARNNLTGELPGML--LASNIRSFDVSGNN 208

Query: 239 FSGPI----LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            SG I    LP        TL  L L  N FTG IPP+LS C+ L +L+LS+N L+G IP
Sbjct: 209 MSGDISGVSLPA-------TLAVLDLSGNRFTGAIPPSLSGCAGLTTLNLSYNGLAGAIP 261

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQEL 487
             +G+++ L  L +  N L G IP  L
Sbjct: 262 EGIGAIAGLEVLDVSWNHLTGAIPPGL 288

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 50/131 (38%), Positives = 68/131 (51%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+PP  G    LE L +  N   G +P D L + R L+ L L+ N   G++P  L N + 
Sbjct: 431 PIPPELGRLRALEKLVMWFNGLDGRIPAD-LGQCRNLRTLILNNNFIGGDIPVELFNCTG 489

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  + L+SN  +G I P   +  +  L  L L NN   G+IP  L NCS L+ L L+ N
Sbjct: 490 -LEWVSLTSNQITGTIRPEFGRLSR--LAVLQLANNSLAGEIPRELGNCSSLMWLDLNSN 546

Query: 386 YLSGTIPSSLG 418
            L+G IP  LG
Sbjct: 547 RLTGEIPRRLG 557

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 61/208 (29%), Positives = 86/208 (41%), Gaps = 41/208 (19%)
 Frame = +2

Query: 35   PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-TNLSASL 211
            P FG  S L  L L++N+ +GE+P + L     L  LDL+ N  +GE+P  L   L ++ 
Sbjct: 506  PEFGRLSRLAVLQLANNSLAGEIPRE-LGNCSSLMWLDLNSNRLTGEIPRRLGRQLGSTP 564

Query: 212  LTLDLSSNN-------------------FSGPILPNLCQNPK------------------ 280
            L+  LS N                    F+G     L Q P                   
Sbjct: 565  LSGILSGNTLAFVRNVGNSCKGVGGLLEFAGIRPERLLQVPTLKSCDFTRLYSGAAVSGW 624

Query: 281  ---NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLW 451
                TL+ L L  N   G+IP  L +   L  L L+ N L+G IP+SLG L  L    + 
Sbjct: 625  TRYQTLEYLDLSYNSLDGEIPEELGDMVVLQVLDLARNNLTGEIPASLGRLRNLGVFDVS 684

Query: 452  LNMLEGEIPQELMYVKTLETLILDFNDL 535
             N L+G IP     +  L  + +  N+L
Sbjct: 685  RNRLQGGIPDSFSNLSFLVQIDISDNNL 712

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 63/199 (31%), Positives = 79/199 (39%), Gaps = 43/199 (21%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLD--LSFN--------- 160
            SL   +P   G+CS L  L L+SN  +GE+P   L +  G   L   LS N         
Sbjct: 523  SLAGEIPRELGNCSSLMWLDLNSNRLTGEIPR-RLGRQLGSTPLSGILSGNTLAFVRNVG 581

Query: 161  ----------EFSGELPESLTNLSA----------------------SLLTLDLSSNNFS 244
                      EF+G  PE L  +                        +L  LDLS N+  
Sbjct: 582  NSCKGVGGLLEFAGIRPERLLQVPTLKSCDFTRLYSGAAVSGWTRYQTLEYLDLSYNSLD 641

Query: 245  GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
            G I   L       LQ L L  N  TG+IP +L     L    +S N L G IP S  +L
Sbjct: 642  GEIPEEL--GDMVVLQVLDLARNNLTGEIPASLGRLRNLGVFDVSRNRLQGGIPDSFSNL 699

Query: 425  SKLRDLKLWLNMLEGEIPQ 481
            S L  + +  N L GEIPQ
Sbjct: 700  SFLVQIDISDNNLSGEIPQ 718

[43][TOP]
>UniRef100_Q0DZM7 Os02g0610000 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q0DZM7_ORYSJ
          Length = 528

 Score =  117 bits (293), Expect = 5e-25
 Identities = 76/175 (43%), Positives = 97/175 (55%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           LSL   +    G+ + L++L  SSN+FSG+LP   L  +  LKVLDL  N     +PE L
Sbjct: 83  LSLSGTISSSLGNLTFLKALNFSSNHFSGKLP--PLNHLHRLKVLDLRHNSLRDTIPEGL 140

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            N S  L  LDLSSN+  G I   L       L  L L NN FTG IPPTL N + L  L
Sbjct: 141 ANCSR-LRVLDLSSNSLVGEIPTKL--GLLTNLSSLCLSNNSFTGTIPPTLGNITGLNYL 197

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N+L G+IP  LG LS L  L +++N + G +P EL  + +L+TL L  N L
Sbjct: 198 SLQINHLEGSIPRELGKLSDLLSLNIFMNNISGRLPHELFNLSSLQTLWLSDNML 252

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 60/165 (36%), Positives = 87/165 (52%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F +C+LL++L L+ N   G++P         L+ L+L  N F G +P S+ NL   L +L
Sbjct: 338 FANCTLLQALNLARNQIKGDIPSSIGNLSTNLQYLNLGVNHFVGVVPPSIGNLHG-LTSL 396

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
            LS NN  G I   +       L+ LYLQ N FTG IP ++ + + L+   L  N L G 
Sbjct: 397 WLSKNNLIGTIEEWV--GKLRNLELLYLQENNFTGSIPSSIGDLTNLIQFSLGKNSLDGQ 454

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           IP++LG+L +L  L    N L G IP  +  ++ L  L L  N+L
Sbjct: 455 IPANLGNLRQLDRLNFSYNNLHGSIPYNVGKLRNLVQLDLSHNNL 499

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 56/150 (37%), Positives = 75/150 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   L SL LS NN  G +  + + K+R L++L L  N F+G +P S+ +L+ +
Sbjct: 383 VPPSIGNLHGLTSLWLSKNNLIGTIE-EWVGKLRNLELLYLQENNFTGSIPSSIGDLT-N 440

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+   L  N+  G I  NL       L  L    N   G IP  +     LV L LS N 
Sbjct: 441 LIQFSLGKNSLDGQIPANL--GNLRQLDRLNFSYNNLHGSIPYNVGKLRNLVQLDLSHNN 498

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           L G IPSS   L KL+ L L  N  +G IP
Sbjct: 499 LDGNIPSSFIKLQKLKHLDLSDNNFQGIIP 528

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 65/177 (36%), Positives = 91/177 (51%), Gaps = 3/177 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G  + L SL LS+N+F+G +P  TL  + GL  L L  N   G +P  L 
Sbjct: 155 SLVGEIPTKLGLLTNLSSLCLSNNSFTGTIP-PTLGNITGLNYLSLQINHLEGSIPRELG 213

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK--IPPTLSNC-SELV 364
            LS  LL+L++  NN SG  LP+   N  ++LQ L+L +N   GK  +PP + +    L 
Sbjct: 214 KLS-DLLSLNIFMNNISGR-LPHELFN-LSSLQTLWLSDN-MLGKEALPPNIGDVLPNLQ 269

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L L+ N   G IP+SL + S L  + L  N   G++P  L  +  L  L L  N L
Sbjct: 270 FLSLARNMFEGHIPTSLINASGLWLIDLTNNNFYGQVPSYLSELANLSDLYLAGNHL 326

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 69/222 (31%), Positives = 100/222 (45%), Gaps = 53/222 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ + L  L+L  N+  G +P + L K+  L  L++  N  SG LP  L NLS S
Sbjct: 184 IPPTLGNITGLNYLSLQINHLEGSIPRE-LGKLSDLLSLNIFMNNISGRLPHELFNLS-S 241

Query: 209 LLTLDLSSNNFS--------GPILPNL-----CQN------PKNTLQE-----LYLQNNG 316
           L TL LS N           G +LPNL      +N      P + +       + L NN 
Sbjct: 242 LQTLWLSDNMLGKEALPPNIGDVLPNLQFLSLARNMFEGHIPTSLINASGLWLIDLTNNN 301

Query: 317 FTGKIPPTLS----------------------------NCSELVSLHLSFNYLSGTIPSS 412
           F G++P  LS                            NC+ L +L+L+ N + G IPSS
Sbjct: 302 FYGQVPSYLSELANLSDLYLAGNHLEASDNEKWLHAFANCTLLQALNLARNQIKGDIPSS 361

Query: 413 LGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +G+LS  L+ L L +N   G +P  +  +  L +L L  N+L
Sbjct: 362 IGNLSTNLQYLNLGVNHFVGVVPPSIGNLHGLTSLWLSKNNL 403

[44][TOP]
>UniRef100_A2Z4H7 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2Z4H7_ORYSI
          Length = 1110

 Score =  117 bits (293), Expect = 5e-25
 Identities = 70/167 (41%), Positives = 93/167 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    SC  L  L +++NN SG +P   L  +  ++ L LS N  SG LP+++ +   +
Sbjct: 274 IPESLSSCHALRLLDVANNNVSGGIPAAVLGNLTAVESLLLSNNFISGSLPDTIAHCK-N 332

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L   DLSSN  SG +   LC +P   L+EL L +N   G IPP LSNCS L  +  S NY
Sbjct: 333 LRVADLSSNKISGALPAELC-SPGAALEELRLPDNLVAGTIPPGLSNCSRLRVIDFSINY 391

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           L G IP  LG L  L  L +W N L+G IP +L   + L TLIL+ N
Sbjct: 392 LRGPIPPELGRLRALEKLVMWFNGLDGRIPADLGQCRNLRTLILNNN 438

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 57/160 (35%), Positives = 90/160 (56%), Gaps = 1/160 (0%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L LS N F+G +P  +L    GL  L+LS+N  +G +PE +  + A L  LD+S N+
Sbjct: 186 LAVLDLSGNRFTGAIP-PSLSGCAGLTTLNLSYNGLAGAIPEGIGAI-AGLEVLDVSWNH 243

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS-L 415
            +G I P L +N   +L+ L + +N  +G IP +LS+C  L  L ++ N +SG IP++ L
Sbjct: 244 LTGAIPPGLGRNACASLRVLRVSSNNISGSIPESLSSCHALRLLDVANNNVSGGIPAAVL 303

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G+L+ +  L L  N + G +P  + + K L    L  N +
Sbjct: 304 GNLTAVESLLLSNNFISGSLPDTIAHCKNLRVADLSSNKI 343

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 73/214 (34%), Positives = 95/214 (44%), Gaps = 50/214 (23%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL- 220
           G+ + +ESL LS+N  SG LP DT+   + L+V DLS N+ SG LP  L +  A+L  L 
Sbjct: 304 GNLTAVESLLLSNNFISGSLP-DTIAHCKNLRVADLSSNKISGALPAELCSPGAALEELR 362

Query: 221 -----------------------DLSSNNFSGPILPNL---------------------- 265
                                  D S N   GPI P L                      
Sbjct: 363 LPDNLVAGTIPPGLSNCSRLRVIDFSINYLRGPIPPELGRLRALEKLVMWFNGLDGRIPA 422

Query: 266 ----CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 433
               C+N    L+ L L NN   G IP  L NC+ L  + L+ N ++GTI    G LS+L
Sbjct: 423 DLGQCRN----LRTLILNNNFIGGDIPVELFNCTGLEWVSLTSNQITGTIRPEFGRLSRL 478

Query: 434 RDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L+L  N L GEIP+EL    +L  L L+ N L
Sbjct: 479 AVLQLANNSLAGEIPRELGNCSSLMWLDLNSNRL 512

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 58/147 (39%), Positives = 79/147 (53%), Gaps = 4/147 (2%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L LS    +G LP   L     L  + L+ N  +GELP  L  L++++ + D+S NN
Sbjct: 115 LLQLDLSDGGLAGRLPDGFLACYPNLTDVSLARNNLTGELPGML--LASNIRSFDVSGNN 172

Query: 239 FSGPI----LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            SG I    LP        TL  L L  N FTG IPP+LS C+ L +L+LS+N L+G IP
Sbjct: 173 MSGDISGVSLPA-------TLAVLDLSGNRFTGAIPPSLSGCAGLTTLNLSYNGLAGAIP 225

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQEL 487
             +G+++ L  L +  N L G IP  L
Sbjct: 226 EGIGAIAGLEVLDVSWNHLTGAIPPGL 252

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 50/131 (38%), Positives = 68/131 (51%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+PP  G    LE L +  N   G +P D L + R L+ L L+ N   G++P  L N + 
Sbjct: 395 PIPPELGRLRALEKLVMWFNGLDGRIPAD-LGQCRNLRTLILNNNFIGGDIPVELFNCTG 453

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  + L+SN  +G I P   +  +  L  L L NN   G+IP  L NCS L+ L L+ N
Sbjct: 454 -LEWVSLTSNQITGTIRPEFGRLSR--LAVLQLANNSLAGEIPRELGNCSSLMWLDLNSN 510

Query: 386 YLSGTIPSSLG 418
            L+G IP  LG
Sbjct: 511 RLTGEIPRRLG 521

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 61/208 (29%), Positives = 86/208 (41%), Gaps = 41/208 (19%)
 Frame = +2

Query: 35   PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-TNLSASL 211
            P FG  S L  L L++N+ +GE+P + L     L  LDL+ N  +GE+P  L   L ++ 
Sbjct: 470  PEFGRLSRLAVLQLANNSLAGEIPRE-LGNCSSLMWLDLNSNRLTGEIPRRLGRQLGSTP 528

Query: 212  LTLDLSSNN-------------------FSGPILPNLCQNPK------------------ 280
            L+  LS N                    F+G     L Q P                   
Sbjct: 529  LSGILSGNTLAFVRNVGNSCKGVGGLLEFAGIRPERLLQVPTLKSCDFTRLYSGAAVSGW 588

Query: 281  ---NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLW 451
                TL+ L L  N   G+IP  L +   L  L L+ N L+G IP+SLG L  L    + 
Sbjct: 589  TRYQTLEYLDLSYNSLDGEIPEELGDMVVLQVLDLARNNLTGEIPASLGRLRNLGVFDVS 648

Query: 452  LNMLEGEIPQELMYVKTLETLILDFNDL 535
             N L+G IP     +  L  + +  N+L
Sbjct: 649  RNRLQGGIPDSFSNLSFLVQIDVSDNNL 676

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 63/199 (31%), Positives = 79/199 (39%), Gaps = 43/199 (21%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLD--LSFN--------- 160
            SL   +P   G+CS L  L L+SN  +GE+P   L +  G   L   LS N         
Sbjct: 487  SLAGEIPRELGNCSSLMWLDLNSNRLTGEIPR-RLGRQLGSTPLSGILSGNTLAFVRNVG 545

Query: 161  ----------EFSGELPESLTNLSA----------------------SLLTLDLSSNNFS 244
                      EF+G  PE L  +                        +L  LDLS N+  
Sbjct: 546  NSCKGVGGLLEFAGIRPERLLQVPTLKSCDFTRLYSGAAVSGWTRYQTLEYLDLSYNSLD 605

Query: 245  GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
            G I   L       LQ L L  N  TG+IP +L     L    +S N L G IP S  +L
Sbjct: 606  GEIPEEL--GDMVVLQVLDLARNNLTGEIPASLGRLRNLGVFDVSRNRLQGGIPDSFSNL 663

Query: 425  SKLRDLKLWLNMLEGEIPQ 481
            S L  + +  N L GEIPQ
Sbjct: 664  SFLVQIDVSDNNLSGEIPQ 682

[45][TOP]
>UniRef100_UPI00019859B9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859B9
          Length = 1140

 Score =  117 bits (292), Expect = 7e-25
 Identities = 71/168 (42%), Positives = 98/168 (58%), Gaps = 2/168 (1%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P  F SCS L SL L +N  SG+     +  +  LK L + FN  +G +P SLTN +  L
Sbjct: 298 PLTFASCSSLVSLNLGNNRLSGDFLTMVISTLPSLKYLYVPFNNLTGSVPLSLTNCT-QL 356

Query: 212 LTLDLSSNNFSGPILPNLCQNP-KNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
             LDLSSN F+G   P  C +  ++ L+++ L +N  +G +P  L NC +L S+ LSFN 
Sbjct: 357 QVLDLSSNAFTGTFPPGFCSDASQSVLEKILLADNFLSGTVPLELGNCQKLRSIDLSFNN 416

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFN 529
           LSG IP  + +L  L DL +W N L GEIP+ + +    LETLIL+ N
Sbjct: 417 LSGPIPYEIWTLPNLSDLVMWANNLTGEIPEGICIKGGNLETLILNNN 464

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 70/218 (32%), Positives = 100/218 (45%), Gaps = 50/218 (22%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           PP   +C LLE+L LS N    ++P D L  +R L+ L L+ N F GE+P  L     +L
Sbjct: 224 PPSLRNCELLETLDLSHNVLEYKIPGDLLGNLRNLRWLSLAHNRFMGEIPPELAATCGTL 283

Query: 212 LTLDLSSNNFSG--PILPNLCQNPKN---------------------TLQELYLQNNGFT 322
             LDLS+NN SG  P+    C +  +                     +L+ LY+  N  T
Sbjct: 284 QGLDLSANNLSGGFPLTFASCSSLVSLNLGNNRLSGDFLTMVISTLPSLKYLYVPFNNLT 343

Query: 323 GKIPPTLSNCSELVSLHLSF---------------------------NYLSGTIPSSLGS 421
           G +P +L+NC++L  L LS                            N+LSGT+P  LG+
Sbjct: 344 GSVPLSLTNCTQLQVLDLSSNAFTGTFPPGFCSDASQSVLEKILLADNFLSGTVPLELGN 403

Query: 422 LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             KLR + L  N L G IP E+  +  L  L++  N+L
Sbjct: 404 CQKLRSIDLSFNNLSGPIPYEIWTLPNLSDLVMWANNL 441

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 65/169 (38%), Positives = 95/169 (56%), Gaps = 3/169 (1%)
 Frame = +2

Query: 32  PPFF---GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           PP F    S S+LE + L+ N  SG +P++ L   + L+ +DLSFN  SG +P  +  L 
Sbjct: 371 PPGFCSDASQSVLEKILLADNFLSGTVPLE-LGNCQKLRSIDLSFNNLSGPIPYEIWTLP 429

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
            +L  L + +NN +G I   +C    N L+ L L NN   G IP +L+NC+ L+ + L+ 
Sbjct: 430 -NLSDLVMWANNLTGEIPEGICIKGGN-LETLILNNNRINGTIPLSLANCTNLIWVSLAS 487

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           N L+G IP+ +G+L  L  L+L  N L G IP EL   + L  L L+ N
Sbjct: 488 NQLTGEIPAGIGNLHNLAVLQLGNNTLNGRIPSELGKCQNLIWLDLNSN 536

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 68/169 (40%), Positives = 86/169 (50%), Gaps = 3/169 (1%)
 Frame = +2

Query: 38  FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 217
           F  +C  L    LS N  + +L   +L   + L  LDLS+N  SGE+P   ++   SL  
Sbjct: 127 FLSNCQNLNLFNLSDNKLAAKLSASSLSPCKNLSTLDLSYNLLSGEMPVGHSS-PPSLRL 185

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG-KIPPTLSNCSELVSLHLSFNYLS 394
           LDLS NNFS   L ++       L  L L +N F+G   PP+L NC  L +L LS N L 
Sbjct: 186 LDLSHNNFSAK-LSSIEFGECGNLTVLDLSHNDFSGTDFPPSLRNCELLETLDLSHNVLE 244

Query: 395 GTIPSS-LGSLSKLRDLKLWLNMLEGEIPQELMYV-KTLETLILDFNDL 535
             IP   LG+L  LR L L  N   GEIP EL     TL+ L L  N+L
Sbjct: 245 YKIPGDLLGNLRNLRWLSLAHNRFMGEIPPELAATCGTLQGLDLSANNL 293

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 69/172 (40%), Positives = 89/172 (51%), Gaps = 3/172 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG-ELPESLTNLSA 205
           +P    S   L  L LS NNFS +L      +   L VLDLS N+FSG + P SL N   
Sbjct: 173 MPVGHSSPPSLRLLDLSHNNFSAKLSSIEFGECGNLTVLDLSHNDFSGTDFPPSLRNCEL 232

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL-SNCSELVSLHLSF 382
            L TLDLS N     I  +L  N +N L+ L L +N F G+IPP L + C  L  L LS 
Sbjct: 233 -LETLDLSHNVLEYKIPGDLLGNLRN-LRWLSLAHNRFMGEIPPELAATCGTLQGLDLSA 290

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGE-IPQELMYVKTLETLILDFNDL 535
           N LSG  P +  S S L  L L  N L G+ +   +  + +L+ L + FN+L
Sbjct: 291 NNLSGGFPLTFASCSSLVSLNLGNNRLSGDFLTMVISTLPSLKYLYVPFNNL 342

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 60/162 (37%), Positives = 82/162 (50%), Gaps = 2/162 (1%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           FLS  +PL    G+C  L S+ LS NN SG +P + +  +  L  L +  N  +GE+PE 
Sbjct: 392 FLSGTVPLE--LGNCQKLRSIDLSFNNLSGPIPYE-IWTLPNLSDLVMWANNLTGEIPEG 448

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL 361
           +     +L TL L++N  +G I  +L  C N    L  + L +N  TG+IP  + N   L
Sbjct: 449 ICIKGGNLETLILNNNRINGTIPLSLANCTN----LIWVSLASNQLTGEIPAGIGNLHNL 504

Query: 362 VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
             L L  N L+G IPS LG    L  L L  N   G +P EL
Sbjct: 505 AVLQLGNNTLNGRIPSELGKCQNLIWLDLNSNGFSGSVPSEL 546

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 47/138 (34%), Positives = 72/138 (52%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F +L  P+P    +   L  L + +NN +GE+P    +K   L+ L L+ N  +G +P S
Sbjct: 414 FNNLSGPIPYEIWTLPNLSDLVMWANNLTGEIPEGICIKGGNLETLILNNNRINGTIPLS 473

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           L N + +L+ + L+SN  +G I   +     + L  L L NN   G+IP  L  C  L+ 
Sbjct: 474 LANCT-NLIWVSLASNQLTGEIPAGI--GNLHNLAVLQLGNNTLNGRIPSELGKCQNLIW 530

Query: 368 LHLSFNYLSGTIPSSLGS 421
           L L+ N  SG++PS L S
Sbjct: 531 LDLNSNGFSGSVPSELAS 548

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 61/211 (28%), Positives = 92/211 (43%), Gaps = 42/211 (19%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    +C+ L  ++L+SN  +GE+P   +  +  L VL L  N  +G +P  L     +
Sbjct: 470  IPLSLANCTNLIWVSLASNQLTGEIPAG-IGNLHNLAVLQLGNNTLNGRIPSELGKCQ-N 527

Query: 209  LLTLDLSSNNFSGPILPNLCQNPK-------NTLQELYLQNNG----------------- 316
            L+ LDL+SN FSG +   L            +  Q  +++N G                 
Sbjct: 528  LIWLDLNSNGFSGSVPSELASEAGLVTPGLVSGKQFAFVRNEGGTACRGAGGLVEFEGIR 587

Query: 317  ------------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 442
                              ++G    T S+   ++ L LS+N LSGTIP S GSL+ L+ L
Sbjct: 588  SERLASFPMVHSCPSTRIYSGVTVYTFSSNGSMIYLDLSYNSLSGTIPQSFGSLNYLQVL 647

Query: 443  KLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  N L G IP  L  +K +  L L  N+L
Sbjct: 648  NLGHNQLTGNIPDSLGGLKAIGVLDLSHNNL 678

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 34/80 (42%), Positives = 49/80 (61%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P  FGS + L+ L L  N  +G +P D+L  ++ + VLDLS N   G +P +L 
Sbjct: 629 SLSGTIPQSFGSLNYLQVLNLGHNQLTGNIP-DSLGGLKAIGVLDLSHNNLQGYIPGALG 687

Query: 194 NLSASLLTLDLSSNNFSGPI 253
           +LS  L  LD+S+NN +GPI
Sbjct: 688 SLSF-LSDLDVSNNNLTGPI 706

 Score = 53.5 bits (127), Expect = 9e-06
 Identities = 56/164 (34%), Positives = 73/164 (44%), Gaps = 8/164 (4%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS-GELPESLTNLSASLLTLDLSSNN- 238
           +L L++    G L +  LL +  L+ +    N FS G+L  S    S  L TLDLS+NN 
Sbjct: 60  ALDLTNAGLVGSLQLSRLLALENLRHVHFHGNHFSEGDLSRSYRG-SCKLETLDLSANNL 118

Query: 239 ----FSGPILPNLCQNPKNTLQELYLQNNGFTGKI-PPTLSNCSELVSLHLSFNYLSGTI 403
               F    L N CQN    L    L +N    K+   +LS C  L +L LS+N LSG +
Sbjct: 119 TDSAFVDHFLSN-CQN----LNLFNLSDNKLAAKLSASSLSPCKNLSTLDLSYNLLSGEM 173

Query: 404 PSSLGSLSKLRDLKLWLNMLEGEIPQ-ELMYVKTLETLILDFND 532
           P    S   LR L L  N    ++   E      L  L L  ND
Sbjct: 174 PVGHSSPPSLRLLDLSHNNFSAKLSSIEFGECGNLTVLDLSHND 217

[46][TOP]
>UniRef100_B9ST85 Serine/threonine-protein kinase bri1, putative n=1 Tax=Ricinus
           communis RepID=B9ST85_RICCO
          Length = 1079

 Score =  116 bits (291), Expect = 9e-25
 Identities = 72/169 (42%), Positives = 97/169 (57%), Gaps = 2/169 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP  F SCS L SL L +N  SG+     +  ++ LK L + FN  +G +P SLTN +  
Sbjct: 233 LPMNFLSCSSLRSLNLGNNMLSGDFLTTVVSNLQNLKFLYVPFNNITGPVPLSLTNCT-Q 291

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNT-LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           L  LDLSSN F+G +    C   K+T L ++ L NN  +GK+P  L +C  L  + LSFN
Sbjct: 292 LEVLDLSSNGFTGNVPSIFCSPSKSTQLHKMLLANNYLSGKVPSELGSCKNLRRIDLSFN 351

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV-KTLETLILDFN 529
            L+G IP  + +L  L DL +W N L GEIP+ +      LETLIL+ N
Sbjct: 352 NLNGPIPPEIWTLPNLSDLVMWANNLTGEIPEGICRKGGNLETLILNNN 400

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 66/202 (32%), Positives = 104/202 (51%), Gaps = 26/202 (12%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPM-------------------------- 109
           F ++  P+P    +C+ LE L LSSN F+G +P                           
Sbjct: 275 FNNITGPVPLSLTNCTQLEVLDLSSNGFTGNVPSIFCSPSKSTQLHKMLLANNYLSGKVP 334

Query: 110 DTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTL 289
             L   + L+ +DLSFN  +G +P  +  L  +L  L + +NN +G I   +C+   N L
Sbjct: 335 SELGSCKNLRRIDLSFNNLNGPIPPEIWTLP-NLSDLVMWANNLTGEIPEGICRKGGN-L 392

Query: 290 QELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEG 469
           + L L NN  TG +P ++ +C+ ++ + +S N L+G IPSS+G+L  L  L++  N L G
Sbjct: 393 ETLILNNNLLTGSLPQSIGSCTGMIWISVSSNQLTGEIPSSIGNLVNLAILQMGNNSLSG 452

Query: 470 EIPQELMYVKTLETLILDFNDL 535
           +IP EL   ++L  L L+ NDL
Sbjct: 453 QIPPELGKCRSLIWLDLNSNDL 474

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 60/166 (36%), Positives = 90/166 (54%), Gaps = 3/166 (1%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +C  L+ L LS+N  +G LPM+  L    L+ L+L  N  SG+   ++ +   +L  L +
Sbjct: 215 ACGSLQELDLSANKLTGGLPMN-FLSCSSLRSLNLGNNMLSGDFLTTVVSNLQNLKFLYV 273

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH---LSFNYLSG 397
             NN +GP+  +L    +  L+ L L +NGFTG +P    + S+   LH   L+ NYLSG
Sbjct: 274 PFNNITGPVPLSLTNCTQ--LEVLDLSSNGFTGNVPSIFCSPSKSTQLHKMLLANNYLSG 331

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +PS LGS   LR + L  N L G IP E+  +  L  L++  N+L
Sbjct: 332 KVPSELGSCKNLRRIDLSFNNLNGPIPPEIWTLPNLSDLVMWANNL 377

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 49/142 (34%), Positives = 77/142 (54%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F +L  P+PP   +   L  L + +NN +GE+P     K   L+ L L+ N  +G LP+S
Sbjct: 350 FNNLNGPIPPEIWTLPNLSDLVMWANNLTGEIPEGICRKGGNLETLILNNNLLTGSLPQS 409

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           + + +  ++ + +SSN  +G I P+   N  N L  L + NN  +G+IPP L  C  L+ 
Sbjct: 410 IGSCTG-MIWISVSSNQLTGEI-PSSIGNLVN-LAILQMGNNSLSGQIPPELGKCRSLIW 466

Query: 368 LHLSFNYLSGTIPSSLGSLSKL 433
           L L+ N LSG++P  L   + L
Sbjct: 467 LDLNSNDLSGSLPPELADQTGL 488

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 49/153 (32%), Positives = 76/153 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GSC  L  + LS NN +G +P + +  +  L  L +  N  +GE+PE +     +
Sbjct: 333 VPSELGSCKNLRRIDLSFNNLNGPIPPE-IWTLPNLSDLVMWANNLTGEIPEGICRKGGN 391

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TL L++N  +G +  ++       +  + + +N  TG+IP ++ N   L  L +  N 
Sbjct: 392 LETLILNNNLLTGSLPQSI--GSCTGMIWISVSSNQLTGEIPSSIGNLVNLAILQMGNNS 449

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           LSG IP  LG    L  L L  N L G +P EL
Sbjct: 450 LSGQIPPELGKCRSLIWLDLNSNDLSGSLPPEL 482

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 66/198 (33%), Positives = 83/198 (41%), Gaps = 43/198 (21%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDL-------------- 151
            SL   +PP  G C  L  L L+SN+ SG LP + L    GL +  +              
Sbjct: 449  SLSGQIPPELGKCRSLIWLDLNSNDLSGSLPPE-LADQTGLIIPGIVSGKQFAFVRNEGG 507

Query: 152  -------SFNEFSGELPESLTNL----------------------SASLLTLDLSSNNFS 244
                      EF G   E L N                       + S++ LDLS N+ S
Sbjct: 508  TSCRGAGGLVEFEGIRAERLENFPMVHSCPTTRIYSGRTVYTFTSNGSMIYLDLSYNSLS 567

Query: 245  GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
            G I  N      + LQ L L +N  TG IP +     E+  L LS N L G+IPSSLG+L
Sbjct: 568  GTIPENF--GLMSYLQVLNLGHNKLTGIIPDSFGGLKEIGVLDLSHNDLKGSIPSSLGTL 625

Query: 425  SKLRDLKLWLNMLEGEIP 478
            S L DL +  N L G IP
Sbjct: 626  SFLSDLDVSNNNLSGLIP 643

[47][TOP]
>UniRef100_A2XR00 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2XR00_ORYSI
          Length = 863

 Score =  116 bits (291), Expect = 9e-25
 Identities = 75/174 (43%), Positives = 105/174 (60%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SLE  +P  FG+   L++L L+SN  +G +P   L     L+ +DL  N  +G +PESL 
Sbjct: 136 SLEGSIPSAFGNLPKLQTLVLASNRLTGGIP-PFLGSSFSLRYVDLGNNFLTGSIPESLA 194

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N S+SL  L L SN+ SG +  +L  +  ++L E++LQ N F G IP   +  S +  L 
Sbjct: 195 N-SSSLQVLMLMSNSLSGELPKSLFNS--SSLIEIFLQQNSFVGSIPDVTAKSSPIKYLS 251

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N +SGTIPSSLG+ S L  L L  N LEG+IP+ L +++TLE LIL  N+L
Sbjct: 252 LRNNNISGTIPSSLGNFSSLLTLNLAENNLEGDIPESLGHIQTLERLILYVNNL 305

 Score =  100 bits (250), Expect = 5e-20
 Identities = 65/169 (38%), Positives = 98/169 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PPF GS   L  + L +N  +G +P ++L     L+VL L  N  SGELP+SL N S+S
Sbjct: 165 IPPFLGSSFSLRYVDLGNNFLTGSIP-ESLANSSSLQVLMLMSNSLSGELPKSLFN-SSS 222

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ + L  N+F G I P++     + ++ L L+NN  +G IP +L N S L++L+L+ N 
Sbjct: 223 LIEIFLQQNSFVGSI-PDVTAK-SSPIKYLSLRNNNISGTIPSSLGNFSSLLTLNLAENN 280

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IP SLG +  L  L L++N L G +P  +  + +L  L +  N L
Sbjct: 281 LEGDIPESLGHIQTLERLILYVNNLSGLVPLSIFNLSSLTFLSMGNNSL 329

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 66/169 (39%), Positives = 86/169 (50%), Gaps = 2/169 (1%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           PFFGS   LE L +S N    +    M +L     L  L L  N F G LP S+ NLS +
Sbjct: 383 PFFGSLPNLEQLDVSYNKLEPDDWGFMTSLSNCSKLTQLMLDGNSFQGNLPSSIGNLSNN 442

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L +N F GPI P +      +L+ L++  N FTG IP T+ N + L+ L  + N 
Sbjct: 443 LEGLWLRNNKFHGPIPPEI--GSLKSLRRLFMDYNLFTGNIPQTIGNLNNLIVLSFAQNK 500

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP   G+L +L D+KL  N   G IP  +     L+ L L  N L
Sbjct: 501 LSGHIPDVFGNLVQLTDIKLDGNNFSGGIPSSIGQCTQLQILNLAHNSL 549

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 56/168 (33%), Positives = 91/168 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG+   L  + L  NNFSG +P  ++ +   L++L+L+ N   G +P ++  +++ 
Sbjct: 505 IPDVFGNLVQLTDIKLDGNNFSGGIP-SSIGQCTQLQILNLAHNSLDGNIPSTIFKITSI 563

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              +DLS N  SG I P+   N  N L +L + NN  +GKIP +L  C  L  L +  N+
Sbjct: 564 SQEMDLSHNYLSGGI-PDEVGNLIN-LNKLRISNNMLSGKIPFSLGQCVALEYLEIQSNF 621

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             G IP S  +L  ++ + +  N L G+IP+ L  + +L  L L FN+
Sbjct: 622 FIGGIPQSFVNLVSMKKMDISWNNLSGKIPEFLKSLSSLHDLNLSFNN 669

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 57/151 (37%), Positives = 84/151 (55%), Gaps = 1/151 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGL-KVLDLSFNEFSGELPESLTNLSA 205
           +P   G C+ L+ L L+ N+  G +P  T+ K+  + + +DLS N  SG +P+ + NL  
Sbjct: 529 IPSSIGQCTQLQILNLAHNSLDGNIP-STIFKITSISQEMDLSHNYLSGGIPDEVGNL-I 586

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L +S+N  SG I  +L Q     L+ L +Q+N F G IP +  N   +  + +S+N
Sbjct: 587 NLNKLRISNNMLSGKIPFSLGQCV--ALEYLEIQSNFFIGGIPQSFVNLVSMKKMDISWN 644

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LSG IP  L SLS L DL L  N  +G IP
Sbjct: 645 NLSGKIPEFLKSLSSLHDLNLSFNNFDGVIP 675

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 61/193 (31%), Positives = 92/193 (47%), Gaps = 23/193 (11%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+PP  GS   L  L +  N F+G +P  T+  +  L VL  + N+ SG +P+   NL  
Sbjct: 456  PIPPEIGSLKSLRRLFMDYNLFTGNIPQ-TIGNLNNLIVLSFAQNKLSGHIPDVFGNL-V 513

Query: 206  SLLTLDLSSNNFSGPILPNLCQ----------------NPKNTL-------QELYLQNNG 316
             L  + L  NNFSG I  ++ Q                N  +T+       QE+ L +N 
Sbjct: 514  QLTDIKLDGNNFSGGIPSSIGQCTQLQILNLAHNSLDGNIPSTIFKITSISQEMDLSHNY 573

Query: 317  FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
             +G IP  + N   L  L +S N LSG IP SLG    L  L++  N   G IPQ  + +
Sbjct: 574  LSGGIPDEVGNLINLNKLRISNNMLSGKIPFSLGQCVALEYLEIQSNFFIGGIPQSFVNL 633

Query: 497  KTLETLILDFNDL 535
             +++ + + +N+L
Sbjct: 634  VSMKKMDISWNNL 646

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 56/160 (35%), Positives = 85/160 (53%), Gaps = 2/160 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS--ASLLTLDLSS 232
           LE L L +N+F+G +P    L    L+ LD+S+N+   +    +T+LS  + L  L L  
Sbjct: 368 LEMLYLGNNSFTGIVPFFGSLP--NLEQLDVSYNKLEPDDWGFMTSLSNCSKLTQLMLDG 425

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           N+F G  LP+   N  N L+ L+L+NN F G IPP + +   L  L + +N  +G IP +
Sbjct: 426 NSFQGN-LPSSIGNLSNNLEGLWLRNNKFHGPIPPEIGSLKSLRRLFMDYNLFTGNIPQT 484

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           +G+L+ L  L    N L G IP     +  L  + LD N+
Sbjct: 485 IGNLNNLIVLSFAQNKLSGHIPDVFGNLVQLTDIKLDGNN 524

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 67/218 (30%), Positives = 95/218 (43%), Gaps = 51/218 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L +L L+ NN  G++P ++L  ++ L+ L L  N  SG +P S+ NLS S
Sbjct: 261 IPSSLGNFSSLLTLNLAENNLEGDIP-ESLGHIQTLERLILYVNNLSGLVPLSIFNLS-S 318

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP------------------ 334
           L  L + +N+  G  LPN        +Q L L  N F G+IP                  
Sbjct: 319 LTFLSMGNNSLMGR-LPNDIGYTLPKIQGLILSTNMFVGQIPASLLNAYHLEMLYLGNNS 377

Query: 335 --------------------------------PTLSNCSELVSLHLSFNYLSGTIPSSLG 418
                                            +LSNCS+L  L L  N   G +PSS+G
Sbjct: 378 FTGIVPFFGSLPNLEQLDVSYNKLEPDDWGFMTSLSNCSKLTQLMLDGNSFQGNLPSSIG 437

Query: 419 SLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           +LS  L  L L  N   G IP E+  +K+L  L +D+N
Sbjct: 438 NLSNNLEGLWLRNNKFHGPIPPEIGSLKSLRRLFMDYN 475

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 49/131 (37%), Positives = 67/131 (51%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           +DL+    +G +   + NL+ SL TL LS N+F G I   L     + L+ L L  N   
Sbjct: 82  IDLASEGITGTISPCIANLT-SLTTLQLSDNSFHGSIPSKL--GHLSELRNLNLSMNSLE 138

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G IP    N  +L +L L+ N L+G IP  LGS   LR + L  N L G IP+ L    +
Sbjct: 139 GSIPSAFGNLPKLQTLVLASNRLTGGIPPFLGSSFSLRYVDLGNNFLTGSIPESLANSSS 198

Query: 503 LETLILDFNDL 535
           L+ L+L  N L
Sbjct: 199 LQVLMLMSNSL 209

[48][TOP]
>UniRef100_A7Q3Q3 Chromosome chr13 scaffold_48, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7Q3Q3_VITVI
          Length = 858

 Score =  116 bits (290), Expect = 1e-24
 Identities = 71/169 (42%), Positives = 98/169 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  GSC LL+++ LS+N+ SG +P D+L        L+LSFN FSG +P SLT  S+S
Sbjct: 191 IPPSIGSCPLLQTVDLSNNSLSGTIP-DSLFNSTKFYRLNLSFNSFSGSIPVSLTR-SSS 248

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  NN SGPI PN        LQ L L +N F+G +P +L   SEL  + LS N 
Sbjct: 249 LTFLALQHNNLSGPI-PNSWGKSLFRLQSLALDHNFFSGSMPTSLGKLSELQKVSLSHNQ 307

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++G IP  +G LS+L+ +    N + G +P  L  + +L  L L+ N L
Sbjct: 308 ITGAIPDEIGRLSRLKTVDFSSNAINGSLPISLSNLSSLLVLNLENNGL 356

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 59/150 (39%), Positives = 83/150 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G  S L+ ++LS N  +G +P D + ++  LK +D S N  +G LP SL+NLS S
Sbjct: 288 MPTSLGKLSELQKVSLSHNQITGAIP-DEIGRLSRLKTVDFSSNAINGSLPISLSNLS-S 345

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           LL L+L +N     I P+  +  +N L  L L+ N F G IP ++ N S L  L LS N 
Sbjct: 346 LLVLNLENNGLDSQI-PDAFEKLQN-LSVLNLRRNRFNGPIPGSIGNASALTQLDLSQNN 403

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           L+G IPSS+  L  L    +  N L G +P
Sbjct: 404 LTGDIPSSIADLPNLNSFNVSYNNLSGSVP 433

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 62/175 (35%), Positives = 95/175 (54%), Gaps = 1/175 (0%)
 Frame = +2

Query: 14  SLELPLPPFFG-SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           +L  P+P  +G S   L+SLAL  N FSG +P  +L K+  L+ + LS N+ +G +P+ +
Sbjct: 258 NLSGPIPNSWGKSLFRLQSLALDHNFFSGSMPT-SLGKLSELQKVSLSHNQITGAIPDEI 316

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
             LS  L T+D SSN  +G +  +L     ++L  L L+NNG   +IP        L  L
Sbjct: 317 GRLSR-LKTVDFSSNAINGSLPISLSN--LSSLLVLNLENNGLDSQIPDAFEKLQNLSVL 373

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +L  N  +G IP S+G+ S L  L L  N L G+IP  +  +  L +  + +N+L
Sbjct: 374 NLRRNRFNGPIPGSIGNASALTQLDLSQNNLTGDIPSSIADLPNLNSFNVSYNNL 428

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 59/167 (35%), Positives = 86/167 (51%), Gaps = 3/167 (1%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 217
           G    L  L+L  N   G +P  +  L  +RG+++ +   N FSG +P S+ +    L T
Sbjct: 148 GQLQALRKLSLHDNFIGGSIPSALGFLPNLRGVQLFN---NRFSGSIPPSIGSCPL-LQT 203

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
           +DLS+N+ SG I  +L  + K     L L  N F+G IP +L+  S L  L L  N LSG
Sbjct: 204 VDLSNNSLSGTIPDSLFNSTK--FYRLNLSFNSFSGSIPVSLTRSSSLTFLALQHNNLSG 261

Query: 398 TIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            IP+S G SL +L+ L L  N   G +P  L  +  L+ + L  N +
Sbjct: 262 PIPNSWGKSLFRLQSLALDHNFFSGSMPTSLGKLSELQKVSLSHNQI 308

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 49/132 (37%), Positives = 65/132 (49%)
 Frame = +2

Query: 140 VLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
           V+ L +    G + E +  L A L  L L  N   G I   L   P   L+ + L NN F
Sbjct: 131 VIQLPWKGLGGRISEKIGQLQA-LRKLSLHDNFIGGSIPSALGFLPN--LRGVQLFNNRF 187

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           +G IPP++ +C  L ++ LS N LSGTIP SL + +K   L L  N   G IP  L    
Sbjct: 188 SGSIPPSIGSCPLLQTVDLSNNSLSGTIPDSLFNSTKFYRLNLSFNSFSGSIPVSLTRSS 247

Query: 500 TLETLILDFNDL 535
           +L  L L  N+L
Sbjct: 248 SLTFLALQHNNL 259

[49][TOP]
>UniRef100_A5BQC8 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BQC8_VITVI
          Length = 562

 Score =  116 bits (290), Expect = 1e-24
 Identities = 70/179 (39%), Positives = 104/179 (58%), Gaps = 3/179 (1%)
 Frame = +2

Query: 2   SLFL---SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SLFL   S    +P  FG+ S+LE+L L  N+  G +P + + K+  LK+L++  N+  G
Sbjct: 257 SLFLGNDSFTGTIPLSFGNMSMLETLGLGGNHLQGNIP-EEIAKLSNLKILEIQSNQLVG 315

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
            +P ++ N+S SL  + L+ N+ SG I  ++C +  + L+ + L  N F G IP  LS C
Sbjct: 316 AIPLAIFNIS-SLQEIALTYNSLSGDIPSSMCNHDLSALRGIRLSGNQFIGPIPSNLSKC 374

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            EL  L  +FN  +G  P S+GSL+KL  L L  N L G IP+EL ++ +LE L L  N
Sbjct: 375 GELQILSSAFNKFTGGSPRSIGSLTKLTMLSLAANSLSGTIPEELSFLPSLEYLYLRSN 433

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 59/175 (33%), Positives = 87/175 (49%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           L L   +PP  G+ S L SL LS NNF   +P++ + ++  L+  +L +N FSG++P S 
Sbjct: 191 LGLRGTIPPDLGNLSFLVSLDLSRNNFHCPVPVE-VDQLTSLQSSNLQYNLFSGQIPPSF 249

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            NL                           N LQ L+L N+ FTG IP +  N S L +L
Sbjct: 250 GNL---------------------------NRLQSLFLGNDSFTGTIPLSFGNMSMLETL 282

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N+L G IP  +  LS L+ L++  N L G IP  +  + +L+ + L +N L
Sbjct: 283 GLGGNHLQGNIPEEIAKLSNLKILEIQSNQLVGAIPLAIFNISSLQEIALTYNSL 337

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 59/177 (33%), Positives = 90/177 (50%), Gaps = 2/177 (1%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           LS ++P        S L  + LS N F G +P + L K   L++L  +FN+F+G  P S+
Sbjct: 337 LSGDIPSSMCNHDLSALRGIRLSGNQFIGPIPSN-LSKCGELQILSSAFNKFTGGSPRSI 395

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            +L+  L  L L++N+ SG I   L   P  +L+ LYL++N FT  IP  + N S L  +
Sbjct: 396 GSLT-KLTMLSLAANSLSGTIPEELSFLP--SLEYLYLRSNSFTNPIPSAIFNISTLKEI 452

Query: 371 HLSFNYLSGTIPSSL--GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N  SG++P  +       L+ + L+ N+  G I   +    +L  L L  NDL
Sbjct: 453 DLGKNGFSGSMPLDIMCAHSPSLQLIGLYNNIFTGTIHGGIANCTSLRELYLSGNDL 509

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 43/121 (35%), Positives = 69/121 (57%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P   GS + L  L+L++N+ SG +P + L  +  L+ L L  N F+  +P ++ N+S +L
Sbjct: 392 PRSIGSLTKLTMLSLAANSLSGTIP-EELSFLPSLEYLYLRSNSFTNPIPSAIFNIS-TL 449

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             +DL  N FSG +  ++      +LQ + L NN FTG I   ++NC+ L  L+LS N L
Sbjct: 450 KEIDLGKNGFSGSMPLDIMCAHSPSLQLIGLYNNIFTGTIHGGIANCTSLRELYLSGNDL 509

Query: 392 S 394
           +
Sbjct: 510 T 510

[50][TOP]
>UniRef100_C5X896 Putative uncharacterized protein Sb02g019470 n=1 Tax=Sorghum
           bicolor RepID=C5X896_SORBI
          Length = 1214

 Score =  115 bits (289), Expect = 2e-24
 Identities = 70/170 (41%), Positives = 94/170 (55%), Gaps = 2/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP  F  C  LE L LS N  SG      +  +  L+ L LSFN  +G+ P  +      
Sbjct: 370 LPASFAKCRSLEVLDLSGNQLSGSFVDSVVSTISSLRELRLSFNNITGQNPLPVLAAGCP 429

Query: 209 LL-TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           LL  +DL SN   G I+ +LC +  + L++L+L NN   G +P +L NC+ L S+ LSFN
Sbjct: 430 LLEVIDLGSNELDGEIMEDLCSSLPS-LRKLFLPNNYLKGTVPKSLGNCANLESIDLSFN 488

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFND 532
           +L G IP  +  L KL DL +W N L GEIP  L     TLETL+L +N+
Sbjct: 489 FLVGQIPKEIILLPKLIDLVMWANGLSGEIPDMLCSNGTTLETLVLSYNN 538

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 64/178 (35%), Positives = 85/178 (47%), Gaps = 24/178 (13%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           PLP     C LLE + L SN   GE+  D    +  L+ L L  N   G +P+SL N  A
Sbjct: 420 PLPVLAAGCPLLEVIDLGSNELDGEIMEDLCSSLPSLRKLFLPNNYLKGTVPKSLGNC-A 478

Query: 206 SLLTLDLS------------------------SNNFSGPILPNLCQNPKNTLQELYLQNN 313
           +L ++DLS                        +N  SG I   LC N   TL+ L L  N
Sbjct: 479 NLESIDLSFNFLVGQIPKEIILLPKLIDLVMWANGLSGEIPDMLCSNG-TTLETLVLSYN 537

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            FTG IPP+++ C  L+ +  S N+L G++P   G L KL  L+L  N L G +P EL
Sbjct: 538 NFTGGIPPSITRCVNLIWVSFSGNHLIGSVPHGFGKLQKLAILQLNKNQLSGPVPAEL 595

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 69/201 (34%), Positives = 98/201 (48%), Gaps = 31/201 (15%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMD------------------------TLLKMRG 133
           P+P F    S L+ LAL+ N FSG +P +                        +  K R 
Sbjct: 320 PIPTFLTGFSSLKRLALAGNEFSGTIPDELSQLCGRIVELDLSSNRLVGGLPASFAKCRS 379

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG----PILPNLCQNPKNTLQELY 301
           L+VLDLS N+ SG   +S+ +  +SL  L LS NN +G    P+L   C      L+ + 
Sbjct: 380 LEVLDLSGNQLSGSFVDSVVSTISSLRELRLSFNNITGQNPLPVLAAGCP----LLEVID 435

Query: 302 LQNNGFTGKIPPTLSNCSELVSLHLSF---NYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 472
           L +N   G+I   L  CS L SL   F   NYL GT+P SLG+ + L  + L  N L G+
Sbjct: 436 LGSNELDGEIMEDL--CSSLPSLRKLFLPNNYLKGTVPKSLGNCANLESIDLSFNFLVGQ 493

Query: 473 IPQELMYVKTLETLILDFNDL 535
           IP+E++ +  L  L++  N L
Sbjct: 494 IPKEIILLPKLIDLVMWANGL 514

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 58/157 (36%), Positives = 81/157 (51%), Gaps = 4/157 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF--NEFSGELPESLTNLS 202
           +P   G+C+ LES+ LS N   G++P + +L     K++DL    N  SGE+P+ L +  
Sbjct: 470 VPKSLGNCANLESIDLSFNFLVGQIPKEIILLP---KLIDLVMWANGLSGEIPDMLCSNG 526

Query: 203 ASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            +L TL LS NNF+G I P++  C N    L  +    N   G +P       +L  L L
Sbjct: 527 TTLETLVLSYNNFTGGIPPSITRCVN----LIWVSFSGNHLIGSVPHGFGKLQKLAILQL 582

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           + N LSG +P+ LGS   L  L L  N   G IP EL
Sbjct: 583 NKNQLSGPVPAELGSCINLIWLDLNSNSFTGIIPPEL 619

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 59/162 (36%), Positives = 79/162 (48%), Gaps = 3/162 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF-SGELPESLTNLSASLLTLDLSSN 235
           L  L+++ NNFSG++          L VLD SFN   S ELP SL N    L  LD+S N
Sbjct: 256 LTHLSIAGNNFSGDVSAYDFGGCANLTVLDWSFNGLSSSELPPSLAN-CGRLEMLDVSGN 314

Query: 236 NFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYLSGTIPSS 412
              G  +P       ++L+ L L  N F+G IP  LS  C  +V L LS N L G +P+S
Sbjct: 315 KLLGGPIPTFLTG-FSSLKRLALAGNEFSGTIPDELSQLCGRIVELDLSSNRLVGGLPAS 373

Query: 413 LGSLSKLRDLKLWLNMLEGE-IPQELMYVKTLETLILDFNDL 535
                 L  L L  N L G  +   +  + +L  L L FN++
Sbjct: 374 FAKCRSLEVLDLSGNQLSGSFVDSVVSTISSLRELRLSFNNI 415

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 47/145 (32%), Positives = 75/145 (51%), Gaps = 3/145 (2%)
 Frame = +2

Query: 50  CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF-SGELPESLTNLSASLLTLDL 226
           C+L+E + +SSN F+G LP   L     L+ L+LS N    G  P      + SL +LDL
Sbjct: 133 CALVE-VDMSSNTFNGTLPAAFLATCGALQSLNLSRNALVGGGFP-----FAPSLRSLDL 186

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
           S N+ +   L N      + L+ L L  N F G++P  L+ CS +  L +S+N++SG +P
Sbjct: 187 SRNHLADVGLLNYSFAGCHGLRYLNLSANQFVGRLPE-LATCSAVSVLDVSWNHMSGALP 245

Query: 407 SSLGSLS--KLRDLKLWLNMLEGEI 475
           +   + +   L  L +  N   G++
Sbjct: 246 AGFMAAAPPNLTHLSIAGNNFSGDV 270

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 53/152 (34%), Positives = 69/152 (45%), Gaps = 5/152 (3%)
 Frame = +2

Query: 95  GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS---LLTLDLSSNNFSGPILPNL 265
           GEL +D LL +  L+ LDL  N F G L  +    SAS   L+ +D+SSN F+G  LP  
Sbjct: 94  GELRLDALLALPALQRLDLRGNAFYGNLSHAHAAASASPCALVEVDMSSNTFNG-TLPAA 152

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS--GTIPSSLGSLSKLRD 439
                  LQ L L  N   G   P       L SL LS N+L+  G +  S      LR 
Sbjct: 153 FLATCGALQSLNLSRNALVGGGFPF---APSLRSLDLSRNHLADVGLLNYSFAGCHGLRY 209

Query: 440 LKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L L  N   G +P EL     +  L + +N +
Sbjct: 210 LNLSANQFVGRLP-ELATCSAVSVLDVSWNHM 240

[51][TOP]
>UniRef100_B9GHZ0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GHZ0_POPTR
          Length = 1186

 Score =  115 bits (289), Expect = 2e-24
 Identities = 71/169 (42%), Positives = 99/169 (58%), Gaps = 2/169 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP  F SCS ++SL L +N  SG+     +  ++ L  L + FN  +G +P SL N +  
Sbjct: 341 LPLTFASCSSMQSLNLGNNLLSGDFLTTVVSNLQSLIYLYVPFNNITGTVPLSLANCT-H 399

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNT-LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           L  LDLSSN F+G +   LC +   T LQ+L L +N  +GK+P  L +C  L S+ LSFN
Sbjct: 400 LQVLDLSSNGFTGDVPSKLCSSSNPTALQKLLLADNYLSGKVPSELGSCKNLRSIDLSFN 459

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFN 529
            L+G IP  + +L  L DL +W N L GEIP+ + +    LETLIL+ N
Sbjct: 460 SLNGPIPLEVWTLPNLLDLVMWANNLTGEIPEGICVNGGNLETLILNNN 508

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 60/159 (37%), Positives = 95/159 (59%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L L+ N  SG++P + L   + L+ +DLSFN  +G +P  +  L  +LL L + +NN
Sbjct: 427 LQKLLLADNYLSGKVPSE-LGSCKNLRSIDLSFNSLNGPIPLEVWTLP-NLLDLVMWANN 484

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G I   +C N  N L+ L L NN  TG IP ++ NC+ ++ + LS N L+G IP+ +G
Sbjct: 485 LTGEIPEGICVNGGN-LETLILNNNLITGSIPQSIGNCTNMIWVSLSSNRLTGEIPAGVG 543

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +L  L  L++  N L G+IP E+   ++L  L L+ N+L
Sbjct: 544 NLVNLAVLQMGNNSLTGKIPPEIGNCRSLIWLDLNSNNL 582

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 72/200 (36%), Positives = 102/200 (51%), Gaps = 27/200 (13%)
 Frame = +2

Query: 17  LELPLPP-FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           L+L +P  F GS + L  L+L+ N F G++P++       L+ LDLS N+ +G LP +  
Sbjct: 287 LQLKIPGNFLGSFTNLRQLSLAHNLFYGDIPLELGQTCGTLQELDLSANKLTGGLPLTFA 346

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQN---------PKNT--------------LQELYL 304
           + S S+ +L+L +N  SG  L  +  N         P N               LQ L L
Sbjct: 347 SCS-SMQSLNLGNNLLSGDFLTTVVSNLQSLIYLYVPFNNITGTVPLSLANCTHLQVLDL 405

Query: 305 QNNGFTGKIPPTL---SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 475
            +NGFTG +P  L   SN + L  L L+ NYLSG +PS LGS   LR + L  N L G I
Sbjct: 406 SSNGFTGDVPSKLCSSSNPTALQKLLLADNYLSGKVPSELGSCKNLRSIDLSFNSLNGPI 465

Query: 476 PQELMYVKTLETLILDFNDL 535
           P E+  +  L  L++  N+L
Sbjct: 466 PLEVWTLPNLLDLVMWANNL 485

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 51/142 (35%), Positives = 76/142 (53%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F SL  P+P    +   L  L + +NN +GE+P    +    L+ L L+ N  +G +P+S
Sbjct: 458 FNSLNGPIPLEVWTLPNLLDLVMWANNLTGEIPEGICVNGGNLETLILNNNLITGSIPQS 517

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           + N + +++ + LSSN  +G I P    N  N L  L + NN  TGKIPP + NC  L+ 
Sbjct: 518 IGNCT-NMIWVSLSSNRLTGEI-PAGVGNLVN-LAVLQMGNNSLTGKIPPEIGNCRSLIW 574

Query: 368 LHLSFNYLSGTIPSSLGSLSKL 433
           L L+ N LSG +P  L   + L
Sbjct: 575 LDLNSNNLSGPLPPELADQAGL 596

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 59/191 (30%), Positives = 83/191 (43%), Gaps = 28/191 (14%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLL--KMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           +C  L  L  S N  +G+L +  L       LK LDLS N FS            +L  L
Sbjct: 196 TCQNLNLLNFSDNKLAGKLAVTPLSCNNSPSLKYLDLSHNNFSANFSSLDFGHYCNLTWL 255

Query: 221 DLSSNNFSGPILP------------NLCQN------PKN------TLQELYLQNNGFTGK 328
            LS N  SG   P            NL +N      P N       L++L L +N F G 
Sbjct: 256 SLSQNRLSGIGFPLSLRNCVLLQTLNLSRNELQLKIPGNFLGSFTNLRQLSLAHNLFYGD 315

Query: 329 IPPTL-SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE-IPQELMYVKT 502
           IP  L   C  L  L LS N L+G +P +  S S ++ L L  N+L G+ +   +  +++
Sbjct: 316 IPLELGQTCGTLQELDLSANKLTGGLPLTFASCSSMQSLNLGNNLLSGDFLTTVVSNLQS 375

Query: 503 LETLILDFNDL 535
           L  L + FN++
Sbjct: 376 LIYLYVPFNNI 386

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 46/114 (40%), Positives = 60/114 (52%), Gaps = 3/114 (2%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P  FGS S L+ L L  N  +G +P D+   ++ + VLDLS N+  G LP SL 
Sbjct: 673 SLSGTIPQNFGSMSYLQVLNLGHNKLTGNIP-DSFGGLKAIGVLDLSHNDLQGFLPGSLG 731

Query: 194 NLSASLLTLDLSSNNFSGPILP--NLCQNPKNTLQELYLQNNGFTG-KIPPTLS 346
            LS  L  LD+S+NN +GPI     L   P    Q  Y  N+G  G  +PP  S
Sbjct: 732 TLSF-LSDLDVSNNNLTGPIPSGGQLTTFP----QSRYENNSGLCGVPLPPCSS 780

 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 71/217 (32%), Positives = 89/217 (41%), Gaps = 54/217 (24%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMD-------------------------------------- 112
           S  +LESL LSSNN S  LP                                        
Sbjct: 123 SSCVLESLDLSSNNISDPLPRKSFFESCNHLSYVNLSHNSIPGGSLRFSPSLLQLDLSRN 182

Query: 113 ----------TLLKMRGLKVLDLSFNEFSGEL---PESLTNLSASLLTLDLSSNNFSGPI 253
                     +L   + L +L+ S N+ +G+L   P S  N S SL  LDLS NNFS   
Sbjct: 183 TISDSTWLAYSLSTCQNLNLLNFSDNKLAGKLAVTPLSCNN-SPSLKYLDLSHNNFSAN- 240

Query: 254 LPNLCQNPKNTLQELYLQNNGFTG-KIPPTLSNCSELVSLHLSFNYLSGTIPSS-LGSLS 427
             +L       L  L L  N  +G   P +L NC  L +L+LS N L   IP + LGS +
Sbjct: 241 FSSLDFGHYCNLTWLSLSQNRLSGIGFPLSLRNCVLLQTLNLSRNELQLKIPGNFLGSFT 300

Query: 428 KLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFNDL 535
            LR L L  N+  G+IP EL     TL+ L L  N L
Sbjct: 301 NLRQLSLAHNLFYGDIPLELGQTCGTLQELDLSANKL 337

[52][TOP]
>UniRef100_B9IBE4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IBE4_POPTR
          Length = 1199

 Score =  115 bits (288), Expect = 2e-24
 Identities = 72/174 (41%), Positives = 99/174 (56%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L   +PP  G C+ L  LAL+ N  SGELP+ +L  +  +  L LS N FSGE+  +L 
Sbjct: 326 ALNSTIPPELGLCTNLTYLALADNQLSGELPL-SLSNLSKIADLGLSENFFSGEISPALI 384

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           +    L +  + +NNFSG I P + Q     LQ L+L NN F+G IP  + N  EL SL 
Sbjct: 385 SNWTELTSFQVQNNNFSGNIPPEIGQ--LTMLQFLFLYNNSFSGSIPHEIGNLEELTSLD 442

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N LSG IP +L +L+ L  L L+ N + G IP E+  +  L+ L L+ N L
Sbjct: 443 LSGNQLSGPIPPTLWNLTNLETLNLFFNNINGTIPPEVGNMTALQILDLNTNQL 496

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 71/191 (37%), Positives = 96/191 (50%), Gaps = 22/191 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMR--------------------GLKV 142
           +P      + L+ L+L +NN +G +P  +  LLK+R                     L+ 
Sbjct: 139 IPVEISELTELQYLSLFNNNLNGTIPSQLSNLLKVRHLDLGANYLETPDWSKFSMPSLEY 198

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           L L FNE + E P+ +T+   +L  LDLS NNF+G I P L       L+ L L NN F 
Sbjct: 199 LSLFFNELTSEFPDFITS-CRNLTFLDLSLNNFTGQI-PELAYTNLGKLETLNLYNNLFQ 256

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G + P +S  S L SL L  N L G IP S+GS+S LR  +L+ N  +G IP  L  +K 
Sbjct: 257 GPLSPKISMLSNLKSLSLQTNLLGGQIPESIGSISGLRTAELFSNSFQGTIPSSLGKLKH 316

Query: 503 LETLILDFNDL 535
           LE L L  N L
Sbjct: 317 LEKLDLRMNAL 327

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 67/173 (38%), Positives = 95/173 (54%), Gaps = 4/173 (2%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG----ELPESLTN 196
            + P +G+C  L +L +  N  SGE+P + L K+  L +L L  N+ +G    E+P+ L +
Sbjct: 621  ISPDWGACENLTNLQMGRNRISGEIPAE-LGKLPRLGLLSLDSNDLTGRIPGEIPQGLGS 679

Query: 197  LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            L+  L +LDLS N  +G I   L    K  L  L L +N  +G+IP  L N +    L L
Sbjct: 680  LTR-LESLDLSDNKLTGNISKELGGYEK--LSSLDLSHNNLSGEIPFELGNLNLRYLLDL 736

Query: 377  SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            S N LSGTIPS+LG LS L +L +  N L G IP  L  + +L +    +NDL
Sbjct: 737  SSNSLSGTIPSNLGKLSMLENLNVSHNHLSGRIPDSLSTMISLHSFDFSYNDL 789

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 66/160 (41%), Positives = 85/160 (53%), Gaps = 1/160 (0%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE-SLTNLSASLLTLDLSSN 235
           LE L+L  N  + E P D +   R L  LDLS N F+G++PE + TNL   L TL+L +N
Sbjct: 196 LEYLSLFFNELTSEFP-DFITSCRNLTFLDLSLNNFTGQIPELAYTNLG-KLETLNLYNN 253

Query: 236 NFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
            F GP+ P +     + L+ L LQ N   G+IP ++ + S L +  L  N   GTIPSSL
Sbjct: 254 LFQGPLSPKISM--LSNLKSLSLQTNLLGGQIPESIGSISGLRTAELFSNSFQGTIPSSL 311

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G L  L  L L +N L   IP EL     L  L L  N L
Sbjct: 312 GKLKHLEKLDLRMNALNSTIPPELGLCTNLTYLALADNQL 351

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 64/200 (32%), Positives = 96/200 (48%), Gaps = 24/200 (12%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
            F ++   +PP  G+ + L+ L L++N   GELP +T+  +  L  ++L  N FSG +P +
Sbjct: 469  FNNINGTIPPEVGNMTALQILDLNTNQLHGELP-ETISNLTFLTSINLFGNNFSGSIPSN 527

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
                  SL+    S+N+FSG + P LC     +LQ+L + +N FTG +P  L NC  L  
Sbjct: 528  FGKNIPSLVYASFSNNSFSGELPPELCSG--LSLQQLTVNSNNFTGALPTCLRNCLGLTR 585

Query: 368  LHLSFNYLSGTIPSSLGSL------------------------SKLRDLKLWLNMLEGEI 475
            + L  N  +G I  + G L                          L +L++  N + GEI
Sbjct: 586  VRLEGNQFTGNITHAFGVLPNLVFVALNDNQFIGEISPDWGACENLTNLQMGRNRISGEI 645

Query: 476  PQELMYVKTLETLILDFNDL 535
            P EL  +  L  L LD NDL
Sbjct: 646  PAELGKLPRLGLLSLDSNDL 665

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 62/169 (36%), Positives = 96/169 (56%), Gaps = 1/169 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G  ++L+ L L +N+FSG +P + +  +  L  LDLS N+ SG +P +L NL+ +
Sbjct: 404 IPPEIGQLTMLQFLFLYNNSFSGSIPHE-IGNLEELTSLDLSGNQLSGPIPPTLWNLT-N 461

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TL+L  NN +G I P +       LQ L L  N   G++P T+SN + L S++L  N 
Sbjct: 462 LETLNLFFNNINGTIPPEV--GNMTALQILDLNTNQLHGELPETISNLTFLTSINLFGNN 519

Query: 389 LSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            SG+IPS+ G ++  L       N   GE+P EL    +L+ L ++ N+
Sbjct: 520 FSGSIPSNFGKNIPSLVYASFSNNSFSGELPPELCSGLSLQQLTVNSNN 568

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 66/185 (35%), Positives = 89/185 (48%), Gaps = 24/185 (12%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELP---------MDTL-------------- 118
           F  L    P F  SC  L  L LS NNF+G++P         ++TL              
Sbjct: 203 FNELTSEFPDFITSCRNLTFLDLSLNNFTGQIPELAYTNLGKLETLNLYNNLFQGPLSPK 262

Query: 119 -LKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE 295
              +  LK L L  N   G++PES+ ++S  L T +L SN+F G I  +L       L++
Sbjct: 263 ISMLSNLKSLSLQTNLLGGQIPESIGSISG-LRTAELFSNSFQGTIPSSL--GKLKHLEK 319

Query: 296 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 475
           L L+ N     IPP L  C+ L  L L+ N LSG +P SL +LSK+ DL L  N   GEI
Sbjct: 320 LDLRMNALNSTIPPELGLCTNLTYLALADNQLSGELPLSLSNLSKIADLGLSENFFSGEI 379

Query: 476 PQELM 490
              L+
Sbjct: 380 SPALI 384

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 71/246 (28%), Positives = 104/246 (42%), Gaps = 76/246 (30%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS- 202
            P+PP   + + LE+L L  NN +G +P + +  M  L++LDL+ N+  GELPE+++NL+ 
Sbjct: 451  PIPPTLWNLTNLETLNLFFNNINGTIPPE-VGNMTALQILDLNTNQLHGELPETISNLTF 509

Query: 203  -----------------------ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
                                    SL+    S+N+FSG + P LC     +LQ+L + +N
Sbjct: 510  LTSINLFGNNFSGSIPSNFGKNIPSLVYASFSNNSFSGELPPELCSGL--SLQQLTVNSN 567

Query: 314  GFTGKIPPTLSNC----------------------------------------------- 352
             FTG +P  L NC                                               
Sbjct: 568  NFTGALPTCLRNCLGLTRVRLEGNQFTGNITHAFGVLPNLVFVALNDNQFIGEISPDWGA 627

Query: 353  -SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLN----MLEGEIPQELMYVKTLETLI 517
               L +L +  N +SG IP+ LG L +L  L L  N     + GEIPQ L  +  LE+L 
Sbjct: 628  CENLTNLQMGRNRISGEIPAELGKLPRLGLLSLDSNDLTGRIPGEIPQGLGSLTRLESLD 687

Query: 518  LDFNDL 535
            L  N L
Sbjct: 688  LSDNKL 693

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 53/127 (41%), Positives = 71/127 (55%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   GS + LESL LS N  +G +  + L     L  LDLS N  SGE+P  L NL+  
Sbjct: 673  IPQGLGSLTRLESLDLSDNKLTGNISKE-LGGYEKLSSLDLSHNNLSGEIPFELGNLNLR 731

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
             L LDLSSN+ SG I  NL     + L+ L + +N  +G+IP +LS    L S   S+N 
Sbjct: 732  YL-LDLSSNSLSGTIPSNL--GKLSMLENLNVSHNHLSGRIPDSLSTMISLHSFDFSYND 788

Query: 389  LSGTIPS 409
            L+G IP+
Sbjct: 789  LTGPIPT 795

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 52/178 (29%), Positives = 81/178 (45%)
 Frame = +2

Query: 2   SLFLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP 181
           SLFLS+ LPL     + +  E+L    N  +   P      +R     +L  N       
Sbjct: 15  SLFLSM-LPLKATSSARTQAEALIQWKNTLTSPPP-----SLRSWSPSNL--NNLCNWTA 66

Query: 182 ESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL 361
            S  + S ++  ++L S   +G  L +    P   L    +QNN  +G IP  +   S+L
Sbjct: 67  ISCNSTSRTVSQINLPSLEINGT-LAHFNFTPFTDLTRFDIQNNTVSGAIPSAIGGLSKL 125

Query: 362 VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           + L LS N+  G+IP  +  L++L+ L L+ N L G IP +L  +  +  L L  N L
Sbjct: 126 IYLDLSVNFFEGSIPVEISELTELQYLSLFNNNLNGTIPSQLSNLLKVRHLDLGANYL 183

[53][TOP]
>UniRef100_UPI0000DD9670 Os09g0293500 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000DD9670
          Length = 1113

 Score =  114 bits (285), Expect = 4e-24
 Identities = 67/170 (39%), Positives = 94/170 (55%), Gaps = 2/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP  F  C  LE L L  N  +G+     +  +  L+ L LSFN  +G  P  +      
Sbjct: 369 LPASFAKCKSLEVLDLGGNQLAGDFVASVVSTIASLRELRLSFNNITGVNPLPVLAAGCP 428

Query: 209 LL-TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           LL  +DL SN   G I+P+LC +  + L++L L NN   G +PP+L +C+ L S+ LSFN
Sbjct: 429 LLEVIDLGSNELDGEIMPDLCSSLPS-LRKLLLPNNYLNGTVPPSLGDCANLESIDLSFN 487

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFND 532
            L G IP+ +  L K+ DL +W N L GEIP  L     TLETL++ +N+
Sbjct: 488 LLVGKIPTEIIRLPKIVDLVMWANGLSGEIPDVLCSNGTTLETLVISYNN 537

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 64/192 (33%), Positives = 89/192 (46%), Gaps = 24/192 (12%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVL-------------------- 145
           PLP     C LLE + L SN   GE+  D    +  L+ L                    
Sbjct: 419 PLPVLAAGCPLLEVIDLGSNELDGEIMPDLCSSLPSLRKLLLPNNYLNGTVPPSLGDCAN 478

Query: 146 ----DLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
               DLSFN   G++P  +  L   ++ L + +N  SG I   LC N   TL+ L +  N
Sbjct: 479 LESIDLSFNLLVGKIPTEIIRL-PKIVDLVMWANGLSGEIPDVLCSN-GTTLETLVISYN 536

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            FTG IP +++ C  L+ + LS N L+G++P   G L KL  L+L  N+L G +P EL  
Sbjct: 537 NFTGSIPRSITKCVNLIWVSLSGNRLTGSVPGGFGKLQKLAILQLNKNLLSGHVPAELGS 596

Query: 494 VKTLETLILDFN 529
              L  L L+ N
Sbjct: 597 CNNLIWLDLNSN 608

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 63/169 (37%), Positives = 90/169 (53%), Gaps = 7/169 (4%)
 Frame = +2

Query: 50  CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
           C  +  L LSSN   G LP  +  K + L+VLDL  N+ +G+   S+ +  ASL  L LS
Sbjct: 352 CGRIVELDLSSNRLVGALPA-SFAKCKSLEVLDLGGNQLAGDFVASVVSTIASLRELRLS 410

Query: 230 SNNFSG----PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH---LSFNY 388
            NN +G    P+L   C      L+ + L +N   G+I P L  CS L SL    L  NY
Sbjct: 411 FNNITGVNPLPVLAAGCP----LLEVIDLGSNELDGEIMPDL--CSSLPSLRKLLLPNNY 464

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GT+P SLG  + L  + L  N+L G+IP E++ +  +  L++  N L
Sbjct: 465 LNGTVPPSLGDCANLESIDLSFNLLVGKIPTEIIRLPKIVDLVMWANGL 513

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 58/157 (36%), Positives = 83/157 (52%), Gaps = 4/157 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF--NEFSGELPESLTNLS 202
           +PP  G C+ LES+ LS N   G++P + +   R  K++DL    N  SGE+P+ L +  
Sbjct: 469 VPPSLGDCANLESIDLSFNLLVGKIPTEII---RLPKIVDLVMWANGLSGEIPDVLCSNG 525

Query: 203 ASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            +L TL +S NNF+G I  ++  C N    L  + L  N  TG +P       +L  L L
Sbjct: 526 TTLETLVISYNNFTGSIPRSITKCVN----LIWVSLSGNRLTGSVPGGFGKLQKLAILQL 581

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           + N LSG +P+ LGS + L  L L  N   G IP +L
Sbjct: 582 NKNLLSGHVPAELGSCNNLIWLDLNSNSFTGTIPPQL 618

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 61/201 (30%), Positives = 81/201 (40%), Gaps = 49/201 (24%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGE-LPMDTLLKM---------------------RGLKVL 145
           P F   C +L S+ LS N  +G   P    L+                       G+  L
Sbjct: 150 PSFLAPCGVLRSVNLSRNGLAGGGFPFAPSLRSLDLSRNRLADAGLLNYSFAGCHGVGYL 209

Query: 146 DLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 325
           +LS N F+G LPE      +++ TLD+S N+ SG + P L       L  L +  N FTG
Sbjct: 210 NLSANLFAGRLPELAA--CSAVTTLDVSWNHMSGGLPPGLVATAPANLTYLNIAGNNFTG 267

Query: 326 --------------------------KIPPTLSNCSELVSLHLSFN-YLSGTIPSSLGSL 424
                                     ++PP L NC  L +L +S N  LSG +P+ L   
Sbjct: 268 DVSGYDFGGCANLTVLDWSYNGLSSTRLPPGLINCRRLETLEMSGNKLLSGALPTFLVGF 327

Query: 425 SKLRDLKLWLNMLEGEIPQEL 487
           S LR L L  N   G IP EL
Sbjct: 328 SSLRRLALAGNEFTGAIPVEL 348

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 38/90 (42%), Positives = 51/90 (56%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           LDLS+N  +G +P SL N+   L  L+L  N  +G I P+  QN K+ +  L L NN  +
Sbjct: 695 LDLSYNGLTGTIPGSLGNMMY-LQVLNLGHNELNGTI-PDAFQNLKS-IGALDLSNNQLS 751

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           G IPP L   + L    +S N L+G IPSS
Sbjct: 752 GGIPPGLGGLNFLADFDVSNNNLTGPIPSS 781

[54][TOP]
>UniRef100_Q75N53 Putative leucine rich repeat-type serine/threonine receptor-like
           kinase n=1 Tax=Daucus carota RepID=Q75N53_DAUCA
          Length = 1212

 Score =  114 bits (285), Expect = 4e-24
 Identities = 69/168 (41%), Positives = 96/168 (57%), Gaps = 2/168 (1%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P  F  C+ L +L +S N  SG+     L  +  LK L LSFN  +G +P SLTN +  L
Sbjct: 370 PTEFSLCTSLVTLNVSKNQLSGDFLTSVLSPLPSLKYLYLSFNNITGSVPPSLTN-ATQL 428

Query: 212 LTLDLSSNNFSGPILPNLCQNPKN-TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
             LDLSSN F+G I    C    + +L++L L NN   G+IP  L NC  L ++ LSFN 
Sbjct: 429 QVLDLSSNAFTGTIPTGFCSTSSSFSLEKLLLANNYLKGRIPSELGNCKNLKTIDLSFNS 488

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFN 529
           L G +PS + +L  + D+ +W N L GEIP+ + +    L+TLIL+ N
Sbjct: 489 LIGPVPSEIWTLPYIADIVMWGNGLTGEIPEGICIDGGNLQTLILNNN 536

 Score =  103 bits (257), Expect = 8e-21
 Identities = 70/195 (35%), Positives = 99/195 (50%), Gaps = 27/195 (13%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN----- 196
           P    +C  LE+L +  N+F  ++P D L  ++ L+ L L+ N F GE+P  L N     
Sbjct: 296 PASLANCQFLETLDMGHNDFHLKIPGDLLGNLKKLRHLSLAQNSFFGEIPPELGNACRTL 355

Query: 197 -------------------LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                              L  SL+TL++S N  SG  L ++  +P  +L+ LYL  N  
Sbjct: 356 EVLDLSGNQLIEQFPTEFSLCTSLVTLNVSKNQLSGDFLTSVL-SPLPSLKYLYLSFNNI 414

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS---KLRDLKLWLNMLEGEIPQELM 490
           TG +PP+L+N ++L  L LS N  +GTIP+   S S    L  L L  N L+G IP EL 
Sbjct: 415 TGSVPPSLTNATQLQVLDLSSNAFTGTIPTGFCSTSSSFSLEKLLLANNYLKGRIPSELG 474

Query: 491 YVKTLETLILDFNDL 535
             K L+T+ L FN L
Sbjct: 475 NCKNLKTIDLSFNSL 489

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 62/191 (32%), Positives = 95/191 (49%), Gaps = 27/191 (14%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           G+   L  L+L+ N+F GE+P +     R L+VLDLS N+   + P   + L  SL+TL+
Sbjct: 325 GNLKKLRHLSLAQNSFFGEIPPELGNACRTLEVLDLSGNQLIEQFPTEFS-LCTSLVTLN 383

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN------ 385
           +S N  SG  L ++  +P  +L+ LYL  N  TG +PP+L+N ++L  L LS N      
Sbjct: 384 VSKNQLSGDFLTSVL-SPLPSLKYLYLSFNNITGSVPPSLTNATQLQVLDLSSNAFTGTI 442

Query: 386 ---------------------YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
                                YL G IPS LG+   L+ + L  N L G +P E+  +  
Sbjct: 443 PTGFCSTSSSFSLEKLLLANNYLKGRIPSELGNCKNLKTIDLSFNSLIGPVPSEIWTLPY 502

Query: 503 LETLILDFNDL 535
           +  +++  N L
Sbjct: 503 IADIVMWGNGL 513

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           LE L L++N   G +P + L   + LK +DLSFN   G +P  +  L   +  + +  N 
Sbjct: 455 LEKLLLANNYLKGRIPSE-LGNCKNLKTIDLSFNSLIGPVPSEIWTLPY-IADIVMWGNG 512

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G I   +C +  N LQ L L NN  +G IP +   C+ L+ + LS N L GTIP+ +G
Sbjct: 513 LTGEIPEGICIDGGN-LQTLILNNNFISGSIPQSFVKCTNLIWVSLSSNQLRGTIPAGIG 571

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +L  L  L+L  N L GEIP  L   K+L  L L+ N L
Sbjct: 572 NLLNLAILQLGNNSLTGEIPPGLGKCKSLIWLDLNSNAL 610

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 51/142 (35%), Positives = 72/142 (50%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F SL  P+P    +   +  + +  N  +GE+P    +    L+ L L+ N  SG +P+S
Sbjct: 486 FNSLIGPVPSEIWTLPYIADIVMWGNGLTGEIPEGICIDGGNLQTLILNNNFISGSIPQS 545

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
               + +L+ + LSSN   G I P    N  N L  L L NN  TG+IPP L  C  L+ 
Sbjct: 546 FVKCT-NLIWVSLSSNQLRGTI-PAGIGNLLN-LAILQLGNNSLTGEIPPGLGKCKSLIW 602

Query: 368 LHLSFNYLSGTIPSSLGSLSKL 433
           L L+ N L+G+IP  L S S L
Sbjct: 603 LDLNSNALTGSIPPELSSQSGL 624

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 69/219 (31%), Positives = 86/219 (39%), Gaps = 52/219 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG------------ 172
           L  F  SC  L ++ LS N FS   P         LK LDLS N F+G            
Sbjct: 220 LTSFLSSCKNLSTVDLSYNFFSQIHPNFVANSPASLKFLDLSHNNFTGNLVNLELGTCHN 279

Query: 173 --------------ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN 310
                         E P SL N    L TLD+  N+F   I  +L  N K  L+ L L  
Sbjct: 280 LTVLNLSHNSLSGTEFPASLANCQ-FLETLDMGHNDFHLKIPGDLLGNLKK-LRHLSLAQ 337

Query: 311 NGFTGKIPPTLSN-------------------------CSELVSLHLSFNYLSGT-IPSS 412
           N F G+IPP L N                         C+ LV+L++S N LSG  + S 
Sbjct: 338 NSFFGEIPPELGNACRTLEVLDLSGNQLIEQFPTEFSLCTSLVTLNVSKNQLSGDFLTSV 397

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           L  L  L+ L L  N + G +P  L     L+ L L  N
Sbjct: 398 LSPLPSLKYLYLSFNNITGSVPPSLTNATQLQVLDLSSN 436

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 56/198 (28%), Positives = 80/198 (40%), Gaps = 43/198 (21%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDT-------------------------- 115
            SL   +PP  G C  L  L L+SN  +G +P +                           
Sbjct: 585  SLTGEIPPGLGKCKSLIWLDLNSNALTGSIPPELSSQSGLVSPGPVSGKQFAFVRNEGGT 644

Query: 116  -------LLKMRGLKVLDL----------SFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
                   LL+  G++   L          S   +SG    +  + + S++  DLS N  S
Sbjct: 645  ACRGAGGLLEYEGIRAERLEKFPMVLACPSTRIYSGRTVYTFAS-NGSIIYFDLSYNALS 703

Query: 245  GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
            G I  +      N++Q + L +N  TG IP +      +  L LS+N L G IP SLG L
Sbjct: 704  GTIPESF--GSLNSVQVMNLGHNNLTGSIPSSFGGLKYIGVLDLSYNNLQGAIPGSLGGL 761

Query: 425  SKLRDLKLWLNMLEGEIP 478
            S L DL +  N L G +P
Sbjct: 762  SFLSDLDVSNNNLSGSVP 779

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 64/194 (32%), Positives = 81/194 (41%), Gaps = 32/194 (16%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLL-KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           SCS  E L LS+NNFS  L   +LL     L + +LS N  S            SLL  D
Sbjct: 130 SCSF-EVLDLSANNFSEPLDAQSLLLTCDHLMIFNLSRNLISA----GSLKFGPSLLQPD 184

Query: 224 LSSNNFS--GPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
           LS N  S  G +  +L  CQN    L  L   +N  TGK+   LS+C  L ++ LS+N+ 
Sbjct: 185 LSRNRISDLGLLTDSLSNCQN----LNLLNFSDNKLTGKLTSFLSSCKNLSTVDLSYNFF 240

Query: 392 SGTIPS--------------------------SLGSLSKLRDLKLWLNMLEG-EIPQELM 490
           S   P+                           LG+   L  L L  N L G E P  L 
Sbjct: 241 SQIHPNFVANSPASLKFLDLSHNNFTGNLVNLELGTCHNLTVLNLSHNSLSGTEFPASLA 300

Query: 491 YVKTLETLILDFND 532
             + LETL +  ND
Sbjct: 301 NCQFLETLDMGHND 314

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/103 (37%), Positives = 57/103 (55%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L++L L++N  SG +P  + +K   L  + LS N+  G +P  + NL  +L  L L +N+
Sbjct: 528 LQTLILNNNFISGSIPQ-SFVKCTNLIWVSLSSNQLRGTIPAGIGNL-LNLAILQLGNNS 585

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
            +G I P L      +L  L L +N  TG IPP LS+ S LVS
Sbjct: 586 LTGEIPPGL--GKCKSLIWLDLNSNALTGSIPPELSSQSGLVS 626

[55][TOP]
>UniRef100_Q69JN6 Os09g0293500 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q69JN6_ORYSJ
          Length = 1214

 Score =  114 bits (285), Expect = 4e-24
 Identities = 67/170 (39%), Positives = 94/170 (55%), Gaps = 2/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP  F  C  LE L L  N  +G+     +  +  L+ L LSFN  +G  P  +      
Sbjct: 369 LPASFAKCKSLEVLDLGGNQLAGDFVASVVSTIASLRELRLSFNNITGVNPLPVLAAGCP 428

Query: 209 LL-TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           LL  +DL SN   G I+P+LC +  + L++L L NN   G +PP+L +C+ L S+ LSFN
Sbjct: 429 LLEVIDLGSNELDGEIMPDLCSSLPS-LRKLLLPNNYLNGTVPPSLGDCANLESIDLSFN 487

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFND 532
            L G IP+ +  L K+ DL +W N L GEIP  L     TLETL++ +N+
Sbjct: 488 LLVGKIPTEIIRLPKIVDLVMWANGLSGEIPDVLCSNGTTLETLVISYNN 537

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 64/192 (33%), Positives = 89/192 (46%), Gaps = 24/192 (12%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVL-------------------- 145
           PLP     C LLE + L SN   GE+  D    +  L+ L                    
Sbjct: 419 PLPVLAAGCPLLEVIDLGSNELDGEIMPDLCSSLPSLRKLLLPNNYLNGTVPPSLGDCAN 478

Query: 146 ----DLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
               DLSFN   G++P  +  L   ++ L + +N  SG I   LC N   TL+ L +  N
Sbjct: 479 LESIDLSFNLLVGKIPTEIIRL-PKIVDLVMWANGLSGEIPDVLCSN-GTTLETLVISYN 536

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            FTG IP +++ C  L+ + LS N L+G++P   G L KL  L+L  N+L G +P EL  
Sbjct: 537 NFTGSIPRSITKCVNLIWVSLSGNRLTGSVPGGFGKLQKLAILQLNKNLLSGHVPAELGS 596

Query: 494 VKTLETLILDFN 529
              L  L L+ N
Sbjct: 597 CNNLIWLDLNSN 608

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 63/169 (37%), Positives = 90/169 (53%), Gaps = 7/169 (4%)
 Frame = +2

Query: 50  CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
           C  +  L LSSN   G LP  +  K + L+VLDL  N+ +G+   S+ +  ASL  L LS
Sbjct: 352 CGRIVELDLSSNRLVGALPA-SFAKCKSLEVLDLGGNQLAGDFVASVVSTIASLRELRLS 410

Query: 230 SNNFSG----PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH---LSFNY 388
            NN +G    P+L   C      L+ + L +N   G+I P L  CS L SL    L  NY
Sbjct: 411 FNNITGVNPLPVLAAGCP----LLEVIDLGSNELDGEIMPDL--CSSLPSLRKLLLPNNY 464

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GT+P SLG  + L  + L  N+L G+IP E++ +  +  L++  N L
Sbjct: 465 LNGTVPPSLGDCANLESIDLSFNLLVGKIPTEIIRLPKIVDLVMWANGL 513

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 58/157 (36%), Positives = 83/157 (52%), Gaps = 4/157 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF--NEFSGELPESLTNLS 202
           +PP  G C+ LES+ LS N   G++P + +   R  K++DL    N  SGE+P+ L +  
Sbjct: 469 VPPSLGDCANLESIDLSFNLLVGKIPTEII---RLPKIVDLVMWANGLSGEIPDVLCSNG 525

Query: 203 ASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            +L TL +S NNF+G I  ++  C N    L  + L  N  TG +P       +L  L L
Sbjct: 526 TTLETLVISYNNFTGSIPRSITKCVN----LIWVSLSGNRLTGSVPGGFGKLQKLAILQL 581

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           + N LSG +P+ LGS + L  L L  N   G IP +L
Sbjct: 582 NKNLLSGHVPAELGSCNNLIWLDLNSNSFTGTIPPQL 618

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 61/201 (30%), Positives = 81/201 (40%), Gaps = 49/201 (24%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGE-LPMDTLLKM---------------------RGLKVL 145
           P F   C +L S+ LS N  +G   P    L+                       G+  L
Sbjct: 150 PSFLAPCGVLRSVNLSRNGLAGGGFPFAPSLRSLDLSRNRLADAGLLNYSFAGCHGVGYL 209

Query: 146 DLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 325
           +LS N F+G LPE      +++ TLD+S N+ SG + P L       L  L +  N FTG
Sbjct: 210 NLSANLFAGRLPELAA--CSAVTTLDVSWNHMSGGLPPGLVATAPANLTYLNIAGNNFTG 267

Query: 326 --------------------------KIPPTLSNCSELVSLHLSFN-YLSGTIPSSLGSL 424
                                     ++PP L NC  L +L +S N  LSG +P+ L   
Sbjct: 268 DVSGYDFGGCANLTVLDWSYNGLSSTRLPPGLINCRRLETLEMSGNKLLSGALPTFLVGF 327

Query: 425 SKLRDLKLWLNMLEGEIPQEL 487
           S LR L L  N   G IP EL
Sbjct: 328 SSLRRLALAGNEFTGAIPVEL 348

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 38/90 (42%), Positives = 51/90 (56%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           LDLS+N  +G +P SL N+   L  L+L  N  +G I P+  QN K+ +  L L NN  +
Sbjct: 695 LDLSYNGLTGTIPGSLGNMMY-LQVLNLGHNELNGTI-PDAFQNLKS-IGALDLSNNQLS 751

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           G IPP L   + L    +S N L+G IPSS
Sbjct: 752 GGIPPGLGGLNFLADFDVSNNNLTGPIPSS 781

[56][TOP]
>UniRef100_C5WPV7 Putative uncharacterized protein Sb01g026940 n=1 Tax=Sorghum
           bicolor RepID=C5WPV7_SORBI
          Length = 1124

 Score =  114 bits (285), Expect = 4e-24
 Identities = 70/168 (41%), Positives = 91/168 (54%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    +C  L  L  + N  +G +P   L  +  L  L LS N  SG LP ++T+ + 
Sbjct: 284 PIPESLSACHALWLLDAADNKLTGAIPAAVLGNLTSLDSLLLSNNFISGSLPSTITSCT- 342

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L   DLSSN  SG +   LC +P   L+EL + +N  TG I P L+NCS L  +  S N
Sbjct: 343 NLRVADLSSNKISGVLPAELC-SPGAALEELRMPDNMVTGTISPGLANCSRLRVIDFSIN 401

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           YL G IP  LG L  L  L +W N LEG IP EL   + L TLIL+ N
Sbjct: 402 YLRGPIPPELGQLRGLEKLVMWFNGLEGRIPAELGQCRGLRTLILNNN 449

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 57/156 (36%), Positives = 78/156 (50%), Gaps = 1/156 (0%)
 Frame = +2

Query: 23  LPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           L LPP       L +L  +     G LP D L +   L  + L+ N  +G LPESL    
Sbjct: 118 LSLPP------ALRTLDFAYGGLGGSLPGDLLTRYPNLTAVSLARNNLTGVLPESLLAGG 171

Query: 203 A-SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           A S+ + D+S NN SG +      +  +TL  L L  N   G IPP LS CS L +L+LS
Sbjct: 172 APSIQSFDVSGNNLSGDVSR---MSFADTLTLLDLSENRLGGAIPPALSRCSGLTTLNLS 228

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           +N L+G IP S+  ++ L    +  N L G IP  +
Sbjct: 229 YNGLTGPIPESVAGIAGLEVFDVSSNHLSGPIPDSI 264

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 70/210 (33%), Positives = 91/210 (43%), Gaps = 46/210 (21%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL- 220
           G+ + L+SL LS+N  SG LP  T+     L+V DLS N+ SG LP  L +  A+L  L 
Sbjct: 315 GNLTSLDSLLLSNNFISGSLP-STITSCTNLRVADLSSNKISGVLPAELCSPGAALEELR 373

Query: 221 -----------------------DLSSNNFSGPILPNLCQ-------------------- 271
                                  D S N   GPI P L Q                    
Sbjct: 374 MPDNMVTGTISPGLANCSRLRVIDFSINYLRGPIPPELGQLRGLEKLVMWFNGLEGRIPA 433

Query: 272 --NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
                  L+ L L NN   G IP  L NC+ L  + L+ N ++GTI    G L++L  L+
Sbjct: 434 ELGQCRGLRTLILNNNFIGGDIPVELFNCTGLEWVSLTSNRITGTIRPEFGRLTRLAVLQ 493

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N LEG IP+EL    +L  L L+ N L
Sbjct: 494 LANNSLEGVIPKELGNCSSLMWLDLNSNRL 523

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 50/131 (38%), Positives = 68/131 (51%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+PP  G    LE L +  N   G +P + L + RGL+ L L+ N   G++P  L N + 
Sbjct: 406 PIPPELGQLRGLEKLVMWFNGLEGRIPAE-LGQCRGLRTLILNNNFIGGDIPVELFNCTG 464

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  + L+SN  +G I P   +  +  L  L L NN   G IP  L NCS L+ L L+ N
Sbjct: 465 -LEWVSLTSNRITGTIRPEFGRLTR--LAVLQLANNSLEGVIPKELGNCSSLMWLDLNSN 521

Query: 386 YLSGTIPSSLG 418
            L+G IP  LG
Sbjct: 522 RLTGEIPRRLG 532

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 64/199 (32%), Positives = 80/199 (40%), Gaps = 43/199 (21%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLD--LSFN--------- 160
            SLE  +P   G+CS L  L L+SN  +GE+P   L +  G   L   LS N         
Sbjct: 498  SLEGVIPKELGNCSSLMWLDLNSNRLTGEIPR-RLGRQLGSTPLSGILSGNTLAFVRNVG 556

Query: 161  ----------EFSGELPESLTNLSA----------------------SLLTLDLSSNNFS 244
                      EF+G  PE L  +                        +L  LDLS N  +
Sbjct: 557  NSCKGVGGLLEFAGIRPERLLQVPTLKSCDFTRLYSGAAVSGWTRYQTLEYLDLSYNALT 616

Query: 245  GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
            G I           LQ L L  N  TG+IP +L     L    +S N LSG IP S  +L
Sbjct: 617  GDIPEEF--GDMVVLQVLDLARNNLTGEIPASLGRLHNLGVFDVSHNALSGGIPDSFSNL 674

Query: 425  SKLRDLKLWLNMLEGEIPQ 481
            S L  + +  N L GEIPQ
Sbjct: 675  SFLVQIDVSDNNLSGEIPQ 693

[57][TOP]
>UniRef100_B9G2N1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9G2N1_ORYSJ
          Length = 1190

 Score =  114 bits (285), Expect = 4e-24
 Identities = 67/170 (39%), Positives = 94/170 (55%), Gaps = 2/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP  F  C  LE L L  N  +G+     +  +  L+ L LSFN  +G  P  +      
Sbjct: 345 LPASFAKCKSLEVLDLGGNQLAGDFVASVVSTIASLRELRLSFNNITGVNPLPVLAAGCP 404

Query: 209 LL-TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           LL  +DL SN   G I+P+LC +  + L++L L NN   G +PP+L +C+ L S+ LSFN
Sbjct: 405 LLEVIDLGSNELDGEIMPDLCSSLPS-LRKLLLPNNYLNGTVPPSLGDCANLESIDLSFN 463

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFND 532
            L G IP+ +  L K+ DL +W N L GEIP  L     TLETL++ +N+
Sbjct: 464 LLVGKIPTEIIRLPKIVDLVMWANGLSGEIPDVLCSNGTTLETLVISYNN 513

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 64/192 (33%), Positives = 89/192 (46%), Gaps = 24/192 (12%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVL-------------------- 145
           PLP     C LLE + L SN   GE+  D    +  L+ L                    
Sbjct: 395 PLPVLAAGCPLLEVIDLGSNELDGEIMPDLCSSLPSLRKLLLPNNYLNGTVPPSLGDCAN 454

Query: 146 ----DLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
               DLSFN   G++P  +  L   ++ L + +N  SG I   LC N   TL+ L +  N
Sbjct: 455 LESIDLSFNLLVGKIPTEIIRL-PKIVDLVMWANGLSGEIPDVLCSN-GTTLETLVISYN 512

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            FTG IP +++ C  L+ + LS N L+G++P   G L KL  L+L  N+L G +P EL  
Sbjct: 513 NFTGSIPRSITKCVNLIWVSLSGNRLTGSVPGGFGKLQKLAILQLNKNLLSGHVPAELGS 572

Query: 494 VKTLETLILDFN 529
              L  L L+ N
Sbjct: 573 CNNLIWLDLNSN 584

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 63/169 (37%), Positives = 90/169 (53%), Gaps = 7/169 (4%)
 Frame = +2

Query: 50  CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
           C  +  L LSSN   G LP  +  K + L+VLDL  N+ +G+   S+ +  ASL  L LS
Sbjct: 328 CGRIVELDLSSNRLVGALPA-SFAKCKSLEVLDLGGNQLAGDFVASVVSTIASLRELRLS 386

Query: 230 SNNFSG----PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH---LSFNY 388
            NN +G    P+L   C      L+ + L +N   G+I P L  CS L SL    L  NY
Sbjct: 387 FNNITGVNPLPVLAAGCP----LLEVIDLGSNELDGEIMPDL--CSSLPSLRKLLLPNNY 440

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GT+P SLG  + L  + L  N+L G+IP E++ +  +  L++  N L
Sbjct: 441 LNGTVPPSLGDCANLESIDLSFNLLVGKIPTEIIRLPKIVDLVMWANGL 489

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 58/157 (36%), Positives = 83/157 (52%), Gaps = 4/157 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF--NEFSGELPESLTNLS 202
           +PP  G C+ LES+ LS N   G++P + +   R  K++DL    N  SGE+P+ L +  
Sbjct: 445 VPPSLGDCANLESIDLSFNLLVGKIPTEII---RLPKIVDLVMWANGLSGEIPDVLCSNG 501

Query: 203 ASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            +L TL +S NNF+G I  ++  C N    L  + L  N  TG +P       +L  L L
Sbjct: 502 TTLETLVISYNNFTGSIPRSITKCVN----LIWVSLSGNRLTGSVPGGFGKLQKLAILQL 557

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           + N LSG +P+ LGS + L  L L  N   G IP +L
Sbjct: 558 NKNLLSGHVPAELGSCNNLIWLDLNSNSFTGTIPPQL 594

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 61/201 (30%), Positives = 81/201 (40%), Gaps = 49/201 (24%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGE-LPMDTLLKM---------------------RGLKVL 145
           P F   C +L S+ LS N  +G   P    L+                       G+  L
Sbjct: 126 PSFLAPCGVLRSVNLSRNGLAGGGFPFAPSLRSLDLSRNRLADAGLLNYSFAGCHGVGYL 185

Query: 146 DLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 325
           +LS N F+G LPE      +++ TLD+S N+ SG + P L       L  L +  N FTG
Sbjct: 186 NLSANLFAGRLPELAA--CSAVTTLDVSWNHMSGGLPPGLVATAPANLTYLNIAGNNFTG 243

Query: 326 --------------------------KIPPTLSNCSELVSLHLSFN-YLSGTIPSSLGSL 424
                                     ++PP L NC  L +L +S N  LSG +P+ L   
Sbjct: 244 DVSGYDFGGCANLTVLDWSYNGLSSTRLPPGLINCRRLETLEMSGNKLLSGALPTFLVGF 303

Query: 425 SKLRDLKLWLNMLEGEIPQEL 487
           S LR L L  N   G IP EL
Sbjct: 304 SSLRRLALAGNEFTGAIPVEL 324

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 38/90 (42%), Positives = 51/90 (56%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           LDLS+N  +G +P SL N+   L  L+L  N  +G I P+  QN K+ +  L L NN  +
Sbjct: 671 LDLSYNGLTGTIPGSLGNMMY-LQVLNLGHNELNGTI-PDAFQNLKS-IGALDLSNNQLS 727

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           G IPP L   + L    +S N L+G IPSS
Sbjct: 728 GGIPPGLGGLNFLADFDVSNNNLTGPIPSS 757

[58][TOP]
>UniRef100_A2YZH5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2YZH5_ORYSI
          Length = 1176

 Score =  114 bits (285), Expect = 4e-24
 Identities = 67/170 (39%), Positives = 94/170 (55%), Gaps = 2/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP  F  C  LE L L  N  +G+     +  +  L+ L LSFN  +G  P  +      
Sbjct: 369 LPASFAKCKSLEVLDLGGNQLAGDFVASVVSTIASLRELRLSFNNITGVNPLPVLAAGCP 428

Query: 209 LL-TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           LL  +DL SN   G I+P+LC +  + L++L L NN   G +PP+L +C+ L S+ LSFN
Sbjct: 429 LLEVIDLGSNELDGEIMPDLCSSLPS-LRKLLLPNNYLNGTVPPSLGDCANLESIDLSFN 487

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFND 532
            L G IP+ +  L K+ DL +W N L GEIP  L     TLETL++ +N+
Sbjct: 488 LLVGKIPTEIIRLPKIVDLVMWANGLSGEIPDVLCSNGTTLETLVISYNN 537

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 64/192 (33%), Positives = 89/192 (46%), Gaps = 24/192 (12%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVL-------------------- 145
           PLP     C LLE + L SN   GE+  D    +  L+ L                    
Sbjct: 419 PLPVLAAGCPLLEVIDLGSNELDGEIMPDLCSSLPSLRKLLLPNNYLNGTVPPSLGDCAN 478

Query: 146 ----DLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
               DLSFN   G++P  +  L   ++ L + +N  SG I   LC N   TL+ L +  N
Sbjct: 479 LESIDLSFNLLVGKIPTEIIRL-PKIVDLVMWANGLSGEIPDVLCSN-GTTLETLVISYN 536

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            FTG IP +++ C  L+ + LS N L+G++P   G L KL  L+L  N+L G +P EL  
Sbjct: 537 NFTGSIPRSITKCVNLIWVSLSGNRLTGSVPGGFGKLQKLAILQLNKNLLSGHVPAELGS 596

Query: 494 VKTLETLILDFN 529
              L  L L+ N
Sbjct: 597 CNNLIWLDLNSN 608

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 63/169 (37%), Positives = 90/169 (53%), Gaps = 7/169 (4%)
 Frame = +2

Query: 50  CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
           C  +  L LSSN   G LP  +  K + L+VLDL  N+ +G+   S+ +  ASL  L LS
Sbjct: 352 CGRIVELDLSSNRLVGALPA-SFAKCKSLEVLDLGGNQLAGDFVASVVSTIASLRELRLS 410

Query: 230 SNNFSG----PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH---LSFNY 388
            NN +G    P+L   C      L+ + L +N   G+I P L  CS L SL    L  NY
Sbjct: 411 FNNITGVNPLPVLAAGCP----LLEVIDLGSNELDGEIMPDL--CSSLPSLRKLLLPNNY 464

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+GT+P SLG  + L  + L  N+L G+IP E++ +  +  L++  N L
Sbjct: 465 LNGTVPPSLGDCANLESIDLSFNLLVGKIPTEIIRLPKIVDLVMWANGL 513

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 58/157 (36%), Positives = 83/157 (52%), Gaps = 4/157 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF--NEFSGELPESLTNLS 202
           +PP  G C+ LES+ LS N   G++P + +   R  K++DL    N  SGE+P+ L +  
Sbjct: 469 VPPSLGDCANLESIDLSFNLLVGKIPTEII---RLPKIVDLVMWANGLSGEIPDVLCSNG 525

Query: 203 ASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            +L TL +S NNF+G I  ++  C N    L  + L  N  TG +P       +L  L L
Sbjct: 526 TTLETLVISYNNFTGSIPRSITKCVN----LIWVSLSGNRLTGSVPGGFGKLQKLAILQL 581

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           + N LSG +P+ LGS + L  L L  N   G IP +L
Sbjct: 582 NKNLLSGHVPAELGSCNNLIWLDLNSNSFTGTIPPQL 618

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 61/201 (30%), Positives = 81/201 (40%), Gaps = 49/201 (24%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGE-LPMDTLLKM---------------------RGLKVL 145
           P F   C +L S+ LS N  +G   P    L+                       G+  L
Sbjct: 150 PSFLAPCGVLRSVNLSRNGLAGGGFPFAPSLRSLDLSRNRLADAGLLNYSFAGCHGVGYL 209

Query: 146 DLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 325
           +LS N F+G LPE      +++ TLD+S N+ SG + P L       L  L +  N FTG
Sbjct: 210 NLSANLFAGRLPELAA--CSAVTTLDVSWNHMSGGLPPGLVATAPANLTYLNIAGNNFTG 267

Query: 326 --------------------------KIPPTLSNCSELVSLHLSFN-YLSGTIPSSLGSL 424
                                     ++PP L NC  L +L +S N  LSG +P+ L   
Sbjct: 268 DVSGYDFGGCANLTVLDWSYNGLSSTRLPPGLINCRRLETLEMSGNKLLSGALPTFLVGF 327

Query: 425 SKLRDLKLWLNMLEGEIPQEL 487
           S LR L L  N   G IP EL
Sbjct: 328 SSLRRLALAGNEFTGAIPVEL 348

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 38/90 (42%), Positives = 51/90 (56%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           LDLS+N  +G +P SL N+   L  L+L  N  +G I P+  QN K+ +  L L NN  +
Sbjct: 695 LDLSYNGLTGTIPGSLGNMMY-LQVLNLGHNELNGTI-PDAFQNLKS-IGALDLSNNQLS 751

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           G IPP L   + L    +S N L+G IPSS
Sbjct: 752 GGIPPGLGGLNFLADFDVSNNNLTGPIPSS 781

[59][TOP]
>UniRef100_C5YJB8 Putative uncharacterized protein Sb07g028670 n=1 Tax=Sorghum
           bicolor RepID=C5YJB8_SORBI
          Length = 1099

 Score =  114 bits (284), Expect = 6e-24
 Identities = 70/174 (40%), Positives = 101/174 (58%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L+ PLPP  G C+ L  L L+    SG LP +T+ +++ ++ + +     +G +PES+ 
Sbjct: 207 ALKGPLPPEIGGCTDLTMLGLAETGLSGSLP-ETIGQLKKIQTIAIYTAMLTGSIPESIG 265

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N +  L +L L  N+ SGPI P L Q  K  LQ + L  N   G IPP ++NC ELV + 
Sbjct: 266 NCT-ELTSLYLYQNSLSGPIPPQLGQLRK--LQTVLLWQNQLVGAIPPEIANCKELVLID 322

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N L+G IPSS G+L  L+ L+L  N L G IP EL    +L  + +D N+L
Sbjct: 323 LSLNSLTGPIPSSFGTLPNLQQLQLSTNKLTGAIPPELSNCTSLTDIEVDNNEL 376

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 61/169 (36%), Positives = 88/169 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+C+ L SL L  N+ SG +P   L ++R L+ + L  N+  G +P  + N    
Sbjct: 260 IPESIGNCTELTSLYLYQNSLSGPIPPQ-LGQLRKLQTVLLWQNQLVGAIPPEIANCK-E 317

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ +DLS N+ +GPI  +    P   LQ+L L  N  TG IPP LSNC+ L  + +  N 
Sbjct: 318 LVLIDLSLNSLTGPIPSSFGTLPN--LQQLQLSTNKLTGAIPPELSNCTSLTDIEVDNNE 375

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG I      L  L     W N L G +P  L   + L++L L +N+L
Sbjct: 376 LSGEIGIDFPRLRNLTLFYAWQNRLTGPVPAGLAQCEGLQSLDLSYNNL 424

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 60/160 (37%), Positives = 86/160 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+C+ L  L L++N  SG +P + + K++ L  LDL  N   G LP +L+    +
Sbjct: 452 IPPEIGNCTNLYRLRLNNNRLSGAIPAE-IGKLKNLNFLDLGSNRLVGPLPAALSGCD-N 509

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DL SN  SG +   L      +LQ + + +N  TG + P +    EL  L+L  N 
Sbjct: 510 LEFMDLHSNALSGTLPDEL----PRSLQFVDISDNKLTGLLGPGIGLLPELTKLNLGKNR 565

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE 508
           +SG IP  LGS  KL+ L L  N L G IP EL  + +LE
Sbjct: 566 ISGGIPPELGSCEKLQLLDLGDNALSGGIPPELGKLPSLE 605

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 58/169 (34%), Positives = 84/169 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   +C+ L  + + +N  SGE+ +D   ++R L +     N  +G +P  L      
Sbjct: 356 IPPELSNCTSLTDIEVDNNELSGEIGID-FPRLRNLTLFYAWQNRLTGPVPAGLAQCEG- 413

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L +LDLS NN +G +   L       L +L L +N  +G IPP + NC+ L  L L+ N 
Sbjct: 414 LQSLDLSYNNLTGAVPRELFA--LQNLTKLLLLDNDLSGFIPPEIGNCTNLYRLRLNNNR 471

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP+ +G L  L  L L  N L G +P  L     LE + L  N L
Sbjct: 472 LSGAIPAEIGKLKNLNFLDLGSNRLVGPLPAALSGCDNLEFMDLHSNAL 520

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 56/170 (32%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G  + L +L LS N  SG +P + L ++  L+ L L+ N   G +P  + NL+ S
Sbjct: 115 IPKEIGELAELTTLDLSKNQLSGGIPPE-LCRLTKLQSLALNTNSLRGAIPGDIGNLT-S 172

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN-GFTGKIPPTLSNCSELVSLHLSFN 385
           L +L L  N  SG I  ++    K  LQ L    N    G +PP +  C++L  L L+  
Sbjct: 173 LTSLTLYDNELSGAIPASIGNLKK--LQVLRAGGNQALKGPLPPEIGGCTDLTMLGLAET 230

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG++P ++G L K++ + ++  ML G IP+ +     L +L L  N L
Sbjct: 231 GLSGSLPETIGQLKKIQTIAIYTAMLTGSIPESIGNCTELTSLYLYQNSL 280

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 65/192 (33%), Positives = 87/192 (45%), Gaps = 22/192 (11%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P     C  L+SL LS NN +G +P + L  ++ L  L L  N+ SG +P  + N + 
Sbjct: 403 PVPAGLAQCEGLQSLDLSYNNLTGAVPRE-LFALQNLTKLLLLDNDLSGFIPPEIGNCT- 460

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L L++N  SG I P      KN L  L L +N   G +P  LS C  L  + L  N
Sbjct: 461 NLYRLRLNNNRLSGAI-PAEIGKLKN-LNFLDLGSNRLVGPLPAALSGCDNLEFMDLHSN 518

Query: 386 YLSGTIPSSL----------------------GSLSKLRDLKLWLNMLEGEIPQELMYVK 499
            LSGT+P  L                      G L +L  L L  N + G IP EL   +
Sbjct: 519 ALSGTLPDELPRSLQFVDISDNKLTGLLGPGIGLLPELTKLNLGKNRISGGIPPELGSCE 578

Query: 500 TLETLILDFNDL 535
            L+ L L  N L
Sbjct: 579 KLQLLDLGDNAL 590

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 58/175 (33%), Positives = 78/175 (44%), Gaps = 24/175 (13%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGEL-------PE 184
            PLP     C  LE + L SN  SG LP +     R L+ +D+S N+ +G L       PE
Sbjct: 499  PLPAALSGCDNLEFMDLHSNALSGTLPDEL---PRSLQFVDISDNKLTGLLGPGIGLLPE 555

Query: 185  SLTNLSAS-----------------LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
             LT L+                   L  LDL  N  SG I P L + P   +  L L  N
Sbjct: 556  -LTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPELGKLPSLEIS-LNLSCN 613

Query: 314  GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
              +G+IP       +L SL +S+N LSG++ + L  L  L  L +  N   GE+P
Sbjct: 614  RLSGEIPEQFGELDKLGSLDISYNQLSGSL-APLARLENLVMLNISYNTFSGELP 667

[60][TOP]
>UniRef100_B9GRE8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GRE8_POPTR
          Length = 1202

 Score =  113 bits (283), Expect = 8e-24
 Identities = 69/174 (39%), Positives = 102/174 (58%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L   +PP  G C+ L  LAL+ N  SGELP+ +L  +  +  + LS N  SGE+  +L 
Sbjct: 325 ALNSTIPPELGLCTNLTYLALADNQLSGELPL-SLSNLSKIADMGLSENSLSGEISPTLI 383

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           +    L++L + +N FSG I P +       LQ L+L NN F+G IPP + N  EL+SL 
Sbjct: 384 SNWTELISLQVQNNLFSGNIPPEI--GKLTMLQYLFLYNNTFSGSIPPEIGNLKELLSLD 441

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N LSG +P +L +L+ L+ L L+ N + G+IP E+  +  L+ L L+ N L
Sbjct: 442 LSGNQLSGPLPPALWNLTNLQILNLFSNNINGKIPPEVGNLTMLQILDLNTNQL 495

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 62/168 (36%), Positives = 94/168 (55%), Gaps = 1/168 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G  ++L+ L L +N FSG +P + +  ++ L  LDLS N+ SG LP +L NL+ +
Sbjct: 403 IPPEIGKLTMLQYLFLYNNTFSGSIPPE-IGNLKELLSLDLSGNQLSGPLPPALWNLT-N 460

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+L SNN +G I P +       LQ L L  N   G++P T+S+ + L S++L  N 
Sbjct: 461 LQILNLFSNNINGKIPPEV--GNLTMLQILDLNTNQLHGELPLTISDITSLTSINLFGNN 518

Query: 389 LSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG+IPS  G  +  L       N   GE+P EL   ++L+   ++ N
Sbjct: 519 LSGSIPSDFGKYMPSLAYASFSNNSFSGELPPELCRGRSLQQFTVNSN 566

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 57/151 (37%), Positives = 82/151 (54%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P    + + L SL + +N FSG +P + + K+  L+ L L  N FSG +P  + NL   L
Sbjct: 380 PTLISNWTELISLQVQNNLFSGNIPPE-IGKLTMLQYLFLYNNTFSGSIPPEIGNLK-EL 437

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
           L+LDLS N  SGP+ P L       LQ L L +N   GKIPP + N + L  L L+ N L
Sbjct: 438 LSLDLSGNQLSGPLPPALWN--LTNLQILNLFSNNINGKIPPEVGNLTMLQILDLNTNQL 495

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
            G +P ++  ++ L  + L+ N L G IP +
Sbjct: 496 HGELPLTISDITSLTSINLFGNNLSGSIPSD 526

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 56/144 (38%), Positives = 84/144 (58%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           LE+L L +N+F G L  + + K+  LK + L +N   G++PES+ ++S  L  ++L  N+
Sbjct: 244 LEALNLYNNSFQGPLSSN-ISKLSNLKNISLQYNLLRGQIPESIGSISG-LQIVELLGNS 301

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           F G I P++ Q     L++L L+ N     IPP L  C+ L  L L+ N LSG +P SL 
Sbjct: 302 FQGNIPPSIGQ--LKHLEKLDLRMNALNSTIPPELGLCTNLTYLALADNQLSGELPLSLS 359

Query: 419 SLSKLRDLKLWLNMLEGEIPQELM 490
           +LSK+ D+ L  N L GEI   L+
Sbjct: 360 NLSKIADMGLSENSLSGEISPTLI 383

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 61/191 (31%), Positives = 88/191 (46%), Gaps = 22/191 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMD----------------------TLLKMRGLKV 142
           +P      + L+ L+L +NN +G +P                        +   M  L+ 
Sbjct: 138 IPVEISQLTELQYLSLYNNNLNGIIPFQLANLPKVRHLDLGANYLENPDWSKFSMPSLEY 197

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           L    NE + E P  +TN   +L  LDLS N F+G I P L       L+ L L NN F 
Sbjct: 198 LSFFLNELTAEFPHFITNCR-NLTFLDLSLNKFTGQI-PELVYTNLGKLEALNLYNNSFQ 255

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G +   +S  S L ++ L +N L G IP S+GS+S L+ ++L  N  +G IP  +  +K 
Sbjct: 256 GPLSSNISKLSNLKNISLQYNLLRGQIPESIGSISGLQIVELLGNSFQGNIPPSIGQLKH 315

Query: 503 LETLILDFNDL 535
           LE L L  N L
Sbjct: 316 LEKLDLRMNAL 326

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 70/197 (35%), Positives = 96/197 (48%), Gaps = 28/197 (14%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLA---LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL 199
            +P  FG    + SLA    S+N+FSGELP + L + R L+   ++ N F+G LP  L N 
Sbjct: 523  IPSDFGK--YMPSLAYASFSNNSFSGELPPE-LCRGRSLQQFTVNSNSFTGSLPTCLRNC 579

Query: 200  SA-----------------------SLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYL 304
            S                        +L+ + LS N F G I P+   C+N    L  L +
Sbjct: 580  SELSRVRLEKNRFTGNITDAFGVLPNLVFVALSDNQFIGEISPDWGECKN----LTNLQM 635

Query: 305  QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
              N  +G+IP  L    +L  L L  N L+G IP+ LG+LS+L  L L  N L GE+PQ 
Sbjct: 636  DGNRISGEIPAELGKLPQLRVLSLGSNDLAGRIPAELGNLSRLFMLNLSNNQLTGEVPQS 695

Query: 485  LMYVKTLETLILDFNDL 535
            L  ++ LE L L  N L
Sbjct: 696  LTSLEGLEYLDLSDNKL 712

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 59/181 (32%), Positives = 82/181 (45%), Gaps = 22/181 (12%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           LE L+   N  + E P   +   R L  LDLS N+F+G++PE +      L  L+L +N+
Sbjct: 195 LEYLSFFLNELTAEFP-HFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNS 253

Query: 239 FSGPILPNLCQ--NPKNT--------------------LQELYLQNNGFTGKIPPTLSNC 352
           F GP+  N+ +  N KN                     LQ + L  N F G IPP++   
Sbjct: 254 FQGPLSSNISKLSNLKNISLQYNLLRGQIPESIGSISGLQIVELLGNSFQGNIPPSIGQL 313

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             L  L L  N L+ TIP  LG  + L  L L  N L GE+P  L  +  +  + L  N 
Sbjct: 314 KHLEKLDLRMNALNSTIPPELGLCTNLTYLALADNQLSGELPLSLSNLSKIADMGLSENS 373

Query: 533 L 535
           L
Sbjct: 374 L 374

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 62/159 (38%), Positives = 80/159 (50%)
 Frame = +2

Query: 41   FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
            FG    L  +ALS N F GE+  D   + + L  L +  N  SGE+P  L  L   L  L
Sbjct: 600  FGVLPNLVFVALSDNQFIGEISPDWG-ECKNLTNLQMDGNRISGEIPAELGKLP-QLRVL 657

Query: 221  DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
             L SN+ +G I   L     + L  L L NN  TG++P +L++   L  L LS N L+G 
Sbjct: 658  SLGSNDLAGRIPAEL--GNLSRLFMLNLSNNQLTGEVPQSLTSLEGLEYLDLSDNKLTGN 715

Query: 401  IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 517
            I   LGS  KL  L L  N L GEIP EL  + +L  L+
Sbjct: 716  ISKELGSYEKLSSLDLSHNNLAGEIPFELGNLNSLRYLL 754

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 51/134 (38%), Positives = 73/134 (54%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    S   LE L LS N  +G +  + L     L  LDLS N  +GE+P  L NL++ 
Sbjct: 692  VPQSLTSLEGLEYLDLSDNKLTGNISKE-LGSYEKLSSLDLSHNNLAGEIPFELGNLNSL 750

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               LDLSSN+ SG I  N  +   + L+ L + +N  +G+IP +LS+   L S   S+N 
Sbjct: 751  RYLLDLSSNSLSGAIPQNFAK--LSQLEILNVSHNHLSGRIPDSLSSMLSLSSFDFSYNE 808

Query: 389  LSGTIPSSLGSLSK 430
            L+G +PS  GS+ K
Sbjct: 809  LTGPLPS--GSVFK 820

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 52/174 (29%), Positives = 79/174 (45%), Gaps = 22/174 (12%)
 Frame = +2

Query: 74  LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI 253
           + SNN +G +P   +  +  L  LDLS N F G +P  ++ L+  L  L L +NN +G I
Sbjct: 105 IQSNNVNGTIP-SAIGSLSKLTHLDLSANFFEGSIPVEISQLT-ELQYLSLYNNNLNGII 162

Query: 254 LPNLCQNPKNTLQEL---YLQN------------------NGFTGKIPPTLSNCSELVSL 370
              L   PK    +L   YL+N                  N  T + P  ++NC  L  L
Sbjct: 163 PFQLANLPKVRHLDLGANYLENPDWSKFSMPSLEYLSFFLNELTAEFPHFITNCRNLTFL 222

Query: 371 HLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            LS N  +G IP  +  +L KL  L L+ N  +G +   +  +  L+ + L +N
Sbjct: 223 DLSLNKFTGQIPELVYTNLGKLEALNLYNNSFQGPLSSNISKLSNLKNISLQYN 276

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 38/117 (32%), Positives = 60/117 (51%)
 Frame = +2

Query: 185 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
           S ++ S S+  ++L S N +G  L +    P   L    +Q+N   G IP  + + S+L 
Sbjct: 67  SCSSTSRSVSQINLRSLNITGT-LAHFNFTPFTDLTRFDIQSNNVNGTIPSAIGSLSKLT 125

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L LS N+  G+IP  +  L++L+ L L+ N L G IP +L  +  +  L L  N L
Sbjct: 126 HLDLSANFFEGSIPVEISQLTELQYLSLYNNNLNGIIPFQLANLPKVRHLDLGANYL 182

[61][TOP]
>UniRef100_C5Z564 Putative uncharacterized protein Sb10g022860 n=1 Tax=Sorghum
           bicolor RepID=C5Z564_SORBI
          Length = 1097

 Score =  113 bits (282), Expect = 1e-23
 Identities = 74/173 (42%), Positives = 101/173 (58%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L+  +P  FG+   L  L L+SN  SG +P  +L     L+ +DL  N  +GE+PE L +
Sbjct: 186 LQGSIPSAFGTLPELRMLNLASNMLSGNIP-PSLGTTLSLRYVDLGRNALTGEIPELLAS 244

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S+++  L L SNN SG  LP    N  ++L  + LQ N F+G IPP  +N   +  LHL
Sbjct: 245 -SSTIQVLRLMSNNLSGE-LPKALFNT-SSLIAICLQKNSFSGSIPPITANSPPVEHLHL 301

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             NYLSGTI  SLG+LS L  L++  N L G IP+ L Y+ TLE L L+ N+L
Sbjct: 302 GENYLSGTIHPSLGNLSSLLTLRIQYNNLVGSIPESLGYISTLEILNLNVNNL 354

 Score =  100 bits (249), Expect = 7e-20
 Identities = 65/169 (38%), Positives = 94/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   L  + L  N  +GE+P + L     ++VL L  N  SGELP++L N S S
Sbjct: 214 IPPSLGTTLSLRYVDLGRNALTGEIP-ELLASSSTIQVLRLMSNNLSGELPKALFNTS-S 271

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ + L  N+FSG I P    +P   ++ L+L  N  +G I P+L N S L++L + +N 
Sbjct: 272 LIAICLQKNSFSGSIPPITANSPP--VEHLHLGENYLSGTIHPSLGNLSSLLTLRIQYNN 329

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G+IP SLG +S L  L L +N L G  PQ L  + +L  L +  N L
Sbjct: 330 LVGSIPESLGYISTLEILNLNVNNLWGPFPQSLFNMSSLIDLAVANNSL 378

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 69/169 (40%), Positives = 89/169 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           L P  G+ S L  L LS+N+F G +P +  L  R L  L+LS N   G +P  L+ L   
Sbjct: 94  LSPCIGNLSSLAKLQLSNNSFHGGIPSELGLLSR-LSNLNLSMNSLEGTIPSELS-LCTQ 151

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L +N+  G I P+L Q     LQE+ L NN   G IP       EL  L+L+ N 
Sbjct: 152 LQFLGLWNNSLHGEIPPSLSQCMH--LQEINLSNNQLQGSIPSAFGTLPELRMLNLASNM 209

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP SLG+   LR + L  N L GEIP+ L    T++ L L  N+L
Sbjct: 210 LSGNIPPSLGTTLSLRYVDLGRNALTGEIPELLASSSTIQVLRLMSNNL 258

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 67/171 (39%), Positives = 90/171 (52%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNF-SGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           L P+FGS   LE L +S N   +G+   + +L     L  L L  N   G LP S+ NLS
Sbjct: 430 LMPYFGSLPNLEVLDVSYNMLEAGDWGFVSSLSNCSKLTQLMLDGNNLQGNLPSSIGNLS 489

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           ++L  L L +N  SG I P +      +L  L++  N FTG IPPT+ N  +LV L  + 
Sbjct: 490 SNLQLLWLRNNRISGHIPPEI--GNLRSLSILFMDYNMFTGNIPPTIGNLHDLVVLAFAQ 547

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N LSG IP  +G+L +L D+KL  N L G IP  +     L+ L L  N L
Sbjct: 548 NRLSGPIPEIIGNLVQLTDIKLDRNNLSGTIPASIGSCTQLQILNLAHNSL 598

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 52/168 (30%), Positives = 85/168 (50%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+P   G+   L  + L  NN SG +P  ++     L++L+L+ N  +G +P  +  +S+
Sbjct: 553  PIPEIIGNLVQLTDIKLDRNNLSGTIPA-SIGSCTQLQILNLAHNSLNGTIPSDIFKISS 611

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
                 DLS N+ +G I P    N  N L++L + NN  +G IP  +  C  L  L +  N
Sbjct: 612  LSEEFDLSHNSLTGGI-PEEVGNLIN-LKKLSITNNMLSGYIPSAIGMCVALEYLEMRDN 669

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            +  G+IP +L +L  + ++ +  N L G IP     + +L  L L FN
Sbjct: 670  FFEGSIPQTLVNLRSIEEIDISKNRLSGNIPDFFQNLSSLHQLNLSFN 717

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 66/195 (33%), Positives = 92/195 (47%), Gaps = 28/195 (14%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G  S LE L L+ NN  G  P  +L  M  L  L ++ N   G LP ++     +
Sbjct: 334 IPESLGYISTLEILNLNVNNLWGPFPQ-SLFNMSSLIDLAVANNSLVGRLPSNIGYTLPN 392

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP------------------ 334
           +  L LS+N F+GPI  +L       LQ L L +N  TG +P                  
Sbjct: 393 IQGLILSANKFAGPIPSSLL--VAYQLQWLQLADNRLTGLMPYFGSLPNLEVLDVSYNML 450

Query: 335 --------PTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWL--NMLEGEIPQE 484
                    +LSNCS+L  L L  N L G +PSS+G+LS    L LWL  N + G IP E
Sbjct: 451 EAGDWGFVSSLSNCSKLTQLMLDGNNLQGNLPSSIGNLSSNLQL-LWLRNNRISGHIPPE 509

Query: 485 LMYVKTLETLILDFN 529
           +  +++L  L +D+N
Sbjct: 510 IGNLRSLSILFMDYN 524

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 61/192 (31%), Positives = 89/192 (46%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP  G+   L  L +  N F+G +P  T+  +  L VL  + N  SG +PE + NL   
Sbjct: 506  IPPEIGNLRSLSILFMDYNMFTGNIP-PTIGNLHDLVVLAFAQNRLSGPIPEIIGNL-VQ 563

Query: 209  LLTLDLSSNNFSGPI-----------LPNLCQNPKNTL------------QELYLQNNGF 319
            L  + L  NN SG I           + NL  N  N              +E  L +N  
Sbjct: 564  LTDIKLDRNNLSGTIPASIGSCTQLQILNLAHNSLNGTIPSDIFKISSLSEEFDLSHNSL 623

Query: 320  TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
            TG IP  + N   L  L ++ N LSG IPS++G    L  L++  N  EG IPQ L+ ++
Sbjct: 624  TGGIPEEVGNLINLKKLSITNNMLSGYIPSAIGMCVALEYLEMRDNFFEGSIPQTLVNLR 683

Query: 500  TLETLILDFNDL 535
            ++E + +  N L
Sbjct: 684  SIEEIDISKNRL 695

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 45/109 (41%), Positives = 60/109 (55%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ LDL+S   +G + P  C    ++L +L L NN F G IP  L   S L +L+LS N 
Sbjct: 80  VVALDLASEGITGSLSP--CIGNLSSLAKLQLSNNSFHGGIPSELGLLSRLSNLNLSMNS 137

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L GTIPS L   ++L+ L LW N L GEIP  L     L+ + L  N L
Sbjct: 138 LEGTIPSELSLCTQLQFLGLWNNSLHGEIPPSLSQCMHLQEINLSNNQL 186

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 47/151 (31%), Positives = 74/151 (49%), Gaps = 24/151 (15%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGL-KVLDLSFNEFSGELPESLTNLSA 205
            +P   GSC+ L+ L L+ N+ +G +P D + K+  L +  DLS N  +G +PE + NL  
Sbjct: 578  IPASIGSCTQLQILNLAHNSLNGTIPSD-IFKISSLSEEFDLSHNSLTGGIPEEVGNL-I 635

Query: 206  SLLTLDLSSNNFSGPI-----------------------LPNLCQNPKNTLQELYLQNNG 316
            +L  L +++N  SG I                       +P    N ++ ++E+ +  N 
Sbjct: 636  NLKKLSITNNMLSGYIPSAIGMCVALEYLEMRDNFFEGSIPQTLVNLRS-IEEIDISKNR 694

Query: 317  FTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 409
             +G IP    N S L  L+LSFN  SG +PS
Sbjct: 695  LSGNIPDFFQNLSSLHQLNLSFNSFSGAVPS 725

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 39/89 (43%), Positives = 47/89 (52%)
 Frame = +2

Query: 269 QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL 448
           Q P   +  L L + G TG + P + N S L  L LS N   G IPS LG LS+L +L L
Sbjct: 74  QRPPLRVVALDLASEGITGSLSPCIGNLSSLAKLQLSNNSFHGGIPSELGLLSRLSNLNL 133

Query: 449 WLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +N LEG IP EL     L+ L L  N L
Sbjct: 134 SMNSLEGTIPSELSLCTQLQFLGLWNNSL 162

[62][TOP]
>UniRef100_B9FTX5 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FTX5_ORYSJ
          Length = 1165

 Score =  113 bits (282), Expect = 1e-23
 Identities = 72/174 (41%), Positives = 105/174 (60%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L+  +P  FG   LL+ L L+++  +GE+P ++L     L  +DL  N  +G +PESL 
Sbjct: 161 NLQGSIPSAFGDLPLLQKLVLANSRLAGEIP-ESLGSSISLTYVDLGNNALTGRIPESLV 219

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N S+SL  L L  N  SG +  NL  +  ++L ++ LQ N F G IPP  +  S++  L 
Sbjct: 220 N-SSSLQVLRLMRNALSGQLPTNLFNS--SSLTDICLQQNSFVGTIPPVTAMSSQVKYLD 276

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N L GT+PSSLG+LS L  L+L  N+L G IP+ L +V TLE + L+ N+L
Sbjct: 277 LSDNNLIGTMPSSLGNLSSLIYLRLSRNILLGSIPESLGHVATLEVISLNSNNL 330

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 68/171 (39%), Positives = 89/171 (52%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFS--GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           +PP  GS   L+ L L  N F   G   + +L     L  L L  N   G LP ++ NLS
Sbjct: 407 IPPL-GSLPNLQKLDLGFNMFEADGWSFVSSLTNCSRLTRLMLDGNNIQGNLPNTIGNLS 465

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           + L  L L  NN SG I P +  N K  L +LY+  N  TG IPPT+ N   LV L+ + 
Sbjct: 466 SDLQWLWLGGNNISGSIPPEI-GNLKG-LTKLYMDCNLLTGNIPPTIENLHNLVDLNFTQ 523

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           NYLSG IP ++G+L +L +L+L  N   G IP  +     L TL L +N L
Sbjct: 524 NYLSGVIPDAIGNLLQLTNLRLDRNNFSGSIPASIGQCTQLTTLNLAYNSL 574

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 60/167 (35%), Positives = 87/167 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   + + L  L LS+N+F G +P +  L +  L  L+LS N   G +P  L++ S  
Sbjct: 94  IPPCIANLTFLTVLQLSNNSFHGSIPSELGL-LNQLSYLNLSTNSLEGNIPSELSSCS-Q 151

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDLS+NN  G I       P   LQ+L L N+   G+IP +L +   L  + L  N 
Sbjct: 152 LKILDLSNNNLQGSIPSAFGDLP--LLQKLVLANSRLAGEIPESLGSSISLTYVDLGNNA 209

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           L+G IP SL + S L+ L+L  N L G++P  L    +L  + L  N
Sbjct: 210 LTGRIPESLVNSSSLQVLRLMRNALSGQLPTNLFNSSSLTDICLQQN 256

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 56/168 (33%), Positives = 90/168 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+   L +L L  NNFSG +P  ++ +   L  L+L++N  +G +P ++  + + 
Sbjct: 530  IPDAIGNLLQLTNLRLDRNNFSGSIPA-SIGQCTQLTTLNLAYNSLNGSIPSNIFQIYSL 588

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
             + LDLS N  SG I P    N  N L +L + NN  +G++P TL  C  L S+    N+
Sbjct: 589  SVVLDLSHNYLSGGI-PEEVGNLVN-LNKLSISNNRLSGEVPSTLGECVLLESVETQSNF 646

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            L G+IP S   L  ++ + +  N L G+IP+ L    ++  L L FN+
Sbjct: 647  LVGSIPQSFAKLVGIKIMDISQNKLSGKIPEFLTSFSSVYYLNLSFNN 694

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 64/172 (37%), Positives = 93/172 (54%), Gaps = 3/172 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L  L LS N   G +P ++L  +  L+V+ L+ N  SG +P SL N+S S
Sbjct: 286 MPSSLGNLSSLIYLRLSRNILLGSIP-ESLGHVATLEVISLNSNNLSGSIPPSLFNMS-S 343

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L +++N+  G I  N+      T+QELYL +  F G IP +L N S L + +L+   
Sbjct: 344 LTFLAMTNNSLIGKIPSNIGYTLP-TIQELYLSDVKFDGSIPASLLNASNLQTFYLANCG 402

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGE---IPQELMYVKTLETLILDFNDL 535
           L+G+IP  LGSL  L+ L L  NM E +       L     L  L+LD N++
Sbjct: 403 LTGSIP-PLGSLPNLQKLDLGFNMFEADGWSFVSSLTNCSRLTRLMLDGNNI 453

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 60/170 (35%), Positives = 83/170 (48%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   L  L +  N  +G +P  T+  +  L  L+ + N  SG +P+++ NL   
Sbjct: 482 IPPEIGNLKGLTKLYMDCNLLTGNIP-PTIENLHNLVDLNFTQNYLSGVIPDAIGNL-LQ 539

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL-VSLHLSFN 385
           L  L L  NNFSG I  ++ Q  +  L  L L  N   G IP  +     L V L LS N
Sbjct: 540 LTNLRLDRNNFSGSIPASIGQCTQ--LTTLNLAYNSLNGSIPSNIFQIYSLSVVLDLSHN 597

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           YLSG IP  +G+L  L  L +  N L GE+P  L     LE++    N L
Sbjct: 598 YLSGGIPEEVGNLVNLNKLSISNNRLSGEVPSTLGECVLLESVETQSNFL 647

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 50/115 (43%), Positives = 63/115 (54%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           LDLS    +G +P  + NL+  L  L LS+N+F G I   L     N L  L L  N   
Sbjct: 83  LDLSSQGITGSIPPCIANLTF-LTVLQLSNNSFHGSIPSEL--GLLNQLSYLNLSTNSLE 139

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           G IP  LS+CS+L  L LS N L G+IPS+ G L  L+ L L  + L GEIP+ L
Sbjct: 140 GNIPSELSSCSQLKILDLSNNNLQGSIPSAFGDLPLLQKLVLANSRLAGEIPESL 194

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 51/150 (34%), Positives = 75/150 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C+ L +L L+ N+ +G +P +         VLDLS N  SG +PE + NL  +
Sbjct: 554 IPASIGQCTQLTTLNLAYNSLNGSIPSNIFQIYSLSVVLDLSHNYLSGGIPEEVGNL-VN 612

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L +S+N  SG +   L +     L+ +  Q+N   G IP + +    +  + +S N 
Sbjct: 613 LNKLSISNNRLSGEVPSTLGECV--LLESVETQSNFLVGSIPQSFAKLVGIKIMDISQNK 670

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           LSG IP  L S S +  L L  N   GEIP
Sbjct: 671 LSGKIPEFLTSFSSVYYLNLSFNNFYGEIP 700

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 57/157 (36%), Positives = 79/157 (50%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           +L LSS   +G +P   +  +  L VL LS N F G +P  L  L+  L  L+LS+N+  
Sbjct: 82  ALDLSSQGITGSIP-PCIANLTFLTVLQLSNNSFHGSIPSELGLLN-QLSYLNLSTNSLE 139

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I   L  +  + L+ L L NN   G IP    +   L  L L+ + L+G IP SLGS 
Sbjct: 140 GNIPSEL--SSCSQLKILDLSNNNLQGSIPSAFGDLPLLQKLVLANSRLAGEIPESLGSS 197

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  + L  N L G IP+ L+   +L+ L L  N L
Sbjct: 198 ISLTYVDLGNNALTGRIPESLVNSSSLQVLRLMRNAL 234

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 55/167 (32%), Positives = 83/167 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   +   L  L  + N  SG +P D +  +  L  L L  N FSG +P S+   +  
Sbjct: 506 IPPTIENLHNLVDLNFTQNYLSGVIP-DAIGNLLQLTNLRLDRNNFSGSIPASIGQCT-Q 563

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TL+L+ N+ +G I  N+ Q    ++  L L +N  +G IP  + N   L  L +S N 
Sbjct: 564 LTTLNLAYNSLNGSIPSNIFQIYSLSVV-LDLSHNYLSGGIPEEVGNLVNLNKLSISNNR 622

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG +PS+LG    L  ++   N L G IPQ   + K +   I+D +
Sbjct: 623 LSGEVPSTLGECVLLESVETQSNFLVGSIPQS--FAKLVGIKIMDIS 667

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 39/89 (43%), Positives = 51/89 (57%)
 Frame = +2

Query: 269 QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL 448
           Q+P+  +  L L + G TG IPP ++N + L  L LS N   G+IPS LG L++L  L L
Sbjct: 75  QSPRRAIA-LDLSSQGITGSIPPCIANLTFLTVLQLSNNSFHGSIPSELGLLNQLSYLNL 133

Query: 449 WLNMLEGEIPQELMYVKTLETLILDFNDL 535
             N LEG IP EL     L+ L L  N+L
Sbjct: 134 STNSLEGNIPSELSSCSQLKILDLSNNNL 162

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 43/103 (41%), Positives = 54/103 (52%)
 Frame = +2

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
           + LDLSS   +G I P  C      L  L L NN F G IP  L   ++L  L+LS N L
Sbjct: 81  IALDLSSQGITGSIPP--CIANLTFLTVLQLSNNSFHGSIPSELGLLNQLSYLNLSTNSL 138

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
            G IPS L S S+L+ L L  N L+G IP     +  L+ L+L
Sbjct: 139 EGNIPSELSSCSQLKILDLSNNNLQGSIPSAFGDLPLLQKLVL 181

[63][TOP]
>UniRef100_B9HFC7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HFC7_POPTR
          Length = 640

 Score =  112 bits (281), Expect = 1e-23
 Identities = 66/193 (34%), Positives = 103/193 (53%), Gaps = 23/193 (11%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+PP  G   ++  L L  NNF+G +P      ++ L+ LDLS N+ +G +P+S+  L+A
Sbjct: 195 PIPPTIGKVVMITKLDLHGNNFTGRIPTG-FGNLKNLRYLDLSENQITGSIPQSIGGLAA 253

Query: 206 -----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNG 316
                                  S++   +S N  SG + P++ Q  K  +Q L L+NN 
Sbjct: 254 LELLYLNQNQLTGRIPSSISGLSSMIFCRISENKLSGSLPPSIGQLSK--IQRLILENNK 311

Query: 317 FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
            TGK+P T+ + + L  +  S NY +G IPSS G+L  L+ L L  N L G++P +L  +
Sbjct: 312 LTGKLPATIGHLTALTDIFFSNNYFTGKIPSSFGNLLNLQTLDLSRNRLSGQLPPQLAKL 371

Query: 497 KTLETLILDFNDL 535
           K+L+TL L +N L
Sbjct: 372 KSLQTLYLSYNPL 384

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 65/173 (37%), Positives = 87/173 (50%), Gaps = 6/173 (3%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 214
           P + S S +  L LS N  +G+LP   +  +  L  L+LS N F   +P    NLS  L+
Sbjct: 413 PHWLSSSSISQLDLSGNALTGKLPW-WIGNITSLSFLNLSNNGFHSSIPVEFKNLSL-LM 470

Query: 215 TLDLSSNNFSGP---ILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN---CSELVSLHL 376
            LDL SN FSG    I     Q+P      + L  N FTG I   +      S + SL L
Sbjct: 471 DLDLHSNKFSGHLNVIFSKEVQDPLGHFNSIDLSYNMFTGPIDDDIGERPAMSSISSLVL 530

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           S N L G++P S+G + +L+ LKL    L G IP+EL   K L T++L  N L
Sbjct: 531 SHNTLGGSLPKSIGKMRELQVLKLVNTGLSGMIPEELGDAKELSTILLSRNKL 583

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 60/170 (35%), Positives = 90/170 (52%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSS-NNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           L P+ G+ S L+ L LS+  +  G +P + L K+  L  L L  N+ +G +P +L  LS 
Sbjct: 98  LSPYLGNLSSLQVLDLSNLKDLKGPIP-EELGKLSKLTHLFLDTNKLTGSIPFTLRYLS- 155

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  + LS N  SG + P++ ++  + + EL L  N  +G IPPT+     +  L L  N
Sbjct: 156 QLEKMYLSDNFISGIVPPSVMKSWTH-VSELGLSGNAMSGPIPPTIGKVVMITKLDLHGN 214

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             +G IP+  G+L  LR L L  N + G IPQ +  +  LE L L+ N L
Sbjct: 215 NFTGRIPTGFGNLKNLRYLDLSENQITGSIPQSIGGLAALELLYLNQNQL 264

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 55/174 (31%), Positives = 88/174 (50%), Gaps = 5/174 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGEL----PESLTN 196
           LP + G+ + L  L LS+N F   +P++    +  L  LDL  N+FSG L     + + +
Sbjct: 435 LPWWIGNITSLSFLNLSNNGFHSSIPVE-FKNLSLLMDLDLHSNKFSGHLNVIFSKEVQD 493

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPK-NTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
                 ++DLS N F+GPI  ++ + P  +++  L L +N   G +P ++    EL  L 
Sbjct: 494 PLGHFNSIDLSYNMFTGPIDDDIGERPAMSSISSLVLSHNTLGGSLPKSIGKMRELQVLK 553

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L    LSG IP  LG   +L  + L  N L G IP+ ++ +K L+   +  N L
Sbjct: 554 LVNTGLSGMIPEELGDAKELSTILLSRNKLTGAIPEIVLNLKELKQFDVSSNRL 607

[64][TOP]
>UniRef100_A5AU91 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5AU91_VITVI
          Length = 1182

 Score =  112 bits (281), Expect = 1e-23
 Identities = 72/169 (42%), Positives = 93/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+CS L +L L  N+ SG +P + L K++ L+ L L  N   G +PE + N S S
Sbjct: 310 IPPDIGNCSELVNLYLYENSLSGSVPPE-LGKLQKLQTLFLWQNTLVGVIPEEIGNCS-S 367

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS N+ SG I P+L     + LQE  + NN  +G IP  LSN   L+ L L  N 
Sbjct: 368 LQMIDLSLNSLSGTIPPSL--GDLSELQEFMISNNNVSGSIPSVLSNARNLMQLQLDTNQ 425

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +SG IP  LG LSKL     W N LEG IP  L   + L+ L L  N L
Sbjct: 426 ISGLIPPDLGKLSKLGVFFAWDNQLEGSIPSTLANCRNLQVLDLSHNSL 474

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 63/170 (37%), Positives = 92/170 (54%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN-EFSGELPESLTNLSA 205
           +P    +C  L +L L  N   G +P D L K+  L+V+    N E +G++P  L   S 
Sbjct: 213 IPVELSNCLNLRNLLLFDNRLGGNIPPD-LGKLSNLEVIRAGGNKEITGKIPAELGECS- 270

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L L+    SG +  +L     + LQ L +     +G+IPP + NCSELV+L+L  N
Sbjct: 271 NLTVLGLADTQVSGSLPASL--GKLSRLQTLSIYTTMLSGEIPPDIGNCSELVNLYLYEN 328

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG++P  LG L KL+ L LW N L G IP+E+    +L+ + L  N L
Sbjct: 329 SLSGSVPPELGKLQKLQTLFLWQNTLVGVIPEEIGNCSSLQMIDLSLNSL 378

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 67/197 (34%), Positives = 89/197 (45%), Gaps = 23/197 (11%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP  G  S L+   +S+NN SG +P   L   R L  L L  N+ SG +P  L 
Sbjct: 377 SLSGTIPPSLGDLSELQEFMISNNNVSGSIP-SVLSNARNLMQLQLDTNQISGLIPPDLG 435

Query: 194 NLSA-----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 304
            LS                        +L  LDLS N+ +G I   L Q     L +L L
Sbjct: 436 KLSKLGVFFAWDNQLEGSIPSTLANCRNLQVLDLSHNSLTGTIPSGLFQ--LQNLTKLLL 493

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
            +N  +G IPP + NCS LV + L  N ++G IP  +G L  L  L L  N L G +P E
Sbjct: 494 ISNDISGTIPPEIGNCSSLVRMRLGNNRITGGIPRQIGGLKNLNFLDLSRNRLSGSVPDE 553

Query: 485 LMYVKTLETLILDFNDL 535
           +     L+ + L  N L
Sbjct: 554 IESCTELQMVDLSNNIL 570

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 63/160 (39%), Positives = 87/160 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+CS L  + L +N  +G +P   +  ++ L  LDLS N  SG +P+ + + +  
Sbjct: 502 IPPEIGNCSSLVRMRLGNNRITGGIPRQ-IGGLKNLNFLDLSRNRLSGSVPDEIESCT-E 559

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS+N   GP LPN   +    LQ L +  N  TG+IP +      L  L LS N 
Sbjct: 560 LQMVDLSNNILEGP-LPNSLSSLSG-LQVLDVSVNRLTGQIPASFGRLVSLNKLILSRNS 617

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE 508
           LSG+IP SLG  S L+ L L  N L G IP EL  ++ LE
Sbjct: 618 LSGSIPPSLGLCSSLQLLDLSSNELFGSIPMELSQIEALE 657

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 67/196 (34%), Positives = 95/196 (48%), Gaps = 23/196 (11%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LELP+P    S   L+ L +S  N +G +P + +     L+++DLS N   G +P SL  
Sbjct: 137 LELPIPSNLSSFQFLQKLVISDANITGTIPPE-IGGCTALRIIDLSSNSLVGTIPASLGK 195

Query: 197 LSASLLTLDLSSNNFSG--PILPNLCQNPKN-----------------TLQELYL----Q 307
           L   L  L L+SN  +G  P+  + C N +N                  L  L +     
Sbjct: 196 LQ-KLEDLVLNSNQLTGKIPVELSNCLNLRNLLLFDNRLGGNIPPDLGKLSNLEVIRAGG 254

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N   TGKIP  L  CS L  L L+   +SG++P+SLG LS+L+ L ++  ML GEIP ++
Sbjct: 255 NKEITGKIPAELGECSNLTVLGLADTQVSGSLPASLGKLSRLQTLSIYTTMLSGEIPPDI 314

Query: 488 MYVKTLETLILDFNDL 535
                L  L L  N L
Sbjct: 315 GNCSELVNLYLYENSL 330

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 63/173 (36%), Positives = 93/173 (53%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P    +C  L+ L LS N+ +G +P   L +++ L  L L  N+ SG +P  + N
Sbjct: 450 LEGSIPSTLANCRNLQVLDLSHNSLTGTIPSG-LFQLQNLTKLLLISNDISGTIPPEIGN 508

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S SL+ + L +N  +G I P      KN L  L L  N  +G +P  + +C+EL  + L
Sbjct: 509 CS-SLVRMRLGNNRITGGI-PRQIGGLKN-LNFLDLSRNRLSGSVPDEIESCTELQMVDL 565

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           S N L G +P+SL SLS L+ L + +N L G+IP     + +L  LIL  N L
Sbjct: 566 SNNILEGPLPNSLSSLSGLQVLDVSVNRLTGQIPASFGRLVSLNKLILSRNSL 618

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 65/169 (38%), Positives = 97/169 (57%), Gaps = 1/169 (0%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    SC+ L+ + LS+N   G LP ++L  + GL+VLD+S N  +G++P S   L  S
Sbjct: 550  VPDEIESCTELQMVDLSNNILEGPLP-NSLSSLSGLQVLDVSVNRLTGQIPASFGRL-VS 607

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL-VSLHLSFN 385
            L  L LS N+ SG I P+L     ++LQ L L +N   G IP  LS    L ++L+LS N
Sbjct: 608  LNKLILSRNSLSGSIPPSL--GLCSSLQLLDLSSNELFGSIPMELSQIEALEIALNLSCN 665

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             L+G IP+ + +L+KL  L L  N LEG +   L  +  L +L + +N+
Sbjct: 666  GLTGPIPTQISALNKLSILDLSHNKLEGNL-IPLAKLDNLVSLNISYNN 713

 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 46/128 (35%), Positives = 69/128 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG    L  L LS N+ SG +P  +L     L++LDLS NE  G +P  L+ + A 
Sbjct: 598 IPASFGRLVSLNKLILSRNSLSGSIP-PSLGLCSSLQLLDLSSNELFGSIPMELSQIEAL 656

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            + L+LS N  +GPI   +  +  N L  L L +N   G + P L+    LVSL++S+N 
Sbjct: 657 EIALNLSCNGLTGPIPTQI--SALNKLSILDLSHNKLEGNLIP-LAKLDNLVSLNISYNN 713

Query: 389 LSGTIPSS 412
            +G +P +
Sbjct: 714 FTGYLPDN 721

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 44/106 (41%), Positives = 58/106 (54%)
 Frame = +2

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
           +++ S +   PI  NL  +    LQ+L + +   TG IPP +  C+ L  + LS N L G
Sbjct: 130 INIQSVHLELPIPSNL--SSFQFLQKLVISDANITGTIPPEIGGCTALRIIDLSSNSLVG 187

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           TIP+SLG L KL DL L  N L G+IP EL     L  L+L  N L
Sbjct: 188 TIPASLGKLQKLEDLVLNSNQLTGKIPVELSNCLNLRNLLLFDNRL 233

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 40/108 (37%), Positives = 59/108 (54%), Gaps = 1/108 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKV-LDLSFNEFSGELPESL 190
           SL   +PP  G CS L+ L LSSN   G +PM+ L ++  L++ L+LS N  +G +P  +
Sbjct: 617 SLSGSIPPSLGLCSSLQLLDLSSNELFGSIPME-LSQIEALEIALNLSCNGLTGPIPTQI 675

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP 334
           + L+  L  LDLS N   G ++P       + L  L +  N FTG +P
Sbjct: 676 SALN-KLSILDLSHNKLEGNLIP---LAKLDNLVSLNISYNNFTGYLP 719

[65][TOP]
>UniRef100_UPI000198341E PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI000198341E
          Length = 1141

 Score =  112 bits (280), Expect = 2e-23
 Identities = 72/169 (42%), Positives = 93/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+CS L +L L  N+ SG +P + L K++ L+ L L  N   G +PE + N S S
Sbjct: 269 IPPDIGNCSELVNLYLYENSLSGSVPPE-LGKLQKLQTLLLWQNTLVGVIPEEIGNCS-S 326

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS N+ SG I P+L     + LQE  + NN  +G IP  LSN   L+ L L  N 
Sbjct: 327 LQMIDLSLNSLSGTIPPSL--GDLSELQEFMISNNNVSGSIPSVLSNARNLMQLQLDTNQ 384

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +SG IP  LG LSKL     W N LEG IP  L   + L+ L L  N L
Sbjct: 385 ISGLIPPELGKLSKLGVFFAWDNQLEGSIPSTLANCRNLQVLDLSHNSL 433

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 63/170 (37%), Positives = 92/170 (54%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN-EFSGELPESLTNLSA 205
           +P    +C  L +L L  N   G +P D L K+  L+V+    N E +G++P  L   S 
Sbjct: 172 IPVELSNCLNLRNLLLFDNRLGGNIPPD-LGKLSNLEVIRAGGNKEITGKIPAELGECS- 229

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L L+    SG +  +L     + LQ L +     +G+IPP + NCSELV+L+L  N
Sbjct: 230 NLTVLGLADTQVSGSLPASL--GKLSRLQTLSIYTTMLSGEIPPDIGNCSELVNLYLYEN 287

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG++P  LG L KL+ L LW N L G IP+E+    +L+ + L  N L
Sbjct: 288 SLSGSVPPELGKLQKLQTLLLWQNTLVGVIPEEIGNCSSLQMIDLSLNSL 337

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 67/197 (34%), Positives = 89/197 (45%), Gaps = 23/197 (11%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP  G  S L+   +S+NN SG +P   L   R L  L L  N+ SG +P  L 
Sbjct: 336 SLSGTIPPSLGDLSELQEFMISNNNVSGSIP-SVLSNARNLMQLQLDTNQISGLIPPELG 394

Query: 194 NLSA-----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 304
            LS                        +L  LDLS N+ +G I   L Q     L +L L
Sbjct: 395 KLSKLGVFFAWDNQLEGSIPSTLANCRNLQVLDLSHNSLTGTIPSGLFQ--LQNLTKLLL 452

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
            +N  +G IPP + NCS LV + L  N ++G IP  +G L  L  L L  N L G +P E
Sbjct: 453 ISNDISGTIPPEIGNCSSLVRMRLGNNRITGGIPRQIGGLKNLNFLDLSRNRLSGSVPDE 512

Query: 485 LMYVKTLETLILDFNDL 535
           +     L+ + L  N L
Sbjct: 513 IESCTELQMVDLSNNIL 529

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 67/196 (34%), Positives = 96/196 (48%), Gaps = 23/196 (11%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LELP+P    S   L+ L +S  N +G +P + ++    L+++DLS N   G +P SL  
Sbjct: 96  LELPIPSNLSSFQFLQKLVISDANITGTIPPE-IVGCTALRIIDLSSNSLVGTIPASLGK 154

Query: 197 LSASLLTLDLSSNNFSG--PILPNLCQNPKN-----------------TLQELYL----Q 307
           L   L  L L+SN  +G  P+  + C N +N                  L  L +     
Sbjct: 155 LQ-KLEDLVLNSNQLTGKIPVELSNCLNLRNLLLFDNRLGGNIPPDLGKLSNLEVIRAGG 213

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N   TGKIP  L  CS L  L L+   +SG++P+SLG LS+L+ L ++  ML GEIP ++
Sbjct: 214 NKEITGKIPAELGECSNLTVLGLADTQVSGSLPASLGKLSRLQTLSIYTTMLSGEIPPDI 273

Query: 488 MYVKTLETLILDFNDL 535
                L  L L  N L
Sbjct: 274 GNCSELVNLYLYENSL 289

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 63/160 (39%), Positives = 87/160 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+CS L  + L +N  +G +P   +  ++ L  LDLS N  SG +P+ + + +  
Sbjct: 461 IPPEIGNCSSLVRMRLGNNRITGGIPRQ-IGGLKNLNFLDLSRNRLSGSVPDEIESCT-E 518

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS+N   GP LPN   +    LQ L +  N  TG+IP +      L  L LS N 
Sbjct: 519 LQMVDLSNNILEGP-LPNSLSSLSG-LQVLDVSVNRLTGQIPASFGRLVSLNKLILSRNS 576

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE 508
           LSG+IP SLG  S L+ L L  N L G IP EL  ++ LE
Sbjct: 577 LSGSIPPSLGLCSSLQLLDLSSNELFGSIPMELSQIEALE 616

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 63/173 (36%), Positives = 93/173 (53%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P    +C  L+ L LS N+ +G +P   L +++ L  L L  N+ SG +P  + N
Sbjct: 409 LEGSIPSTLANCRNLQVLDLSHNSLTGTIPSG-LFQLQNLTKLLLISNDISGTIPPEIGN 467

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S SL+ + L +N  +G I P      KN L  L L  N  +G +P  + +C+EL  + L
Sbjct: 468 CS-SLVRMRLGNNRITGGI-PRQIGGLKN-LNFLDLSRNRLSGSVPDEIESCTELQMVDL 524

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           S N L G +P+SL SLS L+ L + +N L G+IP     + +L  LIL  N L
Sbjct: 525 SNNILEGPLPNSLSSLSGLQVLDVSVNRLTGQIPASFGRLVSLNKLILSRNSL 577

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 65/169 (38%), Positives = 97/169 (57%), Gaps = 1/169 (0%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    SC+ L+ + LS+N   G LP ++L  + GL+VLD+S N  +G++P S   L  S
Sbjct: 509  VPDEIESCTELQMVDLSNNILEGPLP-NSLSSLSGLQVLDVSVNRLTGQIPASFGRL-VS 566

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL-VSLHLSFN 385
            L  L LS N+ SG I P+L     ++LQ L L +N   G IP  LS    L ++L+LS N
Sbjct: 567  LNKLILSRNSLSGSIPPSL--GLCSSLQLLDLSSNELFGSIPMELSQIEALEIALNLSCN 624

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             L+G IP+ + +L+KL  L L  N LEG +   L  +  L +L + +N+
Sbjct: 625  GLTGPIPTQISALNKLSILDLSHNKLEGNL-IPLAKLDNLVSLNISYNN 672

 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 46/128 (35%), Positives = 69/128 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG    L  L LS N+ SG +P  +L     L++LDLS NE  G +P  L+ + A 
Sbjct: 557 IPASFGRLVSLNKLILSRNSLSGSIP-PSLGLCSSLQLLDLSSNELFGSIPMELSQIEAL 615

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            + L+LS N  +GPI   +  +  N L  L L +N   G + P L+    LVSL++S+N 
Sbjct: 616 EIALNLSCNGLTGPIPTQI--SALNKLSILDLSHNKLEGNLIP-LAKLDNLVSLNISYNN 672

Query: 389 LSGTIPSS 412
            +G +P +
Sbjct: 673 FTGYLPDN 680

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 44/106 (41%), Positives = 58/106 (54%)
 Frame = +2

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
           +++ S +   PI  NL  +    LQ+L + +   TG IPP +  C+ L  + LS N L G
Sbjct: 89  INIQSVHLELPIPSNL--SSFQFLQKLVISDANITGTIPPEIVGCTALRIIDLSSNSLVG 146

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           TIP+SLG L KL DL L  N L G+IP EL     L  L+L  N L
Sbjct: 147 TIPASLGKLQKLEDLVLNSNQLTGKIPVELSNCLNLRNLLLFDNRL 192

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 40/108 (37%), Positives = 59/108 (54%), Gaps = 1/108 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKV-LDLSFNEFSGELPESL 190
           SL   +PP  G CS L+ L LSSN   G +PM+ L ++  L++ L+LS N  +G +P  +
Sbjct: 576 SLSGSIPPSLGLCSSLQLLDLSSNELFGSIPME-LSQIEALEIALNLSCNGLTGPIPTQI 634

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP 334
           + L+  L  LDLS N   G ++P       + L  L +  N FTG +P
Sbjct: 635 SALN-KLSILDLSHNKLEGNLIP---LAKLDNLVSLNISYNNFTGYLP 678

[66][TOP]
>UniRef100_Q69KC6 Putative uncharacterized protein B1047H05.12 n=1 Tax=Oryza sativa
           Japonica Group RepID=Q69KC6_ORYSJ
          Length = 1087

 Score =  112 bits (280), Expect = 2e-23
 Identities = 71/174 (40%), Positives = 101/174 (58%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SLE  +P    SCS L+ + LS+N   G +P      +  L+ L+L+ N+ SG +P SL 
Sbjct: 136 SLEGNIPSELTSCSKLQEIDLSNNKLQGRIP-SAFGDLTELQTLELASNKLSGYIPPSLG 194

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           + + SL  +DL  N  +G I  +L  +   +LQ L L NN  +G++P  L NCS L+ L 
Sbjct: 195 S-NLSLTYVDLGRNALTGEIPESLASS--KSLQVLVLMNNALSGQLPVALFNCSSLIDLD 251

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N+ +GTIPSSLG+LS L  L L  N L G IP    +V TL+TL ++ N+L
Sbjct: 252 LEDNHFTGTIPSSLGNLSSLIYLSLIANNLVGTIPDIFDHVPTLQTLAVNLNNL 305

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 61/168 (36%), Positives = 83/168 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+   L  L L  NN SG +P +++     LK L+L+ N   G +P  +  + + 
Sbjct: 505 IPGTIGNLVQLNELNLDGNNLSGSIP-ESIHHCAQLKTLNLAHNSLHGTIPVHIFKIFSL 563

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              LDLS N  SG I P    N  N L +L + NN  +G IP  L  C  L SL L  N+
Sbjct: 564 SEHLDLSHNYLSGGI-PQEVGNLIN-LNKLSISNNRLSGNIPSALGQCVILESLELQSNF 621

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L G IP S   L  +  L +  N L G+IP+ L   K+L  L L FN+
Sbjct: 622 LEGIIPESFAKLQSINKLDISHNKLSGKIPEFLASFKSLINLNLSFNN 669

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 65/169 (38%), Positives = 92/169 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG  + L++L L+SN  SG +P  +L     L  +DL  N  +GE+PESL + S S
Sbjct: 165 IPSAFGDLTELQTLELASNKLSGYIP-PSLGSNLSLTYVDLGRNALTGEIPESLAS-SKS 222

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L +N  SG  LP    N  ++L +L L++N FTG IP +L N S L+ L L  N 
Sbjct: 223 LQVLVLMNNALSGQ-LPVALFNC-SSLIDLDLEDNHFTGTIPSSLGNLSSLIYLSLIANN 280

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L GTIP     +  L+ L + LN L G +P  +  + +L  L +  N L
Sbjct: 281 LVGTIPDIFDHVPTLQTLAVNLNNLSGPVPPSIFNISSLAYLGMANNSL 329

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 62/169 (36%), Positives = 83/169 (49%), Gaps = 2/169 (1%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGE--LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P FGS   L  L ++ N         + +L     L  L L  N   G LP S+ NLS+S
Sbjct: 383 PLFGSLQNLTKLDMAYNMLEANDWSFVSSLSNCSRLTELMLDGNNLQGNLPSSIGNLSSS 442

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L +N  S  I P +      +L  LY+  N  TG IPPT+     LV L  + N 
Sbjct: 443 LEYLWLRNNQISWLIPPGI--GNLKSLNMLYMDYNYLTGNIPPTIGYLHNLVFLSFAQNR 500

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP ++G+L +L +L L  N L G IP+ + +   L+TL L  N L
Sbjct: 501 LSGQIPGTIGNLVQLNELNLDGNNLSGSIPESIHHCAQLKTLNLAHNSL 549

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 64/172 (37%), Positives = 90/172 (52%), Gaps = 3/172 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L  L+L +NN  G +P D    +  L+ L ++ N  SG +P S+ N+S S
Sbjct: 261 IPSSLGNLSSLIYLSLIANNLVGTIP-DIFDHVPTLQTLAVNLNNLSGPVPPSIFNIS-S 318

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L +++N+ +G  LP+   +    +QEL L NN F+G IP +L N S L  L L+ N 
Sbjct: 319 LAYLGMANNSLTGR-LPSKIGHMLPNIQELILLNNKFSGSIPVSLLNASHLQKLSLANNS 377

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEG---EIPQELMYVKTLETLILDFNDL 535
           L G IP   GSL  L  L +  NMLE         L     L  L+LD N+L
Sbjct: 378 LCGPIP-LFGSLQNLTKLDMAYNMLEANDWSFVSSLSNCSRLTELMLDGNNL 428

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 64/223 (28%), Positives = 98/223 (43%), Gaps = 49/223 (21%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L  P+PP   + S L  L +++N+ +G LP      +  ++ L L  N+FSG +P SL 
Sbjct: 304 NLSGPVPPSIFNISSLAYLGMANNSLTGRLPSKIGHMLPNIQELILLNNKFSGSIPVSLL 363

Query: 194 NLSASLLTLDLSSNNFSGPI---------------------------------------- 253
           N S  L  L L++N+  GPI                                        
Sbjct: 364 NAS-HLQKLSLANNSLCGPIPLFGSLQNLTKLDMAYNMLEANDWSFVSSLSNCSRLTELM 422

Query: 254 ---------LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
                    LP+   N  ++L+ L+L+NN  +  IPP + N   L  L++ +NYL+G IP
Sbjct: 423 LDGNNLQGNLPSSIGNLSSSLEYLWLRNNQISWLIPPGIGNLKSLNMLYMDYNYLTGNIP 482

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            ++G L  L  L    N L G+IP  +  +  L  L LD N+L
Sbjct: 483 PTIGYLHNLVFLSFAQNRLSGQIPGTIGNLVQLNELNLDGNNL 525

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 58/169 (34%), Positives = 89/169 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G    L  L+ + N  SG++P  T+  +  L  L+L  N  SG +PES+ +  A 
Sbjct: 481 IPPTIGYLHNLVFLSFAQNRLSGQIP-GTIGNLVQLNELNLDGNNLSGSIPESIHHC-AQ 538

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TL+L+ N+  G I  ++ +   +  + L L +N  +G IP  + N   L  L +S N 
Sbjct: 539 LKTLNLAHNSLHGTIPVHIFKI-FSLSEHLDLSHNYLSGGIPQEVGNLINLNKLSISNNR 597

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IPS+LG    L  L+L  N LEG IP+    ++++  L +  N L
Sbjct: 598 LSGNIPSALGQCVILESLELQSNFLEGIIPESFAKLQSINKLDISHNKL 646

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 54/168 (32%), Positives = 83/168 (49%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P     C+ L++L L+ N+  G +P+         + LDLS N  SG +P+ + NL  +
Sbjct: 529  IPESIHHCAQLKTLNLAHNSLHGTIPVHIFKIFSLSEHLDLSHNYLSGGIPQEVGNL-IN 587

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L +S+N  SG I   L Q     L+ L LQ+N   G IP + +    +  L +S N 
Sbjct: 588  LNKLSISNNRLSGNIPSALGQCV--ILESLELQSNFLEGIIPESFAKLQSINKLDISHNK 645

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            LSG IP  L S   L +L L  N   G +P   +++ T   + ++ ND
Sbjct: 646  LSGKIPEFLASFKSLINLNLSFNNFYGPLPSFGVFLDT-SVISIEGND 692

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 45/109 (41%), Positives = 57/109 (52%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ LDLSS   +G I P  C      L  L L NN F G IP  +   S+L  L +S N 
Sbjct: 79  VIVLDLSSEGITGCISP--CIANLTDLTRLQLSNNSFRGSIPSEIGFLSKLSILDISMNS 136

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IPS L S SKL+++ L  N L+G IP     +  L+TL L  N L
Sbjct: 137 LEGNIPSELTSCSKLQEIDLSNNKLQGRIPSAFGDLTELQTLELASNKL 185

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 51/149 (34%), Positives = 79/149 (53%), Gaps = 1/149 (0%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKM-RGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           GS  +L S + +S  F     +   ++  R + VLDLS    +G +   + NL+  L  L
Sbjct: 48  GSAEVLASWSNASMEFCSWHGITCSIQSPRRVIVLDLSSEGITGCISPCIANLT-DLTRL 106

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
            LS+N+F G I   +    K ++ ++ +  N   G IP  L++CS+L  + LS N L G 
Sbjct: 107 QLSNNSFRGSIPSEIGFLSKLSILDISM--NSLEGNIPSELTSCSKLQEIDLSNNKLQGR 164

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           IPS+ G L++L+ L+L  N L G IP  L
Sbjct: 165 IPSAFGDLTELQTLELASNKLSGYIPPSL 193

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 37/89 (41%), Positives = 51/89 (57%)
 Frame = +2

Query: 269 QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL 448
           Q+P+  +  L L + G TG I P ++N ++L  L LS N   G+IPS +G LSKL  L +
Sbjct: 74  QSPRRVIV-LDLSSEGITGCISPCIANLTDLTRLQLSNNSFRGSIPSEIGFLSKLSILDI 132

Query: 449 WLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +N LEG IP EL     L+ + L  N L
Sbjct: 133 SMNSLEGNIPSELTSCSKLQEIDLSNNKL 161

[67][TOP]
>UniRef100_Q5ZD75 Os01g0152800 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5ZD75_ORYSJ
          Length = 1051

 Score =  112 bits (280), Expect = 2e-23
 Identities = 72/169 (42%), Positives = 95/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LPP  G+ S L+SL LSSN   GE+P  +L ++R L++LD+  N FSGELP +L++   S
Sbjct: 92  LPPVIGNLSFLQSLNLSSNELYGEIP-PSLGRLRRLEILDIGGNSFSGELPANLSSC-IS 149

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +  L L+ N   G I P    N    LQ+L LQNN FTG IP +L+N S L  L++  N 
Sbjct: 150 MKNLGLAFNQLGGRI-PVELGNTLTQLQKLQLQNNSFTGPIPASLANLSLLQYLYMDNNN 208

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IP  LG  + LR+     N L G  P  L  + TL  L  + N L
Sbjct: 209 LEGLIPLDLGKAAALREFSFQQNSLSGIFPSSLWNLSTLTVLAANDNML 257

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 68/179 (37%), Positives = 95/179 (53%), Gaps = 3/179 (1%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLK-VLDLSFNEFSGELPE 184
           + +LE P+P   G    L  L LS+N  +G +P + +L++  L   LDLS+N  SG LP 
Sbjct: 454 YTNLEGPIPASLGKLKTLFVLDLSTNRLNGSIPKE-ILELPSLSWYLDLSYNSLSGPLPI 512

Query: 185 SLTNLSASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSE 358
            +  L A+L  L LS N  SG I  ++  CQ     L+ L L  N F G IP +L+N   
Sbjct: 513 EVATL-ANLNQLILSGNQLSGQIPDSIGNCQ----VLESLLLDKNSFEGGIPQSLTNLKG 567

Query: 359 LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  L+L+ N LSG IP ++G +  L+ L L  N   G IP  L  +  L  L + FN+L
Sbjct: 568 LNILNLTMNKLSGRIPDTIGRIGNLQQLFLAQNNFSGPIPATLQNLTMLWKLDVSFNNL 626

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 61/164 (37%), Positives = 87/164 (53%), Gaps = 1/164 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +CS L+ L +S N+FSG+LP   +     L  L L  N  SG +PE + NL   L TLDL
Sbjct: 346 NCSQLQQLVISDNSFSGQLPNSVVNLSTTLHKLYLDNNSISGSIPEDIGNL-IGLDTLDL 404

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
              + SG I  ++     + L E+ L N   +G IP ++ N + L  L+  +  L G IP
Sbjct: 405 GFTSLSGVIPASI--GKLSNLVEVALYNTSLSGLIPSSIGNLTNLNRLYAYYTNLEGPIP 462

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE-TLILDFNDL 535
           +SLG L  L  L L  N L G IP+E++ + +L   L L +N L
Sbjct: 463 ASLGKLKTLFVLDLSTNRLNGSIPKEILELPSLSWYLDLSYNSL 506

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 64/175 (36%), Positives = 88/175 (50%), Gaps = 6/175 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG------ELPESL 190
           +P    + S L  + L  N FSG +P  T+ +++ L+ L L  N          E   SL
Sbjct: 286 IPSSLFNLSSLTIVLLYGNRFSGFVP-PTVGRLKSLRRLYLYGNRLEANNRKGWEFITSL 344

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           TN S  L  L +S N+FSG  LPN   N   TL +LYL NN  +G IP  + N   L +L
Sbjct: 345 TNCS-QLQQLVISDNSFSGQ-LPNSVVNLSTTLHKLYLDNNSISGSIPEDIGNLIGLDTL 402

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L F  LSG IP+S+G LS L ++ L+   L G IP  +  +  L  L   + +L
Sbjct: 403 DLGFTSLSGVIPASIGKLSNLVEVALYNTSLSGLIPSSIGNLTNLNRLYAYYTNL 457

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 63/181 (34%), Positives = 93/181 (51%), Gaps = 7/181 (3%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL    P    + S L  LA + N   G +P +   K  G++   L+ N+FSG +P SL 
Sbjct: 232 SLSGIFPSSLWNLSTLTVLAANDNMLQGSIPANIGDKFPGIQYFGLADNQFSGVIPSSLF 291

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL------QNNGFTGKIPPTLSNCS 355
           NLS+  + L L  N FSG + P +      +L+ LYL       NN    +   +L+NCS
Sbjct: 292 NLSSLTIVL-LYGNRFSGFVPPTV--GRLKSLRRLYLYGNRLEANNRKGWEFITSLTNCS 348

Query: 356 ELVSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           +L  L +S N  SG +P+S+ +LS  L  L L  N + G IP+++  +  L+TL L F  
Sbjct: 349 QLQQLVISDNSFSGQLPNSVVNLSTTLHKLYLDNNSISGSIPEDIGNLIGLDTLDLGFTS 408

Query: 533 L 535
           L
Sbjct: 409 L 409

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 55/131 (41%), Positives = 74/131 (56%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL  PLP    + + L  L LS N  SG++P D++   + L+ L L  N F G +P+SLT
Sbjct: 505 SLSGPLPIEVATLANLNQLILSGNQLSGQIP-DSIGNCQVLESLLLDKNSFEGGIPQSLT 563

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL   L  L+L+ N  SG I P+      N LQ+L+L  N F+G IP TL N + L  L 
Sbjct: 564 NLKG-LNILNLTMNKLSGRI-PDTIGRIGN-LQQLFLAQNNFSGPIPATLQNLTMLWKLD 620

Query: 374 LSFNYLSGTIP 406
           +SFN L G +P
Sbjct: 621 VSFNNLQGEVP 631

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 54/147 (36%), Positives = 74/147 (50%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    + SLL+ L + +NN  G +P+D L K   L+      N  SG  P SL NLS 
Sbjct: 188 PIPASLANLSLLQYLYMDNNNLEGLIPLD-LGKAAALREFSFQQNSLSGIFPSSLWNLS- 245

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L  + N   G I  N+       +Q   L +N F+G IP +L N S L  + L  N
Sbjct: 246 TLTVLAANDNMLQGSIPANIGDKFPG-IQYFGLADNQFSGVIPSSLFNLSSLTIVLLYGN 304

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLE 466
             SG +P ++G L  LR L L+ N LE
Sbjct: 305 RFSGFVPPTVGRLKSLRRLYLYGNRLE 331

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 33/80 (41%), Positives = 43/80 (53%)
 Frame = +2

Query: 296 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 475
           L L +    G +PP + N S L SL+LS N L G IP SLG L +L  L +  N   GE+
Sbjct: 81  LTLPSGNLAGGLPPVIGNLSFLQSLNLSSNELYGEIPPSLGRLRRLEILDIGGNSFSGEL 140

Query: 476 PQELMYVKTLETLILDFNDL 535
           P  L    +++ L L FN L
Sbjct: 141 PANLSSCISMKNLGLAFNQL 160

[68][TOP]
>UniRef100_A7Q1M5 Chromosome chr7 scaffold_44, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7Q1M5_VITVI
          Length = 941

 Score =  112 bits (280), Expect = 2e-23
 Identities = 75/194 (38%), Positives = 104/194 (53%), Gaps = 24/194 (12%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL-- 199
           P+P   G+ + L  L L SNN SG++PM+ +  ++ LKVLDL+ N+  GELPE+L+ L  
Sbjct: 353 PIPLAVGNLTKLTRLELFSNNLSGKIPME-IGNLKSLKVLDLNTNKLHGELPETLSLLNN 411

Query: 200 ----------------------SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
                                 S  L+ +  ++N+FSG + P LC      LQ L L+NN
Sbjct: 412 LERLSMFTNNFSGTIPTELGKNSLKLMYVSFTNNSFSGELPPGLCNG--FALQYLTLRNN 469

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
             +G+IPP L N S L  L LS N LSG IPS+LG L  L+ L L  N L G+IP  L  
Sbjct: 470 DLSGEIPPELGNLSTLNVLDLSSNSLSGAIPSNLGKLVALQILNLSHNNLTGKIPPSLSD 529

Query: 494 VKTLETLILDFNDL 535
           +  L ++   +N L
Sbjct: 530 MMNLSSIDFSYNTL 543

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 69/193 (35%), Positives = 103/193 (53%), Gaps = 23/193 (11%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKV------------------- 142
           P+P   G  S L+++ +  N F G++P  +  L K++GL +                   
Sbjct: 210 PIPEDIGMISDLQNIEMYDNWFEGKIPSSIGQLRKLQGLDLHMNGLNSTIPTELGLCTSL 269

Query: 143 --LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNG 316
             L+L+ N  +G LP SLTNLS  +  L L+ +NF G I   +    K  L  L+L NN 
Sbjct: 270 TFLNLAMNSLTGVLPLSLTNLSM-ISELGLA-DNFFGKIPLEIGLLTK--LNYLFLYNNT 325

Query: 317 FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
             G IP  + N  +L  L LS N+LSG IP ++G+L+KL  L+L+ N L G+IP E+  +
Sbjct: 326 LYGSIPSEIGNLKDLFELDLSENHLSGPIPLAVGNLTKLTRLELFSNNLSGKIPMEIGNL 385

Query: 497 KTLETLILDFNDL 535
           K+L+ L L+ N L
Sbjct: 386 KSLKVLDLNTNKL 398

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 58/128 (45%), Positives = 76/128 (59%), Gaps = 1/128 (0%)
 Frame = +2

Query: 29  LPPFFGSCSL-LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           +P   G  SL L  ++ ++N+FSGELP   L     L+ L L  N+ SGE+P  L NLS 
Sbjct: 426 IPTELGKNSLKLMYVSFTNNSFSGELPPG-LCNGFALQYLTLRNNDLSGEIPPELGNLS- 483

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  LDLSSN+ SG I  NL       LQ L L +N  TGKIPP+LS+   L S+  S+N
Sbjct: 484 TLNVLDLSSNSLSGAIPSNL--GKLVALQILNLSHNNLTGKIPPSLSDMMNLSSIDFSYN 541

Query: 386 YLSGTIPS 409
            L+G IP+
Sbjct: 542 TLTGPIPT 549

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 61/172 (35%), Positives = 89/172 (51%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L   +P   G C+ L  L L+ N+ +G LP+ +L  +  +  L L+ N F G++P  +  
Sbjct: 255 LNSTIPTELGLCTSLTFLNLAMNSLTGVLPL-SLTNLSMISELGLADN-FFGKIPLEI-G 311

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
           L   L  L L +N   G I P+   N K+ L EL L  N  +G IP  + N ++L  L L
Sbjct: 312 LLTKLNYLFLYNNTLYGSI-PSEIGNLKD-LFELDLSENHLSGPIPLAVGNLTKLTRLEL 369

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             N LSG IP  +G+L  L+ L L  N L GE+P+ L  +  LE L +  N+
Sbjct: 370 FSNNLSGKIPMEIGNLKSLKVLDLNTNKLHGELPETLSLLNNLERLSMFTNN 421

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 61/186 (32%), Positives = 86/186 (46%), Gaps = 27/186 (14%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN- 235
           L SL L++N   G +P   + ++  L+ L L  N   G++P  +TNL   +  LDL SN 
Sbjct: 96  LTSLNLNTNRLKGSIPT-AIGQLTELRYLSLHDNYLIGDIPYQITNLQ-KVWYLDLGSNY 153

Query: 236 -------NFSG-PILPNLCQNPKNTLQE-------------LYLQNNGFTGKIPP----- 337
                   F G P+L +L  N  + + E             L L  N FTG IP      
Sbjct: 154 LVSPDWSRFLGMPLLTHLSFNFNDLILEFPEFITDCRNLTYLDLSQNYFTGPIPDGPIPE 213

Query: 338 TLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 517
            +   S+L ++ +  N+  G IPSS+G L KL+ L L +N L   IP EL    +L  L 
Sbjct: 214 DIGMISDLQNIEMYDNWFEGKIPSSIGQLRKLQGLDLHMNGLNSTIPTELGLCTSLTFLN 273

Query: 518 LDFNDL 535
           L  N L
Sbjct: 274 LAMNSL 279

[69][TOP]
>UniRef100_A7NXS5 Chromosome chr5 scaffold_2, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7NXS5_VITVI
          Length = 1167

 Score =  112 bits (280), Expect = 2e-23
 Identities = 72/169 (42%), Positives = 93/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+CS L +L L  N+ SG +P + L K++ L+ L L  N   G +PE + N S S
Sbjct: 310 IPPDIGNCSELVNLYLYENSLSGSVPPE-LGKLQKLQTLLLWQNTLVGVIPEEIGNCS-S 367

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS N+ SG I P+L     + LQE  + NN  +G IP  LSN   L+ L L  N 
Sbjct: 368 LQMIDLSLNSLSGTIPPSL--GDLSELQEFMISNNNVSGSIPSVLSNARNLMQLQLDTNQ 425

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +SG IP  LG LSKL     W N LEG IP  L   + L+ L L  N L
Sbjct: 426 ISGLIPPELGKLSKLGVFFAWDNQLEGSIPSTLANCRNLQVLDLSHNSL 474

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 63/170 (37%), Positives = 92/170 (54%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN-EFSGELPESLTNLSA 205
           +P    +C  L +L L  N   G +P D L K+  L+V+    N E +G++P  L   S 
Sbjct: 213 IPVELSNCLNLRNLLLFDNRLGGNIPPD-LGKLSNLEVIRAGGNKEITGKIPAELGECS- 270

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L L+    SG +  +L     + LQ L +     +G+IPP + NCSELV+L+L  N
Sbjct: 271 NLTVLGLADTQVSGSLPASL--GKLSRLQTLSIYTTMLSGEIPPDIGNCSELVNLYLYEN 328

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG++P  LG L KL+ L LW N L G IP+E+    +L+ + L  N L
Sbjct: 329 SLSGSVPPELGKLQKLQTLLLWQNTLVGVIPEEIGNCSSLQMIDLSLNSL 378

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 67/197 (34%), Positives = 89/197 (45%), Gaps = 23/197 (11%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP  G  S L+   +S+NN SG +P   L   R L  L L  N+ SG +P  L 
Sbjct: 377 SLSGTIPPSLGDLSELQEFMISNNNVSGSIP-SVLSNARNLMQLQLDTNQISGLIPPELG 435

Query: 194 NLSA-----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 304
            LS                        +L  LDLS N+ +G I   L Q     L +L L
Sbjct: 436 KLSKLGVFFAWDNQLEGSIPSTLANCRNLQVLDLSHNSLTGTIPSGLFQ--LQNLTKLLL 493

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
            +N  +G IPP + NCS LV + L  N ++G IP  +G L  L  L L  N L G +P E
Sbjct: 494 ISNDISGTIPPEIGNCSSLVRMRLGNNRITGGIPRQIGGLKNLNFLDLSRNRLSGSVPDE 553

Query: 485 LMYVKTLETLILDFNDL 535
           +     L+ + L  N L
Sbjct: 554 IESCTELQMVDLSNNIL 570

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 67/196 (34%), Positives = 96/196 (48%), Gaps = 23/196 (11%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LELP+P    S   L+ L +S  N +G +P + ++    L+++DLS N   G +P SL  
Sbjct: 137 LELPIPSNLSSFQFLQKLVISDANITGTIPPE-IVGCTALRIIDLSSNSLVGTIPASLGK 195

Query: 197 LSASLLTLDLSSNNFSG--PILPNLCQNPKN-----------------TLQELYL----Q 307
           L   L  L L+SN  +G  P+  + C N +N                  L  L +     
Sbjct: 196 LQ-KLEDLVLNSNQLTGKIPVELSNCLNLRNLLLFDNRLGGNIPPDLGKLSNLEVIRAGG 254

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N   TGKIP  L  CS L  L L+   +SG++P+SLG LS+L+ L ++  ML GEIP ++
Sbjct: 255 NKEITGKIPAELGECSNLTVLGLADTQVSGSLPASLGKLSRLQTLSIYTTMLSGEIPPDI 314

Query: 488 MYVKTLETLILDFNDL 535
                L  L L  N L
Sbjct: 315 GNCSELVNLYLYENSL 330

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 63/160 (39%), Positives = 87/160 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+CS L  + L +N  +G +P   +  ++ L  LDLS N  SG +P+ + + +  
Sbjct: 502 IPPEIGNCSSLVRMRLGNNRITGGIPRQ-IGGLKNLNFLDLSRNRLSGSVPDEIESCT-E 559

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS+N   GP LPN   +    LQ L +  N  TG+IP +      L  L LS N 
Sbjct: 560 LQMVDLSNNILEGP-LPNSLSSLSG-LQVLDVSVNRLTGQIPASFGRLVSLNKLILSRNS 617

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE 508
           LSG+IP SLG  S L+ L L  N L G IP EL  ++ LE
Sbjct: 618 LSGSIPPSLGLCSSLQLLDLSSNELFGSIPMELSQIEALE 657

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 63/173 (36%), Positives = 93/173 (53%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P    +C  L+ L LS N+ +G +P   L +++ L  L L  N+ SG +P  + N
Sbjct: 450 LEGSIPSTLANCRNLQVLDLSHNSLTGTIPSG-LFQLQNLTKLLLISNDISGTIPPEIGN 508

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S SL+ + L +N  +G I P      KN L  L L  N  +G +P  + +C+EL  + L
Sbjct: 509 CS-SLVRMRLGNNRITGGI-PRQIGGLKN-LNFLDLSRNRLSGSVPDEIESCTELQMVDL 565

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           S N L G +P+SL SLS L+ L + +N L G+IP     + +L  LIL  N L
Sbjct: 566 SNNILEGPLPNSLSSLSGLQVLDVSVNRLTGQIPASFGRLVSLNKLILSRNSL 618

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 65/169 (38%), Positives = 97/169 (57%), Gaps = 1/169 (0%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    SC+ L+ + LS+N   G LP ++L  + GL+VLD+S N  +G++P S   L  S
Sbjct: 550  VPDEIESCTELQMVDLSNNILEGPLP-NSLSSLSGLQVLDVSVNRLTGQIPASFGRL-VS 607

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL-VSLHLSFN 385
            L  L LS N+ SG I P+L     ++LQ L L +N   G IP  LS    L ++L+LS N
Sbjct: 608  LNKLILSRNSLSGSIPPSL--GLCSSLQLLDLSSNELFGSIPMELSQIEALEIALNLSCN 665

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             L+G IP+ + +L+KL  L L  N LEG +   L  +  L +L + +N+
Sbjct: 666  GLTGPIPTQISALNKLSILDLSHNKLEGNL-IPLAKLDNLVSLNISYNN 713

 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 46/128 (35%), Positives = 69/128 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG    L  L LS N+ SG +P  +L     L++LDLS NE  G +P  L+ + A 
Sbjct: 598 IPASFGRLVSLNKLILSRNSLSGSIP-PSLGLCSSLQLLDLSSNELFGSIPMELSQIEAL 656

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            + L+LS N  +GPI   +  +  N L  L L +N   G + P L+    LVSL++S+N 
Sbjct: 657 EIALNLSCNGLTGPIPTQI--SALNKLSILDLSHNKLEGNLIP-LAKLDNLVSLNISYNN 713

Query: 389 LSGTIPSS 412
            +G +P +
Sbjct: 714 FTGYLPDN 721

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 44/106 (41%), Positives = 58/106 (54%)
 Frame = +2

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
           +++ S +   PI  NL  +    LQ+L + +   TG IPP +  C+ L  + LS N L G
Sbjct: 130 INIQSVHLELPIPSNL--SSFQFLQKLVISDANITGTIPPEIVGCTALRIIDLSSNSLVG 187

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           TIP+SLG L KL DL L  N L G+IP EL     L  L+L  N L
Sbjct: 188 TIPASLGKLQKLEDLVLNSNQLTGKIPVELSNCLNLRNLLLFDNRL 233

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 40/108 (37%), Positives = 59/108 (54%), Gaps = 1/108 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKV-LDLSFNEFSGELPESL 190
           SL   +PP  G CS L+ L LSSN   G +PM+ L ++  L++ L+LS N  +G +P  +
Sbjct: 617 SLSGSIPPSLGLCSSLQLLDLSSNELFGSIPME-LSQIEALEIALNLSCNGLTGPIPTQI 675

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP 334
           + L+  L  LDLS N   G ++P       + L  L +  N FTG +P
Sbjct: 676 SALN-KLSILDLSHNKLEGNLIP---LAKLDNLVSLNISYNNFTGYLP 719

[70][TOP]
>UniRef100_A3BD37 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3BD37_ORYSJ
          Length = 1126

 Score =  112 bits (280), Expect = 2e-23
 Identities = 68/165 (41%), Positives = 100/165 (60%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           FG+ S L++L L+SN  + E+P  +L     L+ +DL  N+ +G +PESL N S+SL  L
Sbjct: 191 FGNLSKLQALVLTSNRLTDEIP-PSLGSSFSLRYVDLGNNDITGSIPESLAN-SSSLQVL 248

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
            L SNN SG +  +L     ++L  ++LQ N F G IP   +  S +  + L  N +SGT
Sbjct: 249 RLMSNNLSGEVPKSLFNT--SSLTAIFLQQNSFVGSIPAIAAMSSPIKYISLRDNCISGT 306

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           IP SLG+LS L +L+L  N L G IP+ L +++TLE L +  N+L
Sbjct: 307 IPPSLGNLSSLLELRLSKNNLVGSIPESLGHIRTLEILTMSVNNL 351

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 67/171 (39%), Positives = 86/171 (50%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFS-GELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           L PFFGS   LE L +S N    G+   M +L     L  L L  N F G LP S+ NLS
Sbjct: 427 LVPFFGSLPNLEELDVSYNMLEPGDWSFMTSLSNCSKLTQLMLDGNSFQGILPSSIGNLS 486

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           ++L  L L +N   GPI P +      +L  L++  N FTG IP T+ N + L  L  + 
Sbjct: 487 SNLEGLWLRNNKIYGPIPPEI--GNLKSLSILFMDYNLFTGTIPQTIGNLNNLTVLSFAQ 544

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N LSG IP   G+L +L D+KL  N   G IP  +     L+ L L  N L
Sbjct: 545 NKLSGHIPDVFGNLVQLTDIKLDGNNFSGRIPSSIGQCTQLQILNLAHNSL 595

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 53/168 (31%), Positives = 90/168 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  FG+   L  + L  NNFSG +P  ++ +   L++L+L+ N   G +P  +  +++ 
Sbjct: 551  IPDVFGNLVQLTDIKLDGNNFSGRIP-SSIGQCTQLQILNLAHNSLDGNIPSIIFKITSL 609

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               ++LS N  +G  +P+   N  N L +L + NN  +G+IP +L  C  L  L +  N+
Sbjct: 610  SQEMNLSHNYLTGG-MPDEVGNLIN-LNKLGISNNMLSGEIPSSLGQCVTLEYLEIQSNF 667

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
              G IP S   L  ++++ +  N L G+IPQ L  + +L  L L FN+
Sbjct: 668  FVGGIPQSFMKLVSIKEMDISRNNLSGKIPQFLNLLSSLHDLNLSFNN 715

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/171 (36%), Positives = 92/171 (53%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           + P   + + L +L LS+N+  G +P    L +R L+ L+LS N   G +P  L++ S  
Sbjct: 91  ISPCIANLTSLMTLQLSNNSLHGSIPPKLGL-LRKLRNLNLSMNSLEGNIPSQLSSYS-Q 148

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           +  LDLSSN+F G I  +L  C +    LQ++ L  N   G+I     N S+L +L L+ 
Sbjct: 149 IEILDLSSNSFQGAIPASLGKCIH----LQDINLSRNNLQGRISSAFGNLSKLQALVLTS 204

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N L+  IP SLGS   LR + L  N + G IP+ L    +L+ L L  N+L
Sbjct: 205 NRLTDEIPPSLGSSFSLRYVDLGNNDITGSIPESLANSSSLQVLRLMSNNL 255

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 60/193 (31%), Positives = 90/193 (46%), Gaps = 23/193 (11%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+PP  G+   L  L +  N F+G +P  T+  +  L VL  + N+ SG +P+   NL  
Sbjct: 502  PIPPEIGNLKSLSILFMDYNLFTGTIPQ-TIGNLNNLTVLSFAQNKLSGHIPDVFGNL-V 559

Query: 206  SLLTLDLSSNNFSGPI-----------------------LPNLCQNPKNTLQELYLQNNG 316
             L  + L  NNFSG I                       +P++     +  QE+ L +N 
Sbjct: 560  QLTDIKLDGNNFSGRIPSSIGQCTQLQILNLAHNSLDGNIPSIIFKITSLSQEMNLSHNY 619

Query: 317  FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
             TG +P  + N   L  L +S N LSG IPSSLG    L  L++  N   G IPQ  M +
Sbjct: 620  LTGGMPDEVGNLINLNKLGISNNMLSGEIPSSLGQCVTLEYLEIQSNFFVGGIPQSFMKL 679

Query: 497  KTLETLILDFNDL 535
             +++ + +  N+L
Sbjct: 680  VSIKEMDISRNNL 692

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 59/171 (34%), Positives = 88/171 (51%), Gaps = 2/171 (1%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS- 202
           P+P    +   LE L L +N+F+G +P    L    L+ LD+S+N         +T+LS 
Sbjct: 403 PIPASLLNAYHLEMLYLGNNSFTGLVPFFGSLP--NLEELDVSYNMLEPGDWSFMTSLSN 460

Query: 203 -ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
            + L  L L  N+F G ILP+   N  + L+ L+L+NN   G IPP + N   L  L + 
Sbjct: 461 CSKLTQLMLDGNSFQG-ILPSSIGNLSSNLEGLWLRNNKIYGPIPPEIGNLKSLSILFMD 519

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           +N  +GTIP ++G+L+ L  L    N L G IP     +  L  + LD N+
Sbjct: 520 YNLFTGTIPQTIGNLNNLTVLSFAQNKLSGHIPDVFGNLVQLTDIKLDGNN 570

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 66/174 (37%), Positives = 90/174 (51%), Gaps = 1/174 (0%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           LS E+P   F  + S L ++ L  N+F G +P    +    +K + L  N  SG +P SL
Sbjct: 255 LSGEVPKSLF--NTSSLTAIFLQQNSFVGSIPAIAAMSSP-IKYISLRDNCISGTIPPSL 311

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            NLS SLL L LS NN  G I  +L      TL+ L +  N  +G +PP+L N S L  L
Sbjct: 312 GNLS-SLLELRLSKNNLVGSIPESL--GHIRTLEILTMSVNNLSGLVPPSLFNISSLTFL 368

Query: 371 HLSFNYLSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            +  N L G +PS +G +L+K++ L L  N   G IP  L+    LE L L  N
Sbjct: 369 AMGNNSLVGRLPSDIGYTLTKIQGLILPANKFVGPIPASLLNAYHLEMLYLGNN 422

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 69/218 (31%), Positives = 96/218 (44%), Gaps = 51/218 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ S L  L LS NN  G +P ++L  +R L++L +S N  SG +P SL N+S S
Sbjct: 307 IPPSLGNLSSLLELRLSKNNLVGSIP-ESLGHIRTLEILTMSVNNLSGLVPPSLFNIS-S 364

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP------------------ 334
           L  L + +N+  G  LP+        +Q L L  N F G IP                  
Sbjct: 365 LTFLAMGNNSLVGR-LPSDIGYTLTKIQGLILPANKFVGPIPASLLNAYHLEMLYLGNNS 423

Query: 335 --------------------------------PTLSNCSELVSLHLSFNYLSGTIPSSLG 418
                                            +LSNCS+L  L L  N   G +PSS+G
Sbjct: 424 FTGLVPFFGSLPNLEELDVSYNMLEPGDWSFMTSLSNCSKLTQLMLDGNSFQGILPSSIG 483

Query: 419 SL-SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           +L S L  L L  N + G IP E+  +K+L  L +D+N
Sbjct: 484 NLSSNLEGLWLRNNKIYGPIPPEIGNLKSLSILFMDYN 521

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 54/151 (35%), Positives = 81/151 (53%), Gaps = 1/151 (0%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGL-KVLDLSFNEFSGELPESLTNLSA 205
            +P   G C+ L+ L L+ N+  G +P   + K+  L + ++LS N  +G +P+ + NL  
Sbjct: 575  IPSSIGQCTQLQILNLAHNSLDGNIP-SIIFKITSLSQEMNLSHNYLTGGMPDEVGNL-I 632

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            +L  L +S+N  SG I  +L Q    TL+ L +Q+N F G IP +      +  + +S N
Sbjct: 633  NLNKLGISNNMLSGEIPSSLGQCV--TLEYLEIQSNFFVGGIPQSFMKLVSIKEMDISRN 690

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
             LSG IP  L  LS L DL L  N  +G IP
Sbjct: 691  NLSGKIPQFLNLLSSLHDLNLSFNNFDGVIP 721

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 55/157 (35%), Positives = 78/157 (49%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           ++ LSS   +G +    +  +  L  L LS N   G +P  L  L   L  L+LS N+  
Sbjct: 79  AIDLSSEGITGTIS-PCIANLTSLMTLQLSNNSLHGSIPPKL-GLLRKLRNLNLSMNSLE 136

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I   L  +  + ++ L L +N F G IP +L  C  L  ++LS N L G I S+ G+L
Sbjct: 137 GNIPSQL--SSYSQIEILDLSSNSFQGAIPASLGKCIHLQDINLSRNNLQGRISSAFGNL 194

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           SKL+ L L  N L  EIP  L    +L  + L  ND+
Sbjct: 195 SKLQALVLTSNRLTDEIPPSLGSSFSLRYVDLGNNDI 231

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 42/109 (38%), Positives = 56/109 (51%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ +DLSS   +G I P  C     +L  L L NN   G IPP L    +L +L+LS N 
Sbjct: 77  VIAIDLSSEGITGTISP--CIANLTSLMTLQLSNNSLHGSIPPKLGLLRKLRNLNLSMNS 134

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IPS L S S++  L L  N  +G IP  L     L+ + L  N+L
Sbjct: 135 LEGNIPSQLSSYSQIEILDLSSNSFQGAIPASLGKCIHLQDINLSRNNL 183

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 43/123 (34%), Positives = 65/123 (52%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F   SL + + LS N  +G +P D +  +  L  L +S N  SGE+P SL     +L  L
Sbjct: 604 FKITSLSQEMNLSHNYLTGGMP-DEVGNLINLNKLGISNNMLSGEIPSSLGQC-VTLEYL 661

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
           ++ SN F G I  +  +    +++E+ +  N  +GKIP  L+  S L  L+LSFN   G 
Sbjct: 662 EIQSNFFVGGIPQSFMKLV--SIKEMDISRNNLSGKIPQFLNLLSSLHDLNLSFNNFDGV 719

Query: 401 IPS 409
           IP+
Sbjct: 720 IPT 722

[71][TOP]
>UniRef100_A2WKS7 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2WKS7_ORYSI
          Length = 1051

 Score =  112 bits (280), Expect = 2e-23
 Identities = 72/169 (42%), Positives = 95/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LPP  G+ S L+SL LSSN   GE+P  +L ++R L++LD+  N FSGELP +L++   S
Sbjct: 92  LPPVIGNLSFLQSLNLSSNELYGEIP-PSLGRLRRLEILDIGGNSFSGELPANLSSC-IS 149

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +  L L+ N   G I P    N    LQ+L LQNN FTG IP +L+N S L  L++  N 
Sbjct: 150 MKNLGLAFNQLGGRI-PVELGNTLTQLQKLQLQNNSFTGPIPASLANLSLLQYLYMDNNN 208

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IP  LG  + LR+     N L G  P  L  + TL  L  + N L
Sbjct: 209 LEGLIPLDLGKAAALREFSFQQNSLSGIFPSSLWNLSTLTVLAANDNML 257

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 68/179 (37%), Positives = 95/179 (53%), Gaps = 3/179 (1%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLK-VLDLSFNEFSGELPE 184
           + +LE P+P   G    L  L LS+N  +G +P + +L++  L   LDLS+N  SG LP 
Sbjct: 454 YTNLEGPIPASLGKLKTLFVLDLSTNRLNGSIPKE-ILELPSLSWYLDLSYNYLSGPLPI 512

Query: 185 SLTNLSASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSE 358
            +  L A+L  L LS N  SG I  ++  CQ     L+ L L  N F G IP +L+N   
Sbjct: 513 EVATL-ANLNQLILSGNQLSGQIPDSIGNCQ----VLESLLLDKNSFEGGIPQSLTNLKG 567

Query: 359 LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  L+L+ N LSG IP ++G +  L+ L L  N   G IP  L  +  L  L + FN+L
Sbjct: 568 LNILNLTMNKLSGRIPDTIGRIGNLQQLFLAQNNFSGPIPATLQNLTMLWKLDVSFNNL 626

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 61/164 (37%), Positives = 87/164 (53%), Gaps = 1/164 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +CS L+ L +S N+FSG+LP   +     L  L L  N  SG +PE + NL   L TLDL
Sbjct: 346 NCSQLQQLVISDNSFSGQLPNSVVNLSTTLHKLYLDNNSISGSIPEDIGNL-IGLDTLDL 404

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
              + SG I  ++     + L E+ L N   +G IP ++ N + L  L+  +  L G IP
Sbjct: 405 GFTSLSGVIPASI--GKLSNLVEVALYNTSLSGLIPSSIGNLTNLNRLYAYYTNLEGPIP 462

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE-TLILDFNDL 535
           +SLG L  L  L L  N L G IP+E++ + +L   L L +N L
Sbjct: 463 ASLGKLKTLFVLDLSTNRLNGSIPKEILELPSLSWYLDLSYNYL 506

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 64/175 (36%), Positives = 88/175 (50%), Gaps = 6/175 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG------ELPESL 190
           +P    + S L  + L  N FSG +P  T+ +++ L+ L L  N          E   SL
Sbjct: 286 IPSSLFNLSSLTIVLLYGNRFSGFVP-PTVGRLKSLRRLYLYGNRLEANNRKGWEFITSL 344

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           TN S  L  L +S N+FSG  LPN   N   TL +LYL NN  +G IP  + N   L +L
Sbjct: 345 TNCS-QLQQLVISDNSFSGQ-LPNSVVNLSTTLHKLYLDNNSISGSIPEDIGNLIGLDTL 402

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L F  LSG IP+S+G LS L ++ L+   L G IP  +  +  L  L   + +L
Sbjct: 403 DLGFTSLSGVIPASIGKLSNLVEVALYNTSLSGLIPSSIGNLTNLNRLYAYYTNL 457

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 63/181 (34%), Positives = 93/181 (51%), Gaps = 7/181 (3%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL    P    + S L  LA + N   G +P +   K  G++   L+ N+FSG +P SL 
Sbjct: 232 SLSGIFPSSLWNLSTLTVLAANDNMLQGSIPANIGDKFPGIQYFGLADNQFSGVIPSSLF 291

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL------QNNGFTGKIPPTLSNCS 355
           NLS+  + L L  N FSG + P +      +L+ LYL       NN    +   +L+NCS
Sbjct: 292 NLSSLTIVL-LYGNRFSGFVPPTV--GRLKSLRRLYLYGNRLEANNRKGWEFITSLTNCS 348

Query: 356 ELVSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           +L  L +S N  SG +P+S+ +LS  L  L L  N + G IP+++  +  L+TL L F  
Sbjct: 349 QLQQLVISDNSFSGQLPNSVVNLSTTLHKLYLDNNSISGSIPEDIGNLIGLDTLDLGFTS 408

Query: 533 L 535
           L
Sbjct: 409 L 409

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 53/127 (41%), Positives = 72/127 (56%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           PLP    + + L  L LS N  SG++P D++   + L+ L L  N F G +P+SLTNL  
Sbjct: 509 PLPIEVATLANLNQLILSGNQLSGQIP-DSIGNCQVLESLLLDKNSFEGGIPQSLTNLKG 567

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  L+L+ N  SG I P+      N LQ+L+L  N F+G IP TL N + L  L +SFN
Sbjct: 568 -LNILNLTMNKLSGRI-PDTIGRIGN-LQQLFLAQNNFSGPIPATLQNLTMLWKLDVSFN 624

Query: 386 YLSGTIP 406
            L G +P
Sbjct: 625 NLQGEVP 631

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 54/147 (36%), Positives = 74/147 (50%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    + SLL+ L + +NN  G +P+D L K   L+      N  SG  P SL NLS 
Sbjct: 188 PIPASLANLSLLQYLYMDNNNLEGLIPLD-LGKAAALREFSFQQNSLSGIFPSSLWNLS- 245

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L  + N   G I  N+       +Q   L +N F+G IP +L N S L  + L  N
Sbjct: 246 TLTVLAANDNMLQGSIPANIGDKFPG-IQYFGLADNQFSGVIPSSLFNLSSLTIVLLYGN 304

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLE 466
             SG +P ++G L  LR L L+ N LE
Sbjct: 305 RFSGFVPPTVGRLKSLRRLYLYGNRLE 331

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 33/80 (41%), Positives = 43/80 (53%)
 Frame = +2

Query: 296 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 475
           L L +    G +PP + N S L SL+LS N L G IP SLG L +L  L +  N   GE+
Sbjct: 81  LTLPSGNLAGGLPPVIGNLSFLQSLNLSSNELYGEIPPSLGRLRRLEILDIGGNSFSGEL 140

Query: 476 PQELMYVKTLETLILDFNDL 535
           P  L    +++ L L FN L
Sbjct: 141 PANLSSCISMKNLGLAFNQL 160

[72][TOP]
>UniRef100_B9NFQ7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFQ7_POPTR
          Length = 1178

 Score =  112 bits (279), Expect = 2e-23
 Identities = 68/174 (39%), Positives = 101/174 (58%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L   +PP  G C+ L  L L+ N  SGELP+ +L  +  +  + LS N  SGE+  +L 
Sbjct: 324 ALNSTIPPELGLCTNLTYLTLADNQLSGELPL-SLSNLAKIADMGLSENSLSGEISPTLI 382

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           +    L++L + +N FSG I P +       LQ L+L NN F+G IPP + N  EL+SL 
Sbjct: 383 SNWTELISLQVQNNLFSGNIPPEI--GKLTMLQYLFLYNNTFSGSIPPEIGNLKELLSLD 440

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N LSG +P +L +L+ L+ L L+ N + G+IP E+  +  L+ L L+ N L
Sbjct: 441 LSGNQLSGPLPPALWNLTNLQILNLFSNNINGKIPPEVGNLTMLQILDLNTNQL 494

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 62/168 (36%), Positives = 94/168 (55%), Gaps = 1/168 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G  ++L+ L L +N FSG +P + +  ++ L  LDLS N+ SG LP +L NL+ +
Sbjct: 402 IPPEIGKLTMLQYLFLYNNTFSGSIPPE-IGNLKELLSLDLSGNQLSGPLPPALWNLT-N 459

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+L SNN +G I P +       LQ L L  N   G++P T+S+ + L S++L  N 
Sbjct: 460 LQILNLFSNNINGKIPPEV--GNLTMLQILDLNTNQLHGELPLTISDITSLTSINLFGNN 517

Query: 389 LSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG+IPS  G  +  L       N   GE+P EL   ++L+   ++ N
Sbjct: 518 LSGSIPSDFGKYMPSLAYASFSNNSFSGELPPELCRGRSLQQFTVNSN 565

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 56/144 (38%), Positives = 85/144 (59%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           LE+L L +N+F G L  + + K+  LK + L +N  SG++PES+ ++S  L  ++L  N+
Sbjct: 243 LEALNLYNNSFQGPLSSN-ISKLSNLKNISLQYNLLSGQIPESIGSISG-LQIVELFGNS 300

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           F G I P++ Q     L++L L+ N     IPP L  C+ L  L L+ N LSG +P SL 
Sbjct: 301 FQGNIPPSIGQ--LKHLEKLDLRMNALNSTIPPELGLCTNLTYLTLADNQLSGELPLSLS 358

Query: 419 SLSKLRDLKLWLNMLEGEIPQELM 490
           +L+K+ D+ L  N L GEI   L+
Sbjct: 359 NLAKIADMGLSENSLSGEISPTLI 382

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 57/151 (37%), Positives = 82/151 (54%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P    + + L SL + +N FSG +P + + K+  L+ L L  N FSG +P  + NL   L
Sbjct: 379 PTLISNWTELISLQVQNNLFSGNIPPE-IGKLTMLQYLFLYNNTFSGSIPPEIGNLK-EL 436

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
           L+LDLS N  SGP+ P L       LQ L L +N   GKIPP + N + L  L L+ N L
Sbjct: 437 LSLDLSGNQLSGPLPPALWN--LTNLQILNLFSNNINGKIPPEVGNLTMLQILDLNTNQL 494

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
            G +P ++  ++ L  + L+ N L G IP +
Sbjct: 495 HGELPLTISDITSLTSINLFGNNLSGSIPSD 525

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 62/191 (32%), Positives = 89/191 (46%), Gaps = 22/191 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTL----------------------LKMRGLKV 142
           +P      + L+ L+L +NN +G +P                            M  L+ 
Sbjct: 137 IPVEISQLTELQYLSLYNNNLNGIIPFQLANLPKVRHLDLGANYLENPDWSNFSMPSLEY 196

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           L    NE + E P  +TN   +L  LDLS N F+G I P L       L+ L L NN F 
Sbjct: 197 LSFFLNELTAEFPHFITNCR-NLTFLDLSLNKFTGQI-PELVYTNLGKLEALNLYNNSFQ 254

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G +   +S  S L ++ L +N LSG IP S+GS+S L+ ++L+ N  +G IP  +  +K 
Sbjct: 255 GPLSSNISKLSNLKNISLQYNLLSGQIPESIGSISGLQIVELFGNSFQGNIPPSIGQLKH 314

Query: 503 LETLILDFNDL 535
           LE L L  N L
Sbjct: 315 LEKLDLRMNAL 325

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 70/197 (35%), Positives = 97/197 (49%), Gaps = 28/197 (14%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLA---LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL 199
            +P  FG    + SLA    S+N+FSGELP + L + R L+   ++ N F+G LP  L N 
Sbjct: 522  IPSDFGK--YMPSLAYASFSNNSFSGELPPE-LCRGRSLQQFTVNSNSFTGSLPTCLRNC 578

Query: 200  SA-----------------------SLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYL 304
            S                        +L+ + LS N F G I P+   C+N    L  L +
Sbjct: 579  SELSRVRLEKNRFTGNITDAFGVLPNLVFVALSDNQFIGEISPDWGECKN----LTNLQM 634

Query: 305  QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
              N  +G+IP  L    +L  L L  N L+G IP+ LG+LS+L  L L  N L GE+PQ 
Sbjct: 635  DGNRISGEIPAELGKLPQLRVLSLGSNDLAGRIPAELGNLSRLFMLNLSNNQLTGEVPQS 694

Query: 485  LMYVKTLETLILDFNDL 535
            L  ++ LE+L L  N L
Sbjct: 695  LTSLEGLESLDLSDNKL 711

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 61/179 (34%), Positives = 86/179 (48%), Gaps = 1/179 (0%)
 Frame = +2

Query: 2   SLFLS-LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGEL 178
           S FL+ L    P F  +C  L  L LS N F+G++P      +  L+ L+L  N F G L
Sbjct: 198 SFFLNELTAEFPHFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSFQGPL 257

Query: 179 PESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSE 358
             +++ LS +L  + L  N  SG I  ++     + LQ + L  N F G IPP++     
Sbjct: 258 SSNISKLS-NLKNISLQYNLLSGQIPESI--GSISGLQIVELFGNSFQGNIPPSIGQLKH 314

Query: 359 LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  L L  N L+ TIP  LG  + L  L L  N L GE+P  L  +  +  + L  N L
Sbjct: 315 LEKLDLRMNALNSTIPPELGLCTNLTYLTLADNQLSGELPLSLSNLAKIADMGLSENSL 373

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 63/159 (39%), Positives = 81/159 (50%)
 Frame = +2

Query: 41   FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
            FG    L  +ALS N F GE+  D   + + L  L +  N  SGE+P  L  L   L  L
Sbjct: 599  FGVLPNLVFVALSDNQFIGEISPDWG-ECKNLTNLQMDGNRISGEIPAELGKLP-QLRVL 656

Query: 221  DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
             L SN+ +G I   L     + L  L L NN  TG++P +L++   L SL LS N L+G 
Sbjct: 657  SLGSNDLAGRIPAEL--GNLSRLFMLNLSNNQLTGEVPQSLTSLEGLESLDLSDNKLTGN 714

Query: 401  IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 517
            I   LGS  KL  L L  N L GEIP EL  + +L  L+
Sbjct: 715  ISKELGSYEKLSSLDLSHNNLAGEIPFELGNLNSLRYLL 753

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 52/134 (38%), Positives = 74/134 (55%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    S   LESL LS N  +G +  + L     L  LDLS N  +GE+P  L NL++ 
Sbjct: 691  VPQSLTSLEGLESLDLSDNKLTGNISKE-LGSYEKLSSLDLSHNNLAGEIPFELGNLNSL 749

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               LDLSSN+ SG I  N  +   + L+ L + +N  +G+IP +LS+   L S   S+N 
Sbjct: 750  RYLLDLSSNSLSGAIPQNFAK--LSQLEILNVSHNHLSGRIPDSLSSMRSLSSFDFSYNE 807

Query: 389  LSGTIPSSLGSLSK 430
            L+G IP+  GS+ K
Sbjct: 808  LTGPIPT--GSIFK 819

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 54/187 (28%), Positives = 82/187 (43%), Gaps = 22/187 (11%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 214
           PF G    L    + +N  +G +P   +  +  L  LDLS N F G +P  ++ L+  L 
Sbjct: 95  PFTG----LTRFDIQNNKVNGTIP-SAIGSLSNLTHLDLSVNFFEGSIPVEISQLT-ELQ 148

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQEL---YLQN------------------NGFTGKI 331
            L L +NN +G I   L   PK    +L   YL+N                  N  T + 
Sbjct: 149 YLSLYNNNLNGIIPFQLANLPKVRHLDLGANYLENPDWSNFSMPSLEYLSFFLNELTAEF 208

Query: 332 PPTLSNCSELVSLHLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQELMYVKTLE 508
           P  ++NC  L  L LS N  +G IP  +  +L KL  L L+ N  +G +   +  +  L+
Sbjct: 209 PHFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSFQGPLSSNISKLSNLK 268

Query: 509 TLILDFN 529
            + L +N
Sbjct: 269 NISLQYN 275

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 38/117 (32%), Positives = 58/117 (49%)
 Frame = +2

Query: 185 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
           S ++ S ++   +L S N +G  L +    P   L    +QNN   G IP  + + S L 
Sbjct: 66  SCSSTSRTVSQTNLRSLNITGT-LAHFNFTPFTGLTRFDIQNNKVNGTIPSAIGSLSNLT 124

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L LS N+  G+IP  +  L++L+ L L+ N L G IP +L  +  +  L L  N L
Sbjct: 125 HLDLSVNFFEGSIPVEISQLTELQYLSLYNNNLNGIIPFQLANLPKVRHLDLGANYL 181

[73][TOP]
>UniRef100_B9IBE5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IBE5_POPTR
          Length = 1220

 Score =  112 bits (279), Expect = 2e-23
 Identities = 67/173 (38%), Positives = 100/173 (57%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L   +P   G CS L  L LSSN+  G LP+ ++  +  ++   +S N+ SG +  SL +
Sbjct: 318 LNSSIPEELGLCSNLTYLELSSNSLIGALPL-SMASLTQIREFGISDNKLSGNIHPSLLS 376

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
             + L++L L  NNFSG + P +     + L+ LYL  N  +G IPP + N S L+ L L
Sbjct: 377 NWSELVSLQLQINNFSGKVPPQI--GTLHKLKLLYLFQNRLSGPIPPEIGNLSNLIELQL 434

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           + N+ +G+IP ++G+LS L  L L  N L G++P EL  +K+LE L L  NDL
Sbjct: 435 ADNFFTGSIPPTIGNLSSLTKLILPYNQLNGKLPPELGNIKSLEELDLSENDL 487

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 61/169 (36%), Positives = 91/169 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ S L  L L  N  +G+LP + L  ++ L+ LDLS N+  G LP S+T L  +
Sbjct: 443 IPPTIGNLSSLTKLILPYNQLNGKLPPE-LGNIKSLEELDLSENDLQGTLPLSITGLR-N 500

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L    ++SNNFSG I  +      + L+      N F+GK+PP + N  +L+ L  + N 
Sbjct: 501 LNLFYVASNNFSGSIPEDF---GPDFLRNATFSYNNFSGKLPPGICNGGKLIYLAANRNN 557

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IPSSL + + L  ++L  N+L+G+I         LE + L  N L
Sbjct: 558 LVGPIPSSLRNCTGLTRVRLEQNLLDGDISNAFGMYPNLEYIDLGDNRL 606

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 63/190 (33%), Positives = 93/190 (48%), Gaps = 23/190 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + L SL LSSNNF+ ++P + +  ++ L+VL L  N  +G +P  L+NL   
Sbjct: 106 IPSGIGNATKLISLDLSSNNFTNQIPPE-IGNLKELQVLRLYNNSLTGPIPHQLSNLQ-K 163

Query: 209 LLTLDLSSNNFSGP----------------------ILPNLCQNPKNTLQELYLQNNGFT 322
           L  LDLS+N    P                       +P       N L  L L +N  T
Sbjct: 164 LWLLDLSANYLRDPDPVQFKGMASLTELRLSYILLEAVPAFIAECPN-LIFLDLSDNLIT 222

Query: 323 GKIP-PTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           G+IP P LS    L  L+L+ N + G + +++G+   LR L+L +N L G IP E+  + 
Sbjct: 223 GQIPMPLLSRLKRLEFLNLTKNSVEGPLSTNIGNFRNLRHLRLGMNKLNGTIPYEIGLLS 282

Query: 500 TLETLILDFN 529
            LE L L  N
Sbjct: 283 NLEVLELHEN 292

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 57/153 (37%), Positives = 81/153 (52%)
 Frame = +2

Query: 20   ELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL 199
            ++P+  F  S S L    LS+N  SG +P +  + +  L+ LD S N  SG +PE L + 
Sbjct: 657  KIPIELF--SSSKLNRFNLSNNQLSGHIPEEVGM-LSQLQYLDFSQNNLSGRIPEELGDC 713

Query: 200  SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
             A L+ LDLS+N  +G  +P    N       L L  N  TG+I   L   + L  L++S
Sbjct: 714  QA-LIFLDLSNNRLNGT-MPYQIGNLVALQIVLDLSQNLITGEISSQLRKLTRLEILNIS 771

Query: 380  FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
             N+LSG IPSSL  L  L+ + +  N LEG +P
Sbjct: 772  HNHLSGPIPSSLQDLLSLQQVDISHNNLEGPLP 804

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 52/169 (30%), Positives = 83/169 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P F   C  L  L LS N  +G++PM  L +++ L+ L+L+ N   G L  ++ N   +
Sbjct: 201 VPAFIAECPNLIFLDLSDNLITGQIPMPLLSRLKRLEFLNLTKNSVEGPLSTNIGNFR-N 259

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N  +G I   +     + L+ L L  NGF G +P ++ N   L +L+L  + 
Sbjct: 260 LRHLRLGMNKLNGTIPYEI--GLLSNLEVLELHENGFDGPMPSSVGNLRMLRNLNLKLSG 317

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+ +IP  LG  S L  L+L  N L G +P  +  +  +    +  N L
Sbjct: 318 LNSSIPEELGLCSNLTYLELSSNSLIGALPLSMASLTQIREFGISDNKL 366

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 58/169 (34%), Positives = 79/169 (46%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            LPP   +   L  LA + NN  G +P  +L    GL  + L  N   G++  +   +  +
Sbjct: 538  LPPGICNGGKLIYLAANRNNLVGPIP-SSLRNCTGLTRVRLEQNLLDGDISNAF-GMYPN 595

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  +DL  N  SG +  N  Q     L    +  N  +G IPP L N +EL +L LS N 
Sbjct: 596  LEYIDLGDNRLSGMLSSNWGQC--TILSNFRIAGNIMSGNIPPELGNLTELQNLDLSGNQ 653

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L G IP  L S SKL    L  N L G IP+E+  +  L+ L    N+L
Sbjct: 654  LIGKIPIELFSSSKLNRFNLSNNQLSGHIPEEVGMLSQLQYLDFSQNNL 702

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 55/163 (33%), Positives = 80/163 (49%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           G  S++E + L ++   G L          L  L+L+ N   G++P  + N +  L++LD
Sbjct: 63  GEGSIIE-INLENSGLDGTLDRFDSSSFPNLSSLNLNLNNLVGDIPSGIGN-ATKLISLD 120

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           LSSNNF+  I P +       LQ L L NN  TG IP  LSN  +L  L LS NYL    
Sbjct: 121 LSSNNFTNQIPPEI--GNLKELQVLRLYNNSLTGPIPHQLSNLQKLWLLDLSANYLRDPD 178

Query: 404 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           P     ++ L +L+L   +LE  +P  +     L  + LD +D
Sbjct: 179 PVQFKGMASLTELRLSYILLEA-VPAFIAECPNL--IFLDLSD 218

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 58/170 (34%), Positives = 79/170 (46%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+P    +C+ L  + L  N   G++  +       L+ +DL  N  SG L  +    + 
Sbjct: 561  PIPSSLRNCTGLTRVRLEQNLLDGDIS-NAFGMYPNLEYIDLGDNRLSGMLSSNWGQCTI 619

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
             L    ++ N  SG I P L       LQ L L  N   GKIP  L + S+L   +LS N
Sbjct: 620  -LSNFRIAGNIMSGNIPPEL--GNLTELQNLDLSGNQLIGKIPIELFSSSKLNRFNLSNN 676

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             LSG IP  +G LS+L+ L    N L G IP+EL   + L  L L  N L
Sbjct: 677  QLSGHIPEEVGMLSQLQYLDFSQNNLSGRIPEELGDCQALIFLDLSNNRL 726

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 56/163 (34%), Positives = 75/163 (46%)
 Frame = +2

Query: 41   FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
            FG    LE + L  N  SG L  +   +   L    ++ N  SG +P  L NL+  L  L
Sbjct: 590  FGMYPNLEYIDLGDNRLSGMLSSNWG-QCTILSNFRIAGNIMSGNIPPELGNLT-ELQNL 647

Query: 221  DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
            DLS N   G I   L  + K  L    L NN  +G IP  +   S+L  L  S N LSG 
Sbjct: 648  DLSGNQLIGKIPIELFSSSK--LNRFNLSNNQLSGHIPEEVGMLSQLQYLDFSQNNLSGR 705

Query: 401  IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            IP  LG    L  L L  N L G +P ++  +  L+ ++LD +
Sbjct: 706  IPEELGDCQALIFLDLSNNRLNGTMPYQIGNLVALQ-IVLDLS 747

[74][TOP]
>UniRef100_Q0E2V2 Os02g0211200 protein n=1 Tax=Oryza sativa Japonica Group
            RepID=Q0E2V2_ORYSJ
          Length = 1131

 Score =  111 bits (278), Expect = 3e-23
 Identities = 68/168 (40%), Positives = 97/168 (57%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ + L    L  NNF+G +P + L + R L+ LDLS N F   LP  + N+S+ 
Sbjct: 554  IPDSIGNLAQLTEFHLDGNNFNGSIPSN-LGQWRQLEKLDLSHNSFGESLPSEVFNISSL 612

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              +LDLS N F+GPI P    N  N L  + + NN  TG+IP TL NC  L  LH+  N 
Sbjct: 613  SQSLDLSHNLFTGPI-PLEIGNLIN-LGSISISNNRLTGEIPSTLGNCVLLEYLHMEGNL 670

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            L+G+IP S  +L  +++L L  N L G++P+ L  + +L+ L L FND
Sbjct: 671  LTGSIPQSFMNLKSIKELDLSRNSLSGKVPEFLTLLSSLQKLNLSFND 718

 Score =  102 bits (255), Expect = 1e-20
 Identities = 67/173 (38%), Positives = 98/173 (56%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P  FG+   L++L LSSN   G++P   L        ++L  N+ +G +PE L N
Sbjct: 186 LEGSIPTGFGTLPELKTLDLSSNALRGDIP-PLLGSSPSFVYVNLGGNQLTGGIPEFLAN 244

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S+SL  L L+ N+ +G I P L  +  +TL+ +YL  N   G IPP  +  + +  L L
Sbjct: 245 -SSSLQVLRLTQNSLTGEIPPALFNS--STLRTIYLDRNNLVGSIPPVTAIAAPIQYLTL 301

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             N L+G IP+SLG+LS L  + L  N L G IP+ L  + TLE L+L +N+L
Sbjct: 302 EQNKLTGGIPASLGNLSSLVHVSLKANNLVGSIPESLSKIPTLERLVLTYNNL 354

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 66/169 (39%), Positives = 93/169 (55%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP  G+ S L  L+L+ NN SG +P D++  +  L    L  N F+G +P +L      
Sbjct: 530  IPPTIGNLSNLLVLSLAQNNLSGLIP-DSIGNLAQLTEFHLDGNNFNGSIPSNLGQWR-Q 587

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  LDLS N+F G  LP+   N  +  Q L L +N FTG IP  + N   L S+ +S N 
Sbjct: 588  LEKLDLSHNSF-GESLPSEVFNISSLSQSLDLSHNLFTGPIPLEIGNLINLGSISISNNR 646

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G IPS+LG+   L  L +  N+L G IPQ  M +K+++ L L  N L
Sbjct: 647  LTGEIPSTLGNCVLLEYLHMEGNLLTGSIPQSFMNLKSIKELDLSRNSL 695

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 68/167 (40%), Positives = 87/167 (52%), Gaps = 2/167 (1%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNF-SGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P FGS   L+ L L  N   +G+   + +L     LK L L  N   G LP S+ NL + 
Sbjct: 432 PSFGSLPNLQDLDLGYNQLEAGDWSFLSSLANCTQLKKLALDANFLQGTLPSSVGNLPSQ 491

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N  SG I P+   N K+ L  LYL  N F+G IPPT+ N S L+ L L+ N 
Sbjct: 492 LNWLWLRQNRLSGAI-PSEIGNLKS-LSVLYLDENMFSGSIPPTIGNLSNLLVLSLAQNN 549

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG IP S+G+L++L +  L  N   G IP  L   + LE L L  N
Sbjct: 550 LSGLIPDSIGNLAQLTEFHLDGNNFNGSIPSNLGQWRQLEKLDLSHN 596

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 69/193 (35%), Positives = 94/193 (48%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   + S + SL LS N F G++P + L ++R +  L+LS N   G +P+ L++ S +
Sbjct: 94  IPPCIANLSSITSLDLSRNAFLGKIPSE-LGRLRQISYLNLSINSLEGRIPDELSSCS-N 151

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS+N+  G I  +L Q     LQ++ L NN   G IP       EL +L LS N 
Sbjct: 152 LKVLGLSNNSLQGEIPQSLTQCTH--LQQVILYNNKLEGSIPTGFGTLPELKTLDLSSNA 209

Query: 389 LSGTIPSSLGS------------------------LSKLRDLKLWLNMLEGEIPQELMYV 496
           L G IP  LGS                         S L+ L+L  N L GEIP  L   
Sbjct: 210 LRGDIPPLLGSSPSFVYVNLGGNQLTGGIPEFLANSSSLQVLRLTQNSLTGEIPPALFNS 269

Query: 497 KTLETLILDFNDL 535
            TL T+ LD N+L
Sbjct: 270 STLRTIYLDRNNL 282

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 61/169 (36%), Positives = 86/169 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  GS      + L  N  +G +P + L     L+VL L+ N  +GE+P +L N S++
Sbjct: 214 IPPLLGSSPSFVYVNLGGNQLTGGIP-EFLANSSSLQVLRLTQNSLTGEIPPALFN-SST 271

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L T+ L  NN  G I P         +Q L L+ N  TG IP +L N S LV + L  N 
Sbjct: 272 LRTIYLDRNNLVGSIPPVTAIAAP--IQYLTLEQNKLTGGIPASLGNLSSLVHVSLKANN 329

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G+IP SL  +  L  L L  N L G +PQ +  + +L+ L +  N L
Sbjct: 330 LVGSIPESLSKIPTLERLVLTYNNLSGHVPQAIFNISSLKYLSMANNSL 378

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 59/170 (34%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP   + S L ++ L  NN  G +P  T +    ++ L L  N+ +G +P SL 
Sbjct: 257 SLTGEIPPALFNSSTLRTIYLDRNNLVGSIPPVTAI-AAPIQYLTLEQNKLTGGIPASLG 315

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NLS SL+ + L +NN  G I  +L + P  TL+ L L  N  +G +P  + N S L  L 
Sbjct: 316 NLS-SLVHVSLKANNLVGSIPESLSKIP--TLERLVLTYNNLSGHVPQAIFNISSLKYLS 372

Query: 374 LSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
           ++ N L G +P  +G+ L  L  L L    L G IP  L  +  LE + L
Sbjct: 373 MANNSLIGQLPPDIGNRLPNLEALILSTTQLNGPIPASLRNMSKLEMVYL 422

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 60/164 (36%), Positives = 84/164 (51%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           GS S   + + +  N+ G    +T  ++R +  L++S    SG +P  + NLS S+ +LD
Sbjct: 51  GSLSSWSNTSQNFCNWQGVSCNNTQTQLR-VMALNVSSKGLSGSIPPCIANLS-SITSLD 108

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           LS N F G I   L +     +  L L  N   G+IP  LS+CS L  L LS N L G I
Sbjct: 109 LSRNAFLGKIPSELGR--LRQISYLNLSINSLEGRIPDELSSCSNLKVLGLSNNSLQGEI 166

Query: 404 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           P SL   + L+ + L+ N LEG IP     +  L+TL L  N L
Sbjct: 167 PQSLTQCTHLQQVILYNNKLEGSIPTGFGTLPELKTLDLSSNAL 210

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 52/140 (37%), Positives = 75/140 (53%), Gaps = 2/140 (1%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           +L +SS   SG +P   +  +  +  LDLS N F G++P  L  L   +  L+LS N+  
Sbjct: 82  ALNVSSKGLSGSIP-PCIANLSSITSLDLSRNAFLGKIPSELGRLR-QISYLNLSINSLE 139

Query: 245 GPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           G I   L  C N    L+ L L NN   G+IP +L+ C+ L  + L  N L G+IP+  G
Sbjct: 140 GRIPDELSSCSN----LKVLGLSNNSLQGEIPQSLTQCTHLQQVILYNNKLEGSIPTGFG 195

Query: 419 SLSKLRDLKLWLNMLEGEIP 478
           +L +L+ L L  N L G+IP
Sbjct: 196 TLPELKTLDLSSNALRGDIP 215

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 62/220 (28%), Positives = 88/220 (40%), Gaps = 51/220 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P        LE L L+ NN SG +P   +  +  LK L ++ N   G+LP  + N   +
Sbjct: 334 IPESLSKIPTLERLVLTYNNLSGHVPQ-AIFNISSLKYLSMANNSLIGQLPPDIGNRLPN 392

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP----------------- 337
           L  L LS+   +GPI  +L    K  L+ +YL   G TG +P                  
Sbjct: 393 LEALILSTTQLNGPIPASLRNMSK--LEMVYLAAAGLTGIVPSFGSLPNLQDLDLGYNQL 450

Query: 338 ---------TLSNCSELVSLHLSFNYLSGT-------------------------IPSSL 415
                    +L+NC++L  L L  N+L GT                         IPS +
Sbjct: 451 EAGDWSFLSSLANCTQLKKLALDANFLQGTLPSSVGNLPSQLNWLWLRQNRLSGAIPSEI 510

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G+L  L  L L  NM  G IP  +  +  L  L L  N+L
Sbjct: 511 GNLKSLSVLYLDENMFSGSIPPTIGNLSNLLVLSLAQNNL 550

[75][TOP]
>UniRef100_C6ZRU4 Leucine-rich repeat transmembrane protein kinase n=1 Tax=Glycine
           max RepID=C6ZRU4_SOYBN
          Length = 955

 Score =  111 bits (278), Expect = 3e-23
 Identities = 63/168 (37%), Positives = 100/168 (59%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P  + +C  L+   +S N  SG++P D +  +  ++++DL++N+F+GE+P  +  LS SL
Sbjct: 364 PESYVTCKSLKRFRISMNRLSGKIP-DEVWAIPYVEIIDLAYNDFTGEVPSEI-GLSTSL 421

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             + L+ N FSG +   L       L++LYL NN F+G+IPP + +  +L SLHL  N L
Sbjct: 422 SHIVLTKNRFSGKLPSEL--GKLVNLEKLYLSNNNFSGEIPPEIGSLKQLSSLHLEENSL 479

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +G+IP+ LG  + L DL L  N L G IPQ +  + +L +L +  N L
Sbjct: 480 TGSIPAELGHCAMLVDLNLAWNSLSGNIPQSVSLMSSLNSLNISGNKL 527

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 62/169 (36%), Positives = 90/169 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP     C+ L  L L+ N   G +P   L  +R L+VLDLS N FSG +P S+ NL+  
Sbjct: 99  LPSEISRCTSLRVLNLTGNQLVGAIP--DLSGLRSLQVLDLSANYFSGSIPSSVGNLTG- 155

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L++L L  N ++   +P    N KN L  LYL  +   G IP +L     L +L +S N 
Sbjct: 156 LVSLGLGENEYNEGEIPGTLGNLKN-LAWLYLGGSHLIGDIPESLYEMKALETLDISRNK 214

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +SG +  S+  L  L  ++L+ N L GEIP EL  +  L+ + L  N++
Sbjct: 215 ISGRLSRSISKLENLYKIELFSNNLTGEIPAELANLTNLQEIDLSANNM 263

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 54/157 (34%), Positives = 77/157 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G  + L  + L+ N FSG+LP + L K+  L+ L LS N FSGE+P  + +L   
Sbjct: 411 VPSEIGLSTSLSHIVLTKNRFSGKLPSE-LGKLVNLEKLYLSNNNFSGEIPPEIGSL--- 466

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
                                     L  L+L+ N  TG IP  L +C+ LV L+L++N 
Sbjct: 467 ------------------------KQLSSLHLEENSLTGSIPAELGHCAMLVDLNLAWNS 502

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           LSG IP S+  +S L  L +  N L G IP+ L  +K
Sbjct: 503 LSGNIPQSVSLMSSLNSLNISGNKLSGSIPENLEAIK 539

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 56/167 (33%), Positives = 79/167 (47%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP   G+   L    L  NNFSGELP      MR L    +  N F+G +P +    S  
Sbjct: 267 LPEEIGNMKNLVVFQLYENNFSGELPAG-FADMRHLIGFSIYRNSFTGTIPGNFGRFSP- 324

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L ++D+S N FSG     LC+N K  L+ L    N F+G  P +   C  L    +S N 
Sbjct: 325 LESIDISENQFSGDFPKFLCENRK--LRFLLALQNNFSGTFPESYVTCKSLKRFRISMNR 382

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG IP  + ++  +  + L  N   GE+P E+    +L  ++L  N
Sbjct: 383 LSGKIPDEVWAIPYVEIIDLAYNDFTGEVPSEIGLSTSLSHIVLTKN 429

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 57/166 (34%), Positives = 77/166 (46%), Gaps = 3/166 (1%)
 Frame = +2

Query: 47  SCSLLESL---ALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 217
           S S LE+L    L SNN +GE+P + L  +  L+ +DLS N   G LPE + N+  +L+ 
Sbjct: 222 SISKLENLYKIELFSNNLTGEIPAE-LANLTNLQEIDLSANNMYGRLPEEIGNMK-NLVV 279

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
             L  NNFSG +           L    +  N FTG IP      S L S+ +S N  SG
Sbjct: 280 FQLYENNFSGELPAGFAD--MRHLIGFSIYRNSFTGTIPGNFGRFSPLESIDISENQFSG 337

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             P  L    KLR L    N   G  P+  +  K+L+   +  N L
Sbjct: 338 DFPKFLCENRKLRFLLALQNNFSGTFPESYVTCKSLKRFRISMNRL 383

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 51/168 (30%), Positives = 84/168 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + + L+ + LS+NN  G LP + +  M+ L V  L  N FSGELP    ++   
Sbjct: 243 IPAELANLTNLQEIDLSANNMYGRLP-EEIGNMKNLVVFQLYENNFSGELPAGFADMR-H 300

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+   +  N+F+G I  N  +   + L+ + +  N F+G  P  L    +L  L    N 
Sbjct: 301 LIGFSIYRNSFTGTIPGNFGRF--SPLESIDISENQFSGDFPKFLCENRKLRFLLALQNN 358

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            SGT P S  +   L+  ++ +N L G+IP E+  +  +E + L +ND
Sbjct: 359 FSGTFPESYVTCKSLKRFRISMNRLSGKIPDEVWAIPYVEIIDLAYND 406

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 48/129 (37%), Positives = 70/129 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP   G    LE L LS+NNFSGE+P + +  ++ L  L L  N  +G +P  L +  A 
Sbjct: 435 LPSELGKLVNLEKLYLSNNNFSGEIPPE-IGSLKQLSSLHLEENSLTGSIPAELGH-CAM 492

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L+L+ N+ SG I  ++  +  ++L  L +  N  +G IP  L    +L S+  S N 
Sbjct: 493 LVDLNLAWNSLSGNIPQSV--SLMSSLNSLNISGNKLSGSIPENL-EAIKLSSVDFSENQ 549

Query: 389 LSGTIPSSL 415
           LSG IPS L
Sbjct: 550 LSGRIPSGL 558

[76][TOP]
>UniRef100_A9SM26 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp.
           patens RepID=A9SM26_PHYPA
          Length = 786

 Score =  111 bits (278), Expect = 3e-23
 Identities = 71/169 (42%), Positives = 100/169 (59%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S+L  L LS NN +G +P + L K+  L+ LDLS N  +G++P  L+NLS S
Sbjct: 87  IPEELGTLSMLVGLNLSGNNLTGSIPAE-LAKLTELRSLDLSGNNLTGDIPSELSNLS-S 144

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L++LDL  NN +G I   L +   + L  L L  N   G IP  + N S L +L L  N 
Sbjct: 145 LVSLDLGMNNLTGGIPGGLVK--LSLLVSLDLSENNLVGDIPMGIGNLSALENLQLKANG 202

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP+ LG+L +L++L+L  N L G IP +L   K+LE L +  N+L
Sbjct: 203 LSGAIPAELGNLKQLKNLRLHDNYLTGFIPTQLASCKSLERLDVGANNL 251

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 65/194 (33%), Positives = 97/194 (50%), Gaps = 25/194 (12%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+CS L+ L LS+NN +  +P D+L     L++LDLS N+ +G +P S  NL  S
Sbjct: 570  IPASLGNCSGLKILMLSNNNLADVIP-DSLGNCSVLRLLDLSKNQLTGAIPSSFRNL-VS 627

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN------------------------- 313
              T+ L+SNN SG  +  L  +    L+ + L NN                         
Sbjct: 628  AETIFLASNNLSGDFV--LDMSKLTNLESVSLSNNLMAGDVFASLATLNATNNFTALSRN 685

Query: 314  GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
              +G IP  ++   ++ SL LS N   G IP+++G+L++L+ L L  N L G IPQ  + 
Sbjct: 686  NLSGVIPTDITKLVKMKSLDLSRNQFEGEIPTNMGALTQLQFLDLSNNRLNGSIPQSFIK 745

Query: 494  VKTLETLILDFNDL 535
            +  L TL L  N L
Sbjct: 746  ISNLATLFLANNSL 759

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 66/216 (30%), Positives = 91/216 (42%), Gaps = 47/216 (21%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    +C LL+++ +S N  +G +P +   K   L  L +  N+ +G +P S  +  + 
Sbjct: 424  IPASLANCPLLQNVGVSWNKLTGVIP-EAFSKSPKLMNLQVDHNKLTGSIPASFCSNWSD 482

Query: 209  LLTLDLSSNNFSGPI------LPNLCQ-----NPKNT----------------------- 286
            +  L   +NN +G I       PNL Q     NP  T                       
Sbjct: 483  MEILYFQNNNLTGTIPVMLGNCPNLQQLHVQENPHLTGIIPEELGRLQKLENLVAYDTRI 542

Query: 287  -------------LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS 427
                         LQ L L NN   G IP +L NCS L  L LS N L+  IP SLG+ S
Sbjct: 543  SGEIPASLGNCTRLQNLVLFNNTHNGTIPASLGNCSGLKILMLSNNNLADVIPDSLGNCS 602

Query: 428  KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             LR L L  N L G IP     + + ET+ L  N+L
Sbjct: 603  VLRLLDLSKNQLTGAIPSSFRNLVSAETIFLASNNL 638

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 54/150 (36%), Positives = 82/150 (54%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  F +    E++ L+SNN SG+  +D + K+  L+ + LS N  +G++  SL  L+A+
Sbjct: 618  IPSSFRNLVSAETIFLASNNLSGDFVLD-MSKLTNLESVSLSNNLMAGDVFASLATLNAT 676

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
                 LS NN SG I  ++ +  K  ++ L L  N F G+IP  +   ++L  L LS N 
Sbjct: 677  NNFTALSRNNLSGVIPTDITKLVK--MKSLDLSRNQFEGEIPTNMGALTQLQFLDLSNNR 734

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            L+G+IP S   +S L  L L  N L G IP
Sbjct: 735  LNGSIPQSFIKISNLATLFLANNSLSGAIP 764

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/151 (33%), Positives = 81/151 (53%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P  F +C  L+   +  N  +G +PM     ++ L VL    N+  G++ + L N SA
Sbjct: 327 PIPTGFANCPQLQGFLVGFNKINGTIPMG-FGNLQKLSVLYFQNNDIEGQI-DFLENCSA 384

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
             L +   +N+ +GP LP       + L  L++  N FTG+IP +L+NC  L ++ +S+N
Sbjct: 385 MGL-IHGENNHLTGP-LPRYFWPNCSHLTHLFVSGNNFTGEIPASLANCPLLQNVGVSWN 442

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            L+G IP +     KL +L++  N L G IP
Sbjct: 443 KLTGVIPEAFSKSPKLMNLQVDHNKLTGSIP 473

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 52/149 (34%), Positives = 72/149 (48%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    SC  LE L + +NN +G+L    L + R L  LD+S N   G +      L   
Sbjct: 231 IPTQLASCKSLERLDVGANNLTGKL-WPQLAQCRNLVDLDVSSNGLEGGIEPEFGTLGNL 289

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              L +  NNF+G I      N  N L+   + NN  TG IP   +NC +L    + FN 
Sbjct: 290 QNFLGMH-NNFNGTIPDTFGSNCSN-LRSFSVNNNKLTGPIPTGFANCPQLQGFLVGFNK 347

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEI 475
           ++GTIP   G+L KL  L    N +EG+I
Sbjct: 348 INGTIPMGFGNLQKLSVLYFQNNDIEGQI 376

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 41/97 (42%), Positives = 56/97 (57%)
 Frame = +2

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I PN+  +    L+ L L N+   G IP  L   S LV L+LS N L+G+IP+ L  L
Sbjct: 61  GGISPNI--SGLTVLRNLTLSNHFLRGSIPEELGTLSMLVGLNLSGNNLTGSIPAELAKL 118

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++LR L L  N L G+IP EL  + +L +L L  N+L
Sbjct: 119 TELRSLDLSGNNLTGDIPSELSNLSSLVSLDLGMNNL 155

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 52/171 (30%), Positives = 84/171 (49%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGS-CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           +P  FGS CS L S ++++N  +G +P         L+   + FN+ +G +P    NL  
Sbjct: 303 IPDTFGSNCSNLRSFSVNNNKLTGPIPTG-FANCPQLQGFLVGFNKINGTIPMGFGNLQ- 360

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL-SNCSELVSLHLSF 382
            L  L   +N+  G I  +  +N  + +  ++ +NN  TG +P     NCS L  L +S 
Sbjct: 361 KLSVLYFQNNDIEGQI--DFLENC-SAMGLIHGENNHLTGPLPRYFWPNCSHLTHLFVSG 417

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N  +G IP+SL +   L+++ +  N L G IP+       L  L +D N L
Sbjct: 418 NNFTGEIPASLANCPLLQNVGVSWNKLTGVIPEAFSKSPKLMNLQVDHNKL 468

[77][TOP]
>UniRef100_Q0JQL4 Os01g0153000 protein n=2 Tax=Oryza sativa Japonica Group
           RepID=Q0JQL4_ORYSJ
          Length = 1042

 Score =  111 bits (277), Expect = 4e-23
 Identities = 71/169 (42%), Positives = 96/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LPP  G+ + L    LSSN   GE+P  +L  ++ L++LDL  N FSG  P++L++   S
Sbjct: 76  LPPAIGNLTFLRWFNLSSNGLHGEIP-PSLGHLQHLRILDLGSNSFSGAFPDNLSSC-IS 133

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L L  N  SG I P    N    LQ+L+L NN FTG IP +L+N S L  L L FN+
Sbjct: 134 LINLTLGYNQLSGHI-PVKLGNTLTWLQKLHLGNNSFTGPIPASLANLSSLEFLKLDFNH 192

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IPSSLG++  L+ + L  N L GE P  +  +  L  L +  N L
Sbjct: 193 LKGLIPSSLGNIPNLQKIGLDGNSLSGEFPPSIWNLSKLTVLQVYENKL 241

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 59/167 (35%), Positives = 88/167 (52%), Gaps = 1/167 (0%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P    SC  L +L L  N  SG +P+     +  L+ L L  N F+G +P SL NLS SL
Sbjct: 125 PDNLSSCISLINLTLGYNQLSGHIPVKLGNTLTWLQKLHLGNNSFTGPIPASLANLS-SL 183

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             L L  N+  G ++P+   N  N LQ++ L  N  +G+ PP++ N S+L  L +  N L
Sbjct: 184 EFLKLDFNHLKG-LIPSSLGNIPN-LQKIGLDGNSLSGEFPPSIWNLSKLTVLQVYENKL 241

Query: 392 SGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            G+IP+++G  L  ++   L +N   G IP  L  + +L  + LD N
Sbjct: 242 KGSIPANIGDKLPNMQHFVLSVNQFSGVIPSSLFNLSSLTDVYLDGN 288

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 61/192 (31%), Positives = 93/192 (48%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + L  LA    +  G +P  TL K++ L  LDLS N  +G +P+ +  L + 
Sbjct: 421 IPSVIGNLTNLNILAAYDAHLEGPIPA-TLGKLKKLFALDLSINHLNGSVPKEIFELPSL 479

Query: 209 LLTLDLSSNNFSGPI-----------------------LPNLCQNPKNTLQELYLQNNGF 319
              L LS N  SGPI                       +P+   N +  L+ L L +N F
Sbjct: 480 SWFLILSDNTLSGPIPSEVGTLVNLNSIELSGNQLSDQIPDSIGNCE-VLEYLLLDSNSF 538

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
            G IP +L+    +  L+L+ N  SG+IP+++GS+  L+ L L  N L G IP+ L  + 
Sbjct: 539 EGSIPQSLTKLKGIAILNLTMNKFSGSIPNAIGSMGNLQQLCLAHNNLSGSIPETLQNLT 598

Query: 500 TLETLILDFNDL 535
            L  L + FN+L
Sbjct: 599 QLWHLDVSFNNL 610

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 56/164 (34%), Positives = 85/164 (51%), Gaps = 1/164 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +CS L+ L ++ N+F G+LP+  +     L+   L  N  SG +P  + NL   L TLDL
Sbjct: 330 NCSQLQQLDIAENSFIGQLPISIVNLSTTLQKFFLRGNSVSGSIPTDIGNL-IGLDTLDL 388

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            S + SG I  ++ +     +  LY  +   +G IP  + N + L  L     +L G IP
Sbjct: 389 GSTSLSGVIPESIGKLADLAIITLY--STRLSGLIPSVIGNLTNLNILAAYDAHLEGPIP 446

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE-TLILDFNDL 535
           ++LG L KL  L L +N L G +P+E+  + +L   LIL  N L
Sbjct: 447 ATLGKLKKLFALDLSINHLNGSVPKEIFELPSLSWFLILSDNTL 490

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 60/174 (34%), Positives = 85/174 (48%), Gaps = 5/174 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSN-----NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +PP  G    L  L+LSSN     N  G   + +L     L+ LD++ N F G+LP S+ 
Sbjct: 294 VPPTVGRLKSLVRLSLSSNRLEANNMKGWEFITSLANCSQLQQLDIAENSFIGQLPISIV 353

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NLS +L    L  N+ SG I  ++       L  L L +   +G IP ++   ++L  + 
Sbjct: 354 NLSTTLQKFFLRGNSVSGSIPTDI--GNLIGLDTLDLGSTSLSGVIPESIGKLADLAIIT 411

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L    LSG IPS +G+L+ L  L  +   LEG IP  L  +K L  L L  N L
Sbjct: 412 LYSTRLSGLIPSVIGNLTNLNILAAYDAHLEGPIPATLGKLKKLFALDLSINHL 465

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 57/168 (33%), Positives = 80/168 (47%), Gaps = 6/168 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG------ELPESL 190
           +P    + S L  + L  N FSG +P  T+ +++ L  L LS N          E   SL
Sbjct: 270 IPSSLFNLSSLTDVYLDGNKFSGFVP-PTVGRLKSLVRLSLSSNRLEANNMKGWEFITSL 328

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            N S  L  LD++ N+F G  LP    N   TLQ+ +L+ N  +G IP  + N   L +L
Sbjct: 329 ANCS-QLQQLDIAENSFIGQ-LPISIVNLSTTLQKFFLRGNSVSGSIPTDIGNLIGLDTL 386

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETL 514
            L    LSG IP S+G L+ L  + L+   L G IP  +  +  L  L
Sbjct: 387 DLGSTSLSGVIPESIGKLADLAIITLYSTRLSGLIPSVIGNLTNLNIL 434

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 51/144 (35%), Positives = 79/144 (54%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           SL   L LS N  SG +P + +  +  L  ++LS N+ S ++P+S+ N    L  L L S
Sbjct: 478 SLSWFLILSDNTLSGPIPSE-VGTLVNLNSIELSGNQLSDQIPDSIGNCEV-LEYLLLDS 535

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           N+F G I  +L +     +  L L  N F+G IP  + +   L  L L+ N LSG+IP +
Sbjct: 536 NSFEGSIPQSLTK--LKGIAILNLTMNKFSGSIPNAIGSMGNLQQLCLAHNNLSGSIPET 593

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQE 484
           L +L++L  L +  N L+G++P E
Sbjct: 594 LQNLTQLWHLDVSFNNLQGKVPDE 617

 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 59/179 (32%), Positives = 88/179 (49%), Gaps = 5/179 (2%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL    PP   + S L  L +  N   G +P +   K+  ++   LS N+FSG +P SL 
Sbjct: 216 SLSGEFPPSIWNLSKLTVLQVYENKLKGSIPANIGDKLPNMQHFVLSVNQFSGVIPSSLF 275

Query: 194 NLSASLLTLDLSSNNFSG---PILPNLCQNPKNTLQELYLQNNGFTG-KIPPTLSNCSEL 361
           NLS SL  + L  N FSG   P +  L    + +L    L+ N   G +   +L+NCS+L
Sbjct: 276 NLS-SLTDVYLDGNKFSGFVPPTVGRLKSLVRLSLSSNRLEANNMKGWEFITSLANCSQL 334

Query: 362 VSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L ++ N   G +P S+ +LS  L+   L  N + G IP ++  +  L+TL L    L
Sbjct: 335 QQLDIAENSFIGQLPISIVNLSTTLQKFFLRGNSVSGSIPTDIGNLIGLDTLDLGSTSL 393

[78][TOP]
>UniRef100_A7Q2G1 Chromosome chr1 scaffold_46, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7Q2G1_VITVI
          Length = 969

 Score =  111 bits (277), Expect = 4e-23
 Identities = 68/171 (39%), Positives = 105/171 (61%), Gaps = 1/171 (0%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+P   G  S LE L +SSN  +G +P  ++ K++ L+V+DLS N+ SG++P++ ++L  
Sbjct: 547  PIPLNIGDLSSLEVLDVSSNLLNGSIP-SSMSKLKDLRVIDLSNNQLSGKIPKNWSDLQ- 604

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
             L T+DLS N  SG I   +C   K++L +L L +N  TG++ P+L NC+ L SL L  N
Sbjct: 605  HLDTIDLSKNKLSGGIPSWMCS--KSSLTQLILGDNNLTGELTPSLQNCTGLSSLDLGNN 662

Query: 386  YLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              SG IP  +G  +  L  ++L  NML G+IP++L ++  L  L L  N+L
Sbjct: 663  RFSGEIPKWIGERMPSLEQMRLRGNMLTGDIPEQLCWLSHLHILDLAVNNL 713

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 62/176 (35%), Positives = 92/176 (52%), Gaps = 2/176 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           ++ L  P +  +   L  + L +   S  +P + L K+  L  LDLS N+  G+LP SL+
Sbjct: 452 NVSLKFPNWIRTQKRLHFITLKNVGISDTIP-EWLWKLYFLW-LDLSRNQLYGKLPNSLS 509

Query: 194 NLSASLLTLDLSSNNFSG--PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
              AS+L +DLS N   G  P+  N           L+L NN F+G IP  + + S L  
Sbjct: 510 FSPASVL-VDLSFNRLVGRLPLWFNATW--------LFLGNNSFSGPIPLNIGDLSSLEV 560

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L +S N L+G+IPSS+  L  LR + L  N L G+IP+    ++ L+T+ L  N L
Sbjct: 561 LDVSSNLLNGSIPSSMSKLKDLRVIDLSNNQLSGKIPKNWSDLQHLDTIDLSKNKL 616

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 68/214 (31%), Positives = 87/214 (40%), Gaps = 64/214 (29%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELP------MDTLLKMR------------------GL 136
            L P   +C+ L SL L +N FSGE+P      M +L +MR                   L
Sbjct: 644  LTPSLQNCTGLSSLDLGNNRFSGEIPKWIGERMPSLEQMRLRGNMLTGDIPEQLCWLSHL 703

Query: 137  KVLDLSFNEFSGELPESLTNLSAS------------------------------------ 208
             +LDL+ N  SG +P+ L NL+A                                     
Sbjct: 704  HILDLAVNNLSGFIPQCLGNLTALSFVALLNRNFDNLESHGSYSESMELVVKGQNMEFDS 763

Query: 209  ----LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
                L  +DLSSNN  G I   +     +TL  L L  N  TGKIP  +     L +L L
Sbjct: 764  ILPILNLIDLSSNNIWGEIPKEITN--LSTLGALNLSRNQLTGKIPEKIGAMQGLETLDL 821

Query: 377  SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            S+N LSG IP S  S++ L  L L  N L G IP
Sbjct: 822  SWNCLSGPIPPSTSSITSLNHLNLSHNRLSGPIP 855

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 49/112 (43%), Positives = 65/112 (58%)
 Frame = +2

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
           L+ L L  N F G+LP+SL  L  +L +LDLS N+F GP  PN  Q+  N L+ L L+ N
Sbjct: 294 LERLHLGGNRFGGQLPDSL-GLFKNLKSLDLSYNSFVGPF-PNSIQHLTN-LESLNLREN 350

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEG 469
             +G IP  + N   +  L LS N ++GTIP S+G L +L  L L  N  EG
Sbjct: 351 SISGPIPTWIGNLLRMKRLDLSNNLMNGTIPKSIGQLRELTVLYLNWNSWEG 402

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 64/170 (37%), Positives = 85/170 (50%)
 Frame = +2

Query: 20  ELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL 199
           +LP    F   S+L  + LS N   G LP+           L L  N FSG +P ++ +L
Sbjct: 503 KLPNSLSFSPASVL--VDLSFNRLVGRLPL-----WFNATWLFLGNNSFSGPIPLNIGDL 555

Query: 200 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           S SL  LD+SSN  +G I P+     K+ L+ + L NN  +GKIP   S+   L ++ LS
Sbjct: 556 S-SLEVLDVSSNLLNGSI-PSSMSKLKD-LRVIDLSNNQLSGKIPKNWSDLQHLDTIDLS 612

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N LSG IPS + S S L  L L  N L GE+   L     L +L L  N
Sbjct: 613 KNKLSGGIPSWMCSKSSLTQLILGDNNLTGELTPSLQNCTGLSSLDLGNN 662

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 54/166 (32%), Positives = 84/166 (50%), Gaps = 3/166 (1%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESL-TNLSASL 211
           F + + L  + LS NN S   P  +  +  +  L + D S      EL   L T  + SL
Sbjct: 235 FVNLTSLLVIDLSHNNLSTTFPGWLFNISTLTDLYLNDASIGSEGIELVNGLSTCANNSL 294

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             L L  N F G  LP+     KN L+ L L  N F G  P ++ + + L SL+L  N +
Sbjct: 295 ERLHLGGNRFGGQ-LPDSLGLFKN-LKSLDLSYNSFVGPFPNSIQHLTNLESLNLRENSI 352

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           SG IP+ +G+L +++ L L  N++ G IP+ +  ++ L  L L++N
Sbjct: 353 SGPIPTWIGNLLRMKRLDLSNNLMNGTIPKSIGQLRELTVLYLNWN 398

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 47/146 (32%), Positives = 73/146 (50%), Gaps = 18/146 (12%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSG------------------ELPMDTLLKMRGLKVLDLS 154
            +P   G+ + L  +AL + NF                     +  D++L +  L ++DLS
Sbjct: 717  IPQCLGNLTALSFVALLNRNFDNLESHGSYSESMELVVKGQNMEFDSILPI--LNLIDLS 774

Query: 155  FNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP 334
             N   GE+P+ +TNLS +L  L+LS N  +G I   +       L+ L L  N  +G IP
Sbjct: 775  SNNIWGEIPKEITNLS-TLGALNLSRNQLTGKIPEKI--GAMQGLETLDLSWNCLSGPIP 831

Query: 335  PTLSNCSELVSLHLSFNYLSGTIPSS 412
            P+ S+ + L  L+LS N LSG IP++
Sbjct: 832  PSTSSITSLNHLNLSHNRLSGPIPTT 857

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 43/128 (33%), Positives = 62/128 (48%), Gaps = 6/128 (4%)
 Frame = +2

Query: 170 GELPESLTNLS-ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK---IPP 337
           G+ P S++ ++  SLL +DLS NN S    P    N  +TL +LYL +     +   +  
Sbjct: 227 GDFPHSISFVNLTSLLVIDLSHNNLS-TTFPGWLFNI-STLTDLYLNDASIGSEGIELVN 284

Query: 338 TLSNCSE--LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLET 511
            LS C+   L  LHL  N   G +P SLG    L+ L L  N   G  P  + ++  LE+
Sbjct: 285 GLSTCANNSLERLHLGGNRFGGQLPDSLGLFKNLKSLDLSYNSFVGPFPNSIQHLTNLES 344

Query: 512 LILDFNDL 535
           L L  N +
Sbjct: 345 LNLRENSI 352

[79][TOP]
>UniRef100_A5BMU7 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BMU7_VITVI
          Length = 1241

 Score =  111 bits (277), Expect = 4e-23
 Identities = 72/174 (41%), Positives = 97/174 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P  F  C  L  L+LS N F+G +P   +  +  L+ L L+FN+ +G +P  + 
Sbjct: 195 SLTGEIPSNFSHCRELRGLSLSFNQFTGGIPQ-AIGSLCNLEELYLAFNKLTGGIPREIG 253

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NLS  L  L LSSN  SGPI   +     ++LQE+   NN  TG+IP  LS+C EL  L 
Sbjct: 254 NLS-KLNILQLSSNGISGPIPTEIFNI--SSLQEIDFSNNSLTGEIPSNLSHCRELRVLS 310

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSFN  +G IP ++GSLS L  L L  N L G IP+E+  +  L  L L  N +
Sbjct: 311 LSFNQFTGGIPQAIGSLSNLEGLYLSYNKLTGGIPREIGNLSNLNILQLGSNGI 364

 Score =  108 bits (269), Expect = 3e-22
 Identities = 67/169 (39%), Positives = 96/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS S LE L LS N  +G +P + +  +  L +L L  N  SG +P  + N+S S
Sbjct: 320 IPQAIGSLSNLEGLYLSYNKLTGGIPRE-IGNLSNLNILQLGSNGISGPIPAEIFNIS-S 377

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +D S+N+ SG +  ++C++  N LQ LYL  N  +G++P TLS C EL+ L L+ N 
Sbjct: 378 LQIIDFSNNSLSGSLPMDICKHLPN-LQGLYLLQNHLSGQLPTTLSLCGELLYLSLAVNK 436

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             G+IP  +G+LSKL D+ L  N L G IP     +  L+ L L  N L
Sbjct: 437 FRGSIPREIGNLSKLEDISLRSNSLVGSIPTSFGNLMALKYLDLGMNFL 485

 Score =  105 bits (262), Expect = 2e-21
 Identities = 69/169 (40%), Positives = 93/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S L +++LS+NN SG LP D       LK L+LS N  SG++P  L      
Sbjct: 103 IPATIFNISSLLNISLSNNNLSGSLPKDMCYANPKLKELNLSSNHLSGKIPTGLGQC-IQ 161

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + L+ N+F+G I PN   N    LQ L L+NN  TG+IP   S+C EL  L LSFN 
Sbjct: 162 LQVISLAYNDFTGSI-PNGIGNLVE-LQRLSLRNNSLTGEIPSNFSHCRELRGLSLSFNQ 219

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +G IP ++GSL  L +L L  N L G IP+E+  +  L  L L  N +
Sbjct: 220 FTGGIPQAIGSLCNLEELYLAFNKLTGGIPREIGNLSKLNILQLSSNGI 268

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 72/221 (32%), Positives = 106/221 (47%), Gaps = 48/221 (21%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           + LE  + P  G+ S L SL LS+N F   LP D + K + L+ L+L  N+  G +PE++
Sbjct: 1   MDLEGTIAPQVGNLSFLVSLDLSNNYFHDSLPKD-IGKCKELQQLNLFNNKLVGGIPEAI 59

Query: 191 TNLS-----------------------------------------------ASLLTLDLS 229
            NLS                                               +SLL + LS
Sbjct: 60  CNLSKLEELYLGNNELIGEIPKKMNHLQNLKVLSFPMNNLTGSIPATIFNISSLLNISLS 119

Query: 230 SNNFSGPILPNLC-QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
           +NN SG +  ++C  NPK  L+EL L +N  +GKIP  L  C +L  + L++N  +G+IP
Sbjct: 120 NNNLSGSLPKDMCYANPK--LKELNLSSNHLSGKIPTGLGQCIQLQVISLAYNDFTGSIP 177

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           + +G+L +L+ L L  N L GEIP    + + L  L L FN
Sbjct: 178 NGIGNLVELQRLSLRNNSLTGEIPSNFSHCRELRGLSLSFN 218

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 58/169 (34%), Positives = 91/169 (53%), Gaps = 1/169 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    + S L+ +  S+N+ SG LPMD    +  L+ L L  N  SG+LP +L+ L  
Sbjct: 367 PIPAEIFNISSLQIIDFSNNSLSGSLPMDICKHLPNLQGLYLLQNHLSGQLPTTLS-LCG 425

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            LL L L+ N F G I   +    K  L+++ L++N   G IP +  N   L  L L  N
Sbjct: 426 ELLYLSLAVNKFRGSIPREIGNLSK--LEDISLRSNSLVGSIPTSFGNLMALKYLDLGMN 483

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFN 529
           +L+GT+P ++ ++S+L+ L L  N L G +P  +  ++  LE L +  N
Sbjct: 484 FLTGTVPEAIFNISELQILVLVQNHLSGSLPPSIGTWLPDLEGLYIGSN 532

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 58/161 (36%), Positives = 91/161 (56%), Gaps = 5/161 (3%)
 Frame = +2

Query: 5   LFLSLEL-----PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS 169
           L+LSL +      +P   G+ S LE ++L SN+  G +P  +   +  LK LDL  N  +
Sbjct: 428 LYLSLAVNKFRGSIPREIGNLSKLEDISLRSNSLVGSIPT-SFGNLMALKYLDLGMNFLT 486

Query: 170 GELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN 349
           G +PE++ N+S  L  L L  N+ SG + P++     + L+ LY+ +N F+G IP ++SN
Sbjct: 487 GTVPEAIFNIS-ELQILVLVQNHLSGSLPPSIGTWLPD-LEGLYIGSNKFSGTIPMSISN 544

Query: 350 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 472
            S+L+ L +  N  +G +P  LG+L+KL  L L  N L  E
Sbjct: 545 MSKLIQLQVWDNSFTGNVPKDLGNLTKLEVLNLAANQLTNE 585

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 61/150 (40%), Positives = 81/150 (54%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  FG    L+ L L SN  +  +P  +L  +R L VL+LS N  +G LP  + N+  S
Sbjct: 714  IPSCFGDLPALQELFLDSNVLAFNIPT-SLWSLRDLLVLNLSSNFLTGNLPPEVGNMK-S 771

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            + TLDLS N  SG I   + +  +  L +L L  N   G IP    +   L SL LS N 
Sbjct: 772  ITTLDLSKNLVSGYIPRRMGE--QQNLAKLSLSQNRLQGPIPXEFGDLVSLESLDLSQNN 829

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LSGTIP SL +L  L+ L +  N L+GEIP
Sbjct: 830  LSGTIPKSLEALIYLKYLNVSSNKLQGEIP 859

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 59/170 (34%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP     C  L  L+L+ N F G +P + +  +  L+ + L  N   G +P S  NL A 
Sbjct: 417 LPTTLSLCGELLYLSLAVNKFRGSIPRE-IGNLSKLEDISLRSNSLVGSIPTSFGNLMA- 474

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFN 385
           L  LDL  N  +G + P    N    LQ L L  N  +G +PP++     +L  L++  N
Sbjct: 475 LKYLDLGMNFLTGTV-PEAIFNISE-LQILVLVQNHLSGSLPPSIGTWLPDLEGLYIGSN 532

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             SGTIP S+ ++SKL  L++W N   G +P++L  +  LE L L  N L
Sbjct: 533 KFSGTIPMSISNMSKLIQLQVWDNSFTGNVPKDLGNLTKLEVLNLAANQL 582

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 55/169 (32%), Positives = 91/169 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ + L  L L +N+ +  +P  TL +++ L+ L ++ N   G +P  L +L  +
Sbjct: 642  IPTGIGNLTNLIELDLGANDLTRSIPT-TLGRLQKLQRLHIAGNRIRGSIPNDLCHLK-N 699

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L L SN  SG I P+ C      LQEL+L +N     IP +L +  +L+ L+LS N+
Sbjct: 700  LGYLHLXSNKLSGSI-PS-CFGDLPALQELFLDSNVLAFNIPTSLWSLRDLLVLNLSSNF 757

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G +P  +G++  +  L L  N++ G IP+ +   + L  L L  N L
Sbjct: 758  LTGNLPPEVGNMKSITTLDLSKNLVSGYIPRRMGEQQNLAKLSLSQNRL 806

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 60/206 (29%), Positives = 88/206 (42%), Gaps = 32/206 (15%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
            SL   +P  FG+   L+ L L  N  +G +P + +  +  L++L L  N  SG LP S+ 
Sbjct: 460  SLVGSIPTSFGNLMALKYLDLGMNFLTGTVP-EAIFNISELQILVLVQNHLSGSLPPSIG 518

Query: 194  NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
                 L  L + SN FSG I  ++    K  L +L + +N FTG +P  L N ++L  L+
Sbjct: 519  TWLPDLEGLYIGSNKFSGTIPMSISNMSK--LIQLQVWDNSFTGNVPKDLGNLTKLEVLN 576

Query: 374  LSFNYLS-------------------------------GTIPSSLGSLS-KLRDLKLWLN 457
            L+ N L+                               GT+P+SLG+L   L        
Sbjct: 577  LAANQLTNEHLASGVGFLTSLTNCKFLRHLWIDDNPFKGTLPNSLGNLPIALESFTASAC 636

Query: 458  MLEGEIPQELMYVKTLETLILDFNDL 535
               G IP  +  +  L  L L  NDL
Sbjct: 637  QFRGTIPTGIGNLTNLIELDLGANDL 662

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 33/83 (39%), Positives = 48/83 (57%)
 Frame = +2

Query: 287 LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLE 466
           L  L L NN F   +P  +  C EL  L+L  N L G IP ++ +LSKL +L L  N L 
Sbjct: 17  LVSLDLSNNYFHDSLPKDIGKCKELQQLNLFNNKLVGGIPEAICNLSKLEELYLGNNELI 76

Query: 467 GEIPQELMYVKTLETLILDFNDL 535
           GEIP+++ +++ L+ L    N+L
Sbjct: 77  GEIPKKMNHLQNLKVLSFPMNNL 99

[80][TOP]
>UniRef100_UPI0001985210 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001985210
          Length = 1192

 Score =  110 bits (276), Expect = 5e-23
 Identities = 71/178 (39%), Positives = 95/178 (53%), Gaps = 24/178 (13%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS- 202
           P+PP  GS S LE L L +NNFS ++P ++LL +  L  LDLS N F GE+ E       
Sbjct: 372 PIPPELGSLSSLEGLFLGNNNFSRQVP-ESLLNLSSLAFLDLSKNNFGGEIQEIFGKFKQ 430

Query: 203 -----------------------ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
                                  +++  LDLS NNFSGP+   L + P  +L+ L L +N
Sbjct: 431 VRFLVLHTNSYTGGIYSSGILKLSNISRLDLSFNNFSGPLPVELSEMP--SLEFLILAHN 488

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            F+G IPP   N   L +L LSFN L+G+IPS++G L+ L  L L  N   GEIP E+
Sbjct: 489 QFSGSIPPEFGNIRRLQALDLSFNSLNGSIPSTIGKLNSLLWLMLANNRFSGEIPPEI 546

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 52/126 (41%), Positives = 75/126 (59%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           S +  L LS NNFSG LP++ L +M  L+ L L+ N+FSG +P    N+   L  LDLS 
Sbjct: 454 SNISRLDLSFNNFSGPLPVE-LSEMPSLEFLILAHNQFSGSIPPEFGNIRR-LQALDLSF 511

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           N+ +G I   +     N+L  L L NN F+G+IPP + NC+ L+ L+L+ N  SG IP  
Sbjct: 512 NSLNGSIPSTI--GKLNSLLWLMLANNRFSGEIPPEIGNCTSLLWLNLANNQFSGKIPPE 569

Query: 413 LGSLSK 430
           L ++ +
Sbjct: 570 LTTIGR 575

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 56/161 (34%), Positives = 82/161 (50%)
 Frame = +2

Query: 50  CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
           C  L    +S NNF+G +  +   + + LK LDLS N FSGE+ +      A L     S
Sbjct: 262 CDRLVLANISENNFTGSID-NCFDECKSLKYLDLSSNNFSGEIWQGF----ARLQQFSAS 316

Query: 230 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 409
            N F G + P++       L  L L  N F G++P  ++NC+ L  L+L  N+ +G IP 
Sbjct: 317 ENRFGGVVSPSIFGGVC-ALGLLELSKNSFGGEVPGEIANCTSLRILNLWGNHFTGPIPP 375

Query: 410 SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            LGSLS L  L L  N    ++P+ L+ + +L  L L  N+
Sbjct: 376 ELGSLSSLEGLFLGNNNFSRQVPESLLNLSSLAFLDLSKNN 416

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 59/163 (36%), Positives = 77/163 (47%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F  C  L+ L LSSNNFSGE+          L+    S N F G +  S+     +L  L
Sbjct: 283 FDECKSLKYLDLSSNNFSGEIWQG----FARLQQFSASENRFGGVVSPSIFGGVCALGLL 338

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
           +LS N+F G +   +      +L+ L L  N FTG IPP L + S L  L L  N  S  
Sbjct: 339 ELSKNSFGGEVPGEIANC--TSLRILNLWGNHFTGPIPPELGSLSSLEGLFLGNNNFSRQ 396

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           +P SL +LS L  L L  N   GEI +     K +  L+L  N
Sbjct: 397 VPESLLNLSSLAFLDLSKNNFGGEIQEIFGKFKQVRFLVLHTN 439

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 50/131 (38%), Positives = 68/131 (51%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           PLP        LE L L+ N FSG +P +    +R L+ LDLSFN  +G +P ++  L+ 
Sbjct: 469 PLPVELSEMPSLEFLILAHNQFSGSIPPE-FGNIRRLQALDLSFNSLNGSIPSTIGKLN- 526

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SLL L L++N FSG I P +      +L  L L NN F+GKIPP L+            N
Sbjct: 527 SLLWLMLANNRFSGEIPPEI--GNCTSLLWLNLANNQFSGKIPPELTTIGRNPFPTFEMN 584

Query: 386 YLSGTIPSSLG 418
             +  IP+  G
Sbjct: 585 RKNRGIPAGSG 595

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 43/114 (37%), Positives = 69/114 (60%), Gaps = 1/114 (0%)
 Frame = +2

Query: 74  LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI 253
           +S N FSGE+P + +  M+   ++ ++ N+F G+LP ++  L   ++ L+LS NNFSG I
Sbjct: 657 ISGNQFSGEVPPE-IRNMQNFSLIQMAANKFYGKLPPAIGQLP--VVVLNLSENNFSGEI 713

Query: 254 LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN-YLSGTIPSS 412
              +       LQ L L +N F+G  P +L+N SEL   ++S+N  +SG IPS+
Sbjct: 714 PMEI--GNLGCLQNLDLSSNNFSGTFPTSLNNLSELNKFNISYNPLISGVIPST 765

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 44/123 (35%), Positives = 69/123 (56%), Gaps = 4/123 (3%)
 Frame = +2

Query: 122  KMRGLKV---LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ 292
            K+R L++   + +S N+FSGE+P  + N+    L + +++N F G + P + Q P   L 
Sbjct: 645  KVRTLQISGYVQISGNQFSGEVPPEIRNMQNFSL-IQMAANKFYGKLPPAIGQLPVVVLN 703

Query: 293  ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLN-MLEG 469
               L  N F+G+IP  + N   L +L LS N  SGT P+SL +LS+L    +  N ++ G
Sbjct: 704  ---LSENNFSGEIPMEIGNLGCLQNLDLSSNNFSGTFPTSLNNLSELNKFNISYNPLISG 760

Query: 470  EIP 478
             IP
Sbjct: 761  VIP 763

[81][TOP]
>UniRef100_UPI00019845AE PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vinifera
           RepID=UPI00019845AE
          Length = 869

 Score =  110 bits (276), Expect = 5e-23
 Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 5/174 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  GSC LL+++ LS+N+ SG +P D+L        L+LSFN FSG +P SLT  S+S
Sbjct: 191 IPPSIGSCPLLQTVDLSNNSLSGTIP-DSLFNSTKFYRLNLSFNSFSGSIPVSLTR-SSS 248

Query: 209 LLTLDLSSNNFSGPILPN---LCQNPKNT--LQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           L  L L  NN SGPI PN   +    K+   LQ L L +N F+G +P +L   SEL  + 
Sbjct: 249 LTFLALQHNNLSGPI-PNSWGVGTQGKSLFRLQSLALDHNFFSGSMPTSLGKLSELQKVS 307

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N ++G IP  +G LS+L+ +    N + G +P  L  + +L  L L+ N L
Sbjct: 308 LSHNQITGAIPDEIGRLSRLKTVDFSSNAINGSLPISLSNLSSLLVLNLENNGL 361

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 59/150 (39%), Positives = 83/150 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G  S L+ ++LS N  +G +P D + ++  LK +D S N  +G LP SL+NLS S
Sbjct: 293 MPTSLGKLSELQKVSLSHNQITGAIP-DEIGRLSRLKTVDFSSNAINGSLPISLSNLS-S 350

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           LL L+L +N     I P+  +  +N L  L L+ N F G IP ++ N S L  L LS N 
Sbjct: 351 LLVLNLENNGLDSQI-PDAFEKLQN-LSVLNLRRNRFNGPIPGSIGNASALTQLDLSQNN 408

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           L+G IPSS+  L  L    +  N L G +P
Sbjct: 409 LTGDIPSSIADLPNLNSFNVSYNNLSGSVP 438

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 62/180 (34%), Positives = 95/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query: 14  SLELPLPPFFG------SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE 175
           +L  P+P  +G      S   L+SLAL  N FSG +P  +L K+  L+ + LS N+ +G 
Sbjct: 258 NLSGPIPNSWGVGTQGKSLFRLQSLALDHNFFSGSMPT-SLGKLSELQKVSLSHNQITGA 316

Query: 176 LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS 355
           +P+ +  LS  L T+D SSN  +G +  +L     ++L  L L+NNG   +IP       
Sbjct: 317 IPDEIGRLSR-LKTVDFSSNAINGSLPISLSN--LSSLLVLNLENNGLDSQIPDAFEKLQ 373

Query: 356 ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  L+L  N  +G IP S+G+ S L  L L  N L G+IP  +  +  L +  + +N+L
Sbjct: 374 NLSVLNLRRNRFNGPIPGSIGNASALTQLDLSQNNLTGDIPSSIADLPNLNSFNVSYNNL 433

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 59/172 (34%), Positives = 86/172 (50%), Gaps = 8/172 (4%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 217
           G    L  L+L  N   G +P  +  L  +RG+++ +   N FSG +P S+ +    L T
Sbjct: 148 GQLQALRKLSLHDNFIGGSIPSALGFLPNLRGVQLFN---NRFSGSIPPSIGSCPL-LQT 203

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
           +DLS+N+ SG I  +L  + K     L L  N F+G IP +L+  S L  L L  N LSG
Sbjct: 204 VDLSNNSLSGTIPDSLFNSTK--FYRLNLSFNSFSGSIPVSLTRSSSLTFLALQHNNLSG 261

Query: 398 TIPSSLG------SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            IP+S G      SL +L+ L L  N   G +P  L  +  L+ + L  N +
Sbjct: 262 PIPNSWGVGTQGKSLFRLQSLALDHNFFSGSMPTSLGKLSELQKVSLSHNQI 313

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 49/132 (37%), Positives = 65/132 (49%)
 Frame = +2

Query: 140 VLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
           V+ L +    G + E +  L A L  L L  N   G I   L   P   L+ + L NN F
Sbjct: 131 VIQLPWKGLGGRISEKIGQLQA-LRKLSLHDNFIGGSIPSALGFLPN--LRGVQLFNNRF 187

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           +G IPP++ +C  L ++ LS N LSGTIP SL + +K   L L  N   G IP  L    
Sbjct: 188 SGSIPPSIGSCPLLQTVDLSNNSLSGTIPDSLFNSTKFYRLNLSFNSFSGSIPVSLTRSS 247

Query: 500 TLETLILDFNDL 535
           +L  L L  N+L
Sbjct: 248 SLTFLALQHNNL 259

[82][TOP]
>UniRef100_Q6ETT7 Putative uncharacterized protein P0017C12.12 n=1 Tax=Oryza sativa
            Japonica Group RepID=Q6ETT7_ORYSJ
          Length = 1131

 Score =  110 bits (276), Expect = 5e-23
 Identities = 67/168 (39%), Positives = 96/168 (57%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ + L    L  NNF+G +P + L + R L+ LD S N F G LP  + N+S+ 
Sbjct: 554  IPDSIGNLAQLTEFHLDGNNFNGSIPSN-LGQWRQLEKLDFSHNSFGGSLPSEVFNISSL 612

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              +LDLS N F+GPI P    N  N L  + + NN  TG+IP TL  C  L  LH+  N 
Sbjct: 613  SQSLDLSHNLFTGPI-PLEIGNLIN-LGSISISNNRLTGEIPSTLGKCVLLEYLHMEGNL 670

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            L+G+IP S  +L  +++L L  N L G++P+ L  + +L+ L L FND
Sbjct: 671  LTGSIPRSFMNLKSIKELDLSCNSLSGKVPEFLTLLSSLQKLNLSFND 718

 Score =  102 bits (254), Expect = 2e-20
 Identities = 67/173 (38%), Positives = 97/173 (56%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P  FG+   L++L LS+N   G++P   L        +DL  N+ +G +PE L N
Sbjct: 186 LEGSIPTRFGTLPELKTLDLSNNALRGDIP-PLLGSSPSFVYVDLGGNQLTGGIPEFLVN 244

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S+SL  L L+ N+ +G I P L  +  +TL  +YL  N   G IPP  +  + +  L L
Sbjct: 245 -SSSLQVLRLTQNSLTGEIPPALFNS--STLTTIYLDRNNLVGSIPPITAIAAPIQYLSL 301

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             N L+G IP+SLG+LS L  + L  N L G IP+ L  + TLE L+L +N+L
Sbjct: 302 EQNKLTGGIPASLGNLSSLVHVSLKANNLVGSIPKSLSKIPTLERLVLTYNNL 354

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 71/193 (36%), Positives = 97/193 (50%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ S + SL LS N F G++P + L ++  +  L+LS N   G +P+ L++ S +
Sbjct: 94  IPPCIGNLSSIASLDLSRNAFLGKIPSE-LGRLGQISYLNLSINSLEGRIPDELSSCS-N 151

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS+N+F G I P+L Q  +  LQ++ L NN   G IP       EL +L LS N 
Sbjct: 152 LQVLGLSNNSFEGEIPPSLTQCTR--LQQVILYNNKLEGSIPTRFGTLPELKTLDLSNNA 209

Query: 389 LSGTIPSSLGS------------------------LSKLRDLKLWLNMLEGEIPQELMYV 496
           L G IP  LGS                         S L+ L+L  N L GEIP  L   
Sbjct: 210 LRGDIPPLLGSSPSFVYVDLGGNQLTGGIPEFLVNSSSLQVLRLTQNSLTGEIPPALFNS 269

Query: 497 KTLETLILDFNDL 535
            TL T+ LD N+L
Sbjct: 270 STLTTIYLDRNNL 282

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 64/169 (37%), Positives = 91/169 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP  G+ S L  L+L+ NN SG +P D++  +  L    L  N F+G +P +L      
Sbjct: 530  IPPTIGNLSNLLVLSLAQNNLSGLIP-DSIGNLAQLTEFHLDGNNFNGSIPSNLGQWR-Q 587

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  LD S N+F G  LP+   N  +  Q L L +N FTG IP  + N   L S+ +S N 
Sbjct: 588  LEKLDFSHNSFGGS-LPSEVFNISSLSQSLDLSHNLFTGPIPLEIGNLINLGSISISNNR 646

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G IPS+LG    L  L +  N+L G IP+  M +K+++ L L  N L
Sbjct: 647  LTGEIPSTLGKCVLLEYLHMEGNLLTGSIPRSFMNLKSIKELDLSCNSL 695

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 61/169 (36%), Positives = 87/169 (51%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  GS      + L  N  +G +P + L+    L+VL L+ N  +GE+P +L N S++
Sbjct: 214 IPPLLGSSPSFVYVDLGGNQLTGGIP-EFLVNSSSLQVLRLTQNSLTGEIPPALFN-SST 271

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L T+ L  NN  G I P         +Q L L+ N  TG IP +L N S LV + L  N 
Sbjct: 272 LTTIYLDRNNLVGSIPPITAIAAP--IQYLSLEQNKLTGGIPASLGNLSSLVHVSLKANN 329

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G+IP SL  +  L  L L  N L G +PQ +  + +L+ L +  N L
Sbjct: 330 LVGSIPKSLSKIPTLERLVLTYNNLTGHVPQAIFNISSLKYLSMANNSL 378

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 67/167 (40%), Positives = 85/167 (50%), Gaps = 2/167 (1%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNF-SGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P FGS   L  L L  N   +G+   + +L     LK L L  N   G LP S+ NL + 
Sbjct: 432 PSFGSLPNLHDLDLGYNQLEAGDWSFLSSLANCTQLKKLALDANFLQGTLPSSVGNLPSQ 491

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N  SG I P+   N K+ L  LYL  N F+G IPPT+ N S L+ L L+ N 
Sbjct: 492 LNWLWLRQNKLSGTI-PSEIGNLKS-LSVLYLDENMFSGSIPPTIGNLSNLLVLSLAQNN 549

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG IP S+G+L++L +  L  N   G IP  L   + LE L    N
Sbjct: 550 LSGLIPDSIGNLAQLTEFHLDGNNFNGSIPSNLGQWRQLEKLDFSHN 596

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 55/139 (39%), Positives = 76/139 (54%), Gaps = 2/139 (1%)
 Frame = +2

Query: 68  LALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG 247
           L +SS   SG +P   +  +  +  LDLS N F G++P  L  L   +  L+LS N+  G
Sbjct: 83  LNVSSKGLSGSIP-PCIGNLSSIASLDLSRNAFLGKIPSELGRLG-QISYLNLSINSLEG 140

Query: 248 PILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
            I   L  C N    LQ L L NN F G+IPP+L+ C+ L  + L  N L G+IP+  G+
Sbjct: 141 RIPDELSSCSN----LQVLGLSNNSFEGEIPPSLTQCTRLQQVILYNNKLEGSIPTRFGT 196

Query: 422 LSKLRDLKLWLNMLEGEIP 478
           L +L+ L L  N L G+IP
Sbjct: 197 LPELKTLDLSNNALRGDIP 215

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 60/170 (35%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP   + S L ++ L  NN  G +P  T +    ++ L L  N+ +G +P SL 
Sbjct: 257 SLTGEIPPALFNSSTLTTIYLDRNNLVGSIPPITAI-AAPIQYLSLEQNKLTGGIPASLG 315

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NLS SL+ + L +NN  G I  +L + P  TL+ L L  N  TG +P  + N S L  L 
Sbjct: 316 NLS-SLVHVSLKANNLVGSIPKSLSKIP--TLERLVLTYNNLTGHVPQAIFNISSLKYLS 372

Query: 374 LSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
           ++ N L G +P  +G+ L  L  L L    L G IP  L  +  LE + L
Sbjct: 373 MANNSLIGQLPPDIGNRLPNLEALILSTTQLNGPIPASLRNMSKLEMVYL 422

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 60/164 (36%), Positives = 85/164 (51%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           GS S   + + +  N+ G    +T  ++R + VL++S    SG +P  + NLS S+ +LD
Sbjct: 51  GSLSSWSNTSQNFCNWQGVSCNNTQTQLR-VMVLNVSSKGLSGSIPPCIGNLS-SIASLD 108

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           LS N F G I   L +     +  L L  N   G+IP  LS+CS L  L LS N   G I
Sbjct: 109 LSRNAFLGKIPSELGR--LGQISYLNLSINSLEGRIPDELSSCSNLQVLGLSNNSFEGEI 166

Query: 404 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           P SL   ++L+ + L+ N LEG IP     +  L+TL L  N L
Sbjct: 167 PPSLTQCTRLQQVILYNNKLEGSIPTRFGTLPELKTLDLSNNAL 210

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 62/220 (28%), Positives = 89/220 (40%), Gaps = 51/220 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P        LE L L+ NN +G +P   +  +  LK L ++ N   G+LP  + N   +
Sbjct: 334 IPKSLSKIPTLERLVLTYNNLTGHVPQ-AIFNISSLKYLSMANNSLIGQLPPDIGNRLPN 392

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP----------------- 337
           L  L LS+   +GPI  +L    K  L+ +YL   G TG +P                  
Sbjct: 393 LEALILSTTQLNGPIPASLRNMSK--LEMVYLAAAGLTGIVPSFGSLPNLHDLDLGYNQL 450

Query: 338 ---------TLSNCSELVSLHLSFNYL-------------------------SGTIPSSL 415
                    +L+NC++L  L L  N+L                         SGTIPS +
Sbjct: 451 EAGDWSFLSSLANCTQLKKLALDANFLQGTLPSSVGNLPSQLNWLWLRQNKLSGTIPSEI 510

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G+L  L  L L  NM  G IP  +  +  L  L L  N+L
Sbjct: 511 GNLKSLSVLYLDENMFSGSIPPTIGNLSNLLVLSLAQNNL 550

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 43/129 (33%), Positives = 61/129 (47%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P   G+   L S+++S+N  +GE+P  TL K   L+ L +  N  +G +P S  NL  
Sbjct: 626 PIPLEIGNLINLGSISISNNRLTGEIP-STLGKCVLLEYLHMEGNLLTGSIPRSFMNLK- 683

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           S+  LDLS N+ S                          GK+P  L+  S L  L+LSFN
Sbjct: 684 SIKELDLSCNSLS--------------------------GKVPEFLTLLSSLQKLNLSFN 717

Query: 386 YLSGTIPSS 412
              G IPS+
Sbjct: 718 DFEGPIPSN 726

[83][TOP]
>UniRef100_B9MZW8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZW8_POPTR
          Length = 1000

 Score =  110 bits (276), Expect = 5e-23
 Identities = 77/175 (44%), Positives = 94/175 (53%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           + LE  + PF  + SLL  L+L  NNF GE+P  TL  +  L+ L++S N+ SG LP SL
Sbjct: 85  MRLEGSISPFLSNLSLLTKLSLQGNNFHGEIPT-TLGALSQLEYLNMSENKLSGALPASL 143

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
                 L  LDL+ NN SG I   L    K  L  L L  N  TG IP  LSN +EL  L
Sbjct: 144 HGCQI-LKFLDLTDNNLSGVIPEELGWMKK--LSFLALSENNLTGVIPAFLSNLTELTQL 200

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+ NY +G IP  LG LS+L  L L LN LEG IP  L     L+ + L  N L
Sbjct: 201 ELAVNYFTGQIPVELGVLSRLEILYLHLNFLEGTIPASLSNCTALQAISLIENRL 255

 Score =  100 bits (248), Expect = 9e-20
 Identities = 68/196 (34%), Positives = 97/196 (49%), Gaps = 23/196 (11%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L+  +P  FG   LL+ L L  N   G +P D + +   L +LDL+ N  +G +P SL N
Sbjct: 381 LDGTIPATFGKLKLLQRLYLGRNKLQGSIP-DEMGQTENLGLLDLANNSITGSIPCSLGN 439

Query: 197 LS-----------------------ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ 307
           LS                       + ++ LDLS N+  GP+ P +     N    L L 
Sbjct: 440 LSQLRYLYLSQNSLSGNIPIKLSQCSLMMQLDLSFNSLQGPLPPEIGVF-SNLGLSLNLS 498

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           NN   G+IP T+ N   + ++ LS N  SG IPSS+GS + L  L L  NM++G IP+ L
Sbjct: 499 NNNLDGEIPATIGNLVSVQAIDLSVNRFSGIIPSSVGSCTALEYLNLSKNMIQGTIPESL 558

Query: 488 MYVKTLETLILDFNDL 535
             + +L+ L L FN L
Sbjct: 559 KQIASLKALDLAFNQL 574

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 69/170 (40%), Positives = 95/170 (55%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP     C +L+ L L+ NN SG +P + L  M+ L  L LS N  +G +P  L+NL+  
Sbjct: 139 LPASLHGCQILKFLDLTDNNLSGVIP-EELGWMKKLSFLALSENNLTGVIPAFLSNLT-E 196

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+L+ N F+G I   L     + L+ LYL  N   G IP +LSNC+ L ++ L  N 
Sbjct: 197 LTQLELAVNYFTGQIPVEL--GVLSRLEILYLHLNFLEGTIPASLSNCTALQAISLIENR 254

Query: 389 LSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IPS +G+ L  LR L     +  GE+P+EL  +K LE L L  N+L
Sbjct: 255 LSGEIPSQMGNKLQNLRKLYFMTTIFLGEVPEELGKLKNLEILYLHSNNL 304

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 68/200 (34%), Positives = 94/200 (47%), Gaps = 27/200 (13%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-- 190
           LE  +P    +C+ L++++L  N  SGE+P     K++ L+ L      F GE+PE L  
Sbjct: 231 LEGTIPASLSNCTALQAISLIENRLSGEIPSQMGNKLQNLRKLYFMTTIFLGEVPEELGK 290

Query: 191 ---------------TNLSASLLT----------LDLSSNNFSGPILPNLCQNPKNTLQE 295
                          +N S S LT          L L S  FSG  LP    N    L  
Sbjct: 291 LKNLEILYLHSNNLVSNSSLSFLTALTNCSFMKKLHLGSCLFSGS-LPASIGNLSKDLYY 349

Query: 296 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 475
             L NN   G+IP ++ N S LV+L L +N+L GTIP++ G L  L+ L L  N L+G I
Sbjct: 350 FNLLNNRIRGEIPDSIGNLSGLVTLQLWYNHLDGTIPATFGKLKLLQRLYLGRNKLQGSI 409

Query: 476 PQELMYVKTLETLILDFNDL 535
           P E+   + L  L L  N +
Sbjct: 410 PDEMGQTENLGLLDLANNSI 429

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 62/172 (36%), Positives = 91/172 (52%), Gaps = 3/172 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L  L LS N+ SG +P+  L +   +  LDLSFN   G LP  +   S  
Sbjct: 433 IPCSLGNLSQLRYLYLSQNSLSGNIPIK-LSQCSLMMQLDLSFNSLQGPLPPEIGVFSNL 491

Query: 209 LLTLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
            L+L+LS+NN  G I   + NL      ++Q + L  N F+G IP ++ +C+ L  L+LS
Sbjct: 492 GLSLNLSNNNLDGEIPATIGNLV-----SVQAIDLSVNRFSGIIPSSVGSCTALEYLNLS 546

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            N + GTIP SL  ++ L+ L L  N L G +P  L     ++   L +N L
Sbjct: 547 KNMIQGTIPESLKQIASLKALDLAFNQLTGSVPIWLANDSVMKNFNLSYNRL 598

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 1/155 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDT-LLKMRGLKVLDLSFNEFSGELPESL 190
           SL   +P     CSL+  L LS N+  G LP +  +    GL  L+LS N   GE+P ++
Sbjct: 452 SLSGNIPIKLSQCSLMMQLDLSFNSLQGPLPPEIGVFSNLGLS-LNLSNNNLDGEIPATI 510

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            NL  S+  +DLS N FSG I+P+   +    L+ L L  N   G IP +L   + L +L
Sbjct: 511 GNL-VSVQAIDLSVNRFSG-IIPSSVGSC-TALEYLNLSKNMIQGTIPESLKQIASLKAL 567

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 475
            L+FN L+G++P  L + S +++  L  N L GE+
Sbjct: 568 DLAFNQLTGSVPIWLANDSVMKNFNLSYNRLTGEV 602

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 58/143 (40%), Positives = 83/143 (58%), Gaps = 1/143 (0%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLE-SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE 184
           F SL+ PLPP  G  S L  SL LS+NN  GE+P  T+  +  ++ +DLS N FSG +P 
Sbjct: 474 FNSLQGPLPPEIGVFSNLGLSLNLSNNNLDGEIPA-TIGNLVSVQAIDLSVNRFSGIIPS 532

Query: 185 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
           S+ + +A L  L+LS N   G I  +L Q    +L+ L L  N  TG +P  L+N S + 
Sbjct: 533 SVGSCTA-LEYLNLSKNMIQGTIPESLKQIA--SLKALDLAFNQLTGSVPIWLANDSVMK 589

Query: 365 SLHLSFNYLSGTIPSSLGSLSKL 433
           + +LS+N L+G + SS+G    L
Sbjct: 590 NFNLSYNRLTGEV-SSMGRFKNL 611

[84][TOP]
>UniRef100_B9I3H5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I3H5_POPTR
          Length = 975

 Score =  110 bits (276), Expect = 5e-23
 Identities = 76/170 (44%), Positives = 96/170 (56%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP+ GS   L  L  S NNF G +P + L    GL  L L  N+ SG +P+ + NL+ S
Sbjct: 664  MPPWLGSLEELGELDFSFNNFHGNIPAE-LGNCSGLLKLSLHSNKLSGNIPQEIGNLT-S 721

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL-VSLHLSFN 385
            L  L+L  NN SG ++P+  Q  +    EL L  N  TG IPP L   +EL V L LS N
Sbjct: 722  LNVLNLQRNNLSG-LIPSTIQECEKIF-ELRLSENFLTGSIPPELGKLTELQVILDLSEN 779

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              SG IPSSLG+L KL  L L LN L+GE+P  L  + +L  L L  NDL
Sbjct: 780  SFSGEIPSSLGNLMKLEGLNLSLNHLQGEVPFSLTKLTSLHMLNLSNNDL 829

 Score =  109 bits (273), Expect = 1e-22
 Identities = 70/170 (41%), Positives = 92/170 (54%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+PP  G C  L+ +AL+ N  SG LP +T   +  L  + L  N F G LP SL  L  
Sbjct: 496 PIPPSLGYCKRLQIMALADNKISGTLP-ETFRFLTELNKITLYNNSFEGPLPASLFLLK- 553

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  ++ S N FSG I P L     N+L  L L NN F+G IP  L+    L  L L+ N
Sbjct: 554 NLKIINFSHNRFSGSISPLL---GSNSLTALDLTNNSFSGPIPSELTQSRNLSRLRLAHN 610

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +LSG IPS  GSL+KL    L  N L GE+P +L   K ++  +L+ N L
Sbjct: 611 HLSGEIPSEFGSLTKLNFFDLSFNNLTGEVPPQLSNCKKIQHFLLNNNQL 660

 Score =  102 bits (253), Expect = 2e-20
 Identities = 68/169 (40%), Positives = 91/169 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            + P  GS SL  +L L++N+FSG +P + L + R L  L L+ N  SGE+P    +L+  
Sbjct: 569  ISPLLGSNSLT-ALDLTNNSFSGPIPSE-LTQSRNLSRLRLAHNHLSGEIPSEFGSLT-K 625

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L   DLS NN +G + P L    K  +Q   L NN   G +PP L +  EL  L  SFN 
Sbjct: 626  LNFFDLSFNNLTGEVPPQLSNCKK--IQHFLLNNNQLAGTMPPWLGSLEELGELDFSFNN 683

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              G IP+ LG+ S L  L L  N L G IPQE+  + +L  L L  N+L
Sbjct: 684  FHGNIPAELGNCSGLLKLSLHSNKLSGNIPQEIGNLTSLNVLNLQRNNL 732

 Score =  100 bits (248), Expect = 9e-20
 Identities = 69/170 (40%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G  S L  L+L  N  SG +P   L ++  L+ LDLS N FSG +  SL 
Sbjct: 250 SLSGSIPVELGQLSNLTYLSLLGNRLSGRIPSQ-LNQLVQLETLDLSVNNFSGAI--SLF 306

Query: 194 NLSA-SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           N    +L TL LS+N+ +G I  N C +  + LQ+L+L  N  +GK    L NC  L  L
Sbjct: 307 NAQLKNLRTLVLSNNDLTGSIPSNFCLSNSSKLQQLFLARNSLSGKFQLDLLNCRSLQQL 366

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
            LS N   G +PS L  L  L DL L  N   G +P E+  +  LETLIL
Sbjct: 367 DLSDNNFEGGLPSGLEKLEHLTDLLLNNNSFSGNLPSEIGNMSNLETLIL 416

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 60/163 (36%), Positives = 89/163 (54%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +C  L+ L LS NNF G LP   L K+  L  L L+ N FSG LP  + N+S +L TL L
Sbjct: 359 NCRSLQQLDLSDNNFEGGLPSG-LEKLEHLTDLLLNNNSFSGNLPSEIGNMS-NLETLIL 416

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
             N  +G +   + +  +  L  +YL +N  +G IP  L+NC+ +  +    N+ +G+IP
Sbjct: 417 FDNMITGRLPSEIGKLQR--LSTIYLYDNQMSGGIPRELTNCTSMTKIDFFGNHFTGSIP 474

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +++G L  L  L+L  N L G IP  L Y K L+ + L  N +
Sbjct: 475 ATIGKLKNLNMLQLRQNDLSGPIPPSLGYCKRLQIMALADNKI 517

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 59/167 (35%), Positives = 90/167 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP   G+ S LE+L L  N  +G LP + + K++ L  + L  N+ SG +P  LTN + S
Sbjct: 401 LPSEIGNMSNLETLILFDNMITGRLPSE-IGKLQRLSTIYLYDNQMSGGIPRELTNCT-S 458

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +  +D   N+F+G I P      KN L  L L+ N  +G IPP+L  C  L  + L+ N 
Sbjct: 459 MTKIDFFGNHFTGSI-PATIGKLKN-LNMLQLRQNDLSGPIPPSLGYCKRLQIMALADNK 516

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           +SGT+P +   L++L  + L+ N  EG +P  L  +K L+ +    N
Sbjct: 517 ISGTLPETFRFLTELNKITLYNNSFEGPLPASLFLLKNLKIINFSHN 563

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 67/173 (38%), Positives = 89/173 (51%), Gaps = 2/173 (1%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P   G    L+ L L++N+ SG +P++ L ++  L  L L  N  SG +P  L  
Sbjct: 227 LEGDIPASIGMLRSLQILNLANNSLSGSIPVE-LGQLSNLTYLSLLGNRLSGRIPSQLNQ 285

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPT--LSNCSELVSL 370
           L   L TLDLS NNFSG I  +L       L+ L L NN  TG IP    LSN S+L  L
Sbjct: 286 L-VQLETLDLSVNNFSGAI--SLFNAQLKNLRTLVLSNNDLTGSIPSNFCLSNSSKLQQL 342

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L+ N LSG     L +   L+ L L  N  EG +P  L  ++ L  L+L+ N
Sbjct: 343 FLARNSLSGKFQLDLLNCRSLQQLDLSDNNFEGGLPSGLEKLEHLTDLLLNNN 395

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 63/175 (36%), Positives = 90/175 (51%), Gaps = 2/175 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G    L+ L +  N  SGE+   ++  +  L+VL L++ +F+G +P  + 
Sbjct: 130 SLSGKIPEEIGLLKNLQVLRVGDNLLSGEIT-PSIGNLTQLRVLGLAYCQFNGSIPSGIG 188

Query: 194 NLSASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           NL   L++LDL  N+  G I   +  C+     LQ L   NN   G IP ++     L  
Sbjct: 189 NLK-HLVSLDLQKNSLDGHIPEEIHGCEE----LQNLAALNNKLEGDIPASIGMLRSLQI 243

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L+L+ N LSG+IP  LG LS L  L L  N L G IP +L  +  LETL L  N+
Sbjct: 244 LNLANNSLSGSIPVELGQLSNLTYLSLLGNRLSGRIPSQLNQLVQLETLDLSVNN 298

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 66/174 (37%), Positives = 90/174 (51%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G    L+ L L +N+ SG++P +  L ++ L+VL +  N  SGE+  S+ 
Sbjct: 106 SLTGSIPSELGKLQNLQMLLLYANSLSGKIPEEIGL-LKNLQVLRVGDNLLSGEITPSIG 164

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL+  L  L L+   F+G I P+   N K+ L  L LQ N   G IP  +  C EL +L 
Sbjct: 165 NLT-QLRVLGLAYCQFNGSI-PSGIGNLKH-LVSLDLQKNSLDGHIPEEIHGCEELQNLA 221

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              N L G IP+S+G L  L+ L L  N L G IP EL  +  L  L L  N L
Sbjct: 222 ALNNKLEGDIPASIGMLRSLQILNLANNSLSGSIPVELGQLSNLTYLSLLGNRL 275

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 49/131 (37%), Positives = 67/131 (51%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           ++LS +  SG +   L +L+ SL  LDLSSN+ +G I   L       LQ L L  N  +
Sbjct: 76  MNLSGSGLSGSISHELWHLT-SLQILDLSSNSLTGSIPSEL--GKLQNLQMLLLYANSLS 132

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           GKIP  +     L  L +  N LSG I  S+G+L++LR L L      G IP  +  +K 
Sbjct: 133 GKIPEEIGLLKNLQVLRVGDNLLSGEITPSIGNLTQLRVLGLAYCQFNGSIPSGIGNLKH 192

Query: 503 LETLILDFNDL 535
           L +L L  N L
Sbjct: 193 LVSLDLQKNSL 203

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 31/83 (37%), Positives = 47/83 (56%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
           C   +  +  + L  +G +G I   L + + L  L LS N L+G+IPS LG L  L+ L 
Sbjct: 66  CSLDQTHVLGMNLSGSGLSGSISHELWHLTSLQILDLSSNSLTGSIPSELGKLQNLQMLL 125

Query: 446 LWLNMLEGEIPQELMYVKTLETL 514
           L+ N L G+IP+E+  +K L+ L
Sbjct: 126 LYANSLSGKIPEEIGLLKNLQVL 148

[85][TOP]
>UniRef100_B9GRE0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GRE0_POPTR
          Length = 1142

 Score =  110 bits (276), Expect = 5e-23
 Identities = 68/174 (39%), Positives = 100/174 (57%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L   +PP  G C+ L  LAL+ N   GELP+ +L  +  +  + LS N  SGE+  +L 
Sbjct: 325 ALNSTIPPELGLCTNLTYLALADNQLRGELPL-SLSNLSKIADMGLSENSLSGEISPTLI 383

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           +    L++L + +N FSG I P +       LQ L+L NN F+G IPP + N  EL+SL 
Sbjct: 384 SNWTELISLQVQNNLFSGNIPPEI--GKLTMLQYLFLYNNTFSGSIPPEIGNLKELLSLD 441

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N LSG +P  L +L+ L+ L L+ N + G+IP E+  +  L+ L L+ N L
Sbjct: 442 LSGNQLSGPLPPPLWNLTNLQILNLFSNNITGKIPSEVGNLTMLQILDLNTNQL 495

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 67/170 (39%), Positives = 91/170 (53%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            + P +G C  L +L +  N  SGE+P + L K+  L+VL L  NE +G +P  L NLS  
Sbjct: 603  ISPDWGECKNLTNLQMDGNRISGEIPAE-LGKLPQLQVLSLGSNELTGRIPAELGNLS-K 660

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L+LS+N  +G +  +L       L  L L +N  TG I   L +  +L SL LS N 
Sbjct: 661  LFMLNLSNNQLTGEVPQSLTS--LKGLNSLDLSDNKLTGNISKELGSYEKLSSLDLSHNN 718

Query: 389  LSGTIPSSLGSLSKLRDL-KLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G IP  LG+L+ L+ L  L  N L G IPQ    +  LETL +  N L
Sbjct: 719  LAGEIPFELGNLNSLQYLLDLSSNSLSGAIPQNFAKLSRLETLNVSHNHL 768

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 58/159 (36%), Positives = 83/159 (52%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           LE L+   N  + E P   +   R L  LDLS N+F+G++PE +      L  L+L +N+
Sbjct: 195 LEYLSFFLNELTAEFP-HFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNS 253

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           F GP+  N+ +   + L+ + LQNN  +G+IP ++ + S L  + L  N   G IPSS+G
Sbjct: 254 FQGPLSSNISK--LSNLKNISLQNNLLSGQIPESIGSISGLQIVELFSNSFQGNIPSSIG 311

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  L  L L +N L   IP EL     L  L L  N L
Sbjct: 312 KLKHLEKLDLRINALNSTIPPELGLCTNLTYLALADNQL 350

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 71/201 (35%), Positives = 89/201 (44%), Gaps = 32/201 (15%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS-- 202
            LP      + L S+ L  NN SG +P D    M  L     S N FSGELP  L +L   
Sbjct: 499  LPLTISDITSLTSINLFGNNLSGSIPSDFGKYMPSLAYASFSNNSFSGELPPELWSLPTC 558

Query: 203  ----ASLLTLDLSSNNFSGPI------LPNL--------------------CQNPKNTLQ 292
                + L  + L  N F+G I      LPNL                    C+N    L 
Sbjct: 559  LRNCSKLTRVRLEENRFAGNITNAFGVLPNLVFVALSDNQFIGEISPDWGECKN----LT 614

Query: 293  ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 472
             L +  N  +G+IP  L    +L  L L  N L+G IP+ LG+LSKL  L L  N L GE
Sbjct: 615  NLQMDGNRISGEIPAELGKLPQLQVLSLGSNELTGRIPAELGNLSKLFMLNLSNNQLTGE 674

Query: 473  IPQELMYVKTLETLILDFNDL 535
            +PQ L  +K L +L L  N L
Sbjct: 675  VPQSLTSLKGLNSLDLSDNKL 695

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 62/159 (38%), Positives = 89/159 (55%), Gaps = 1/159 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G  ++L+ L L +N FSG +P + +  ++ L  LDLS N+ SG LP  L NL+ +
Sbjct: 403 IPPEIGKLTMLQYLFLYNNTFSGSIPPE-IGNLKELLSLDLSGNQLSGPLPPPLWNLT-N 460

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+L SNN +G I P+   N    LQ L L  N   G++P T+S+ + L S++L  N 
Sbjct: 461 LQILNLFSNNITGKI-PSEVGN-LTMLQILDLNTNQLHGELPLTISDITSLTSINLFGNN 518

Query: 389 LSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKT 502
           LSG+IPS  G  +  L       N   GE+P EL  + T
Sbjct: 519 LSGSIPSDFGKYMPSLAYASFSNNSFSGELPPELWSLPT 557

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 62/191 (32%), Positives = 88/191 (46%), Gaps = 22/191 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTL----------------------LKMRGLKV 142
           +P      + L+ L+L +NN +G +P                            M  L+ 
Sbjct: 138 IPVEISQLTELQYLSLYNNNLNGIIPFQLANLPKVRHLDLGANYLENPDWSNFSMPSLEY 197

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           L    NE + E P  +TN   +L  LDLS N F+G I P L       L+ L L NN F 
Sbjct: 198 LSFFLNELTAEFPHFITNCR-NLTFLDLSLNKFTGQI-PELVYTNLGKLEALNLYNNSFQ 255

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G +   +S  S L ++ L  N LSG IP S+GS+S L+ ++L+ N  +G IP  +  +K 
Sbjct: 256 GPLSSNISKLSNLKNISLQNNLLSGQIPESIGSISGLQIVELFSNSFQGNIPSSIGKLKH 315

Query: 503 LETLILDFNDL 535
           LE L L  N L
Sbjct: 316 LEKLDLRINAL 326

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 57/144 (39%), Positives = 84/144 (58%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           LE+L L +N+F G L  + + K+  LK + L  N  SG++PES+ ++S  L  ++L SN+
Sbjct: 244 LEALNLYNNSFQGPLSSN-ISKLSNLKNISLQNNLLSGQIPESIGSISG-LQIVELFSNS 301

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           F G I P+     K+ L++L L+ N     IPP L  C+ L  L L+ N L G +P SL 
Sbjct: 302 FQGNI-PSSIGKLKH-LEKLDLRINALNSTIPPELGLCTNLTYLALADNQLRGELPLSLS 359

Query: 419 SLSKLRDLKLWLNMLEGEIPQELM 490
           +LSK+ D+ L  N L GEI   L+
Sbjct: 360 NLSKIADMGLSENSLSGEISPTLI 383

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 51/134 (38%), Positives = 73/134 (54%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    S   L SL LS N  +G +  + L     L  LDLS N  +GE+P  L NL++ 
Sbjct: 675  VPQSLTSLKGLNSLDLSDNKLTGNISKE-LGSYEKLSSLDLSHNNLAGEIPFELGNLNSL 733

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               LDLSSN+ SG I  N  +   + L+ L + +N  +G+IP +LS+   L S   S+N 
Sbjct: 734  QYLLDLSSNSLSGAIPQNFAK--LSRLETLNVSHNHLSGRIPDSLSSMLSLSSFDFSYNE 791

Query: 389  LSGTIPSSLGSLSK 430
            L+G IP+  GS+ K
Sbjct: 792  LTGPIPT--GSVFK 803

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 52/174 (29%), Positives = 78/174 (44%), Gaps = 22/174 (12%)
 Frame = +2

Query: 74  LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI 253
           + SNN +G +P   +  +  L  LDLS N F G +P  ++ L+  L  L L +NN +G I
Sbjct: 105 IQSNNVNGTIP-SAIGSLSKLTHLDLSANLFEGSIPVEISQLT-ELQYLSLYNNNLNGII 162

Query: 254 LPNLCQNPKNTLQEL---YLQN------------------NGFTGKIPPTLSNCSELVSL 370
              L   PK    +L   YL+N                  N  T + P  ++NC  L  L
Sbjct: 163 PFQLANLPKVRHLDLGANYLENPDWSNFSMPSLEYLSFFLNELTAEFPHFITNCRNLTFL 222

Query: 371 HLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            LS N  +G IP  +  +L KL  L L+ N  +G +   +  +  L+ + L  N
Sbjct: 223 DLSLNKFTGQIPELVYTNLGKLEALNLYNNSFQGPLSSNISKLSNLKNISLQNN 276

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 38/117 (32%), Positives = 59/117 (50%)
 Frame = +2

Query: 185 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
           S ++ S S+  ++L S N +G  L +    P   L    +Q+N   G IP  + + S+L 
Sbjct: 67  SCSSTSRSVSQINLRSLNITGT-LAHFNFTPFTDLTRFDIQSNNVNGTIPSAIGSLSKLT 125

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L LS N   G+IP  +  L++L+ L L+ N L G IP +L  +  +  L L  N L
Sbjct: 126 HLDLSANLFEGSIPVEISQLTELQYLSLYNNNLNGIIPFQLANLPKVRHLDLGANYL 182

[86][TOP]
>UniRef100_B9F1R3 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9F1R3_ORYSJ
          Length = 1146

 Score =  110 bits (276), Expect = 5e-23
 Identities = 67/168 (39%), Positives = 96/168 (57%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ + L    L  NNF+G +P + L + R L+ LD S N F G LP  + N+S+ 
Sbjct: 569  IPDSIGNLAQLTEFHLDGNNFNGSIPSN-LGQWRQLEKLDFSHNSFGGSLPSEVFNISSL 627

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              +LDLS N F+GPI P    N  N L  + + NN  TG+IP TL  C  L  LH+  N 
Sbjct: 628  SQSLDLSHNLFTGPI-PLEIGNLIN-LGSISISNNRLTGEIPSTLGKCVLLEYLHMEGNL 685

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            L+G+IP S  +L  +++L L  N L G++P+ L  + +L+ L L FND
Sbjct: 686  LTGSIPRSFMNLKSIKELDLSCNSLSGKVPEFLTLLSSLQKLNLSFND 733

 Score =  102 bits (254), Expect = 2e-20
 Identities = 67/173 (38%), Positives = 97/173 (56%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P  FG+   L++L LS+N   G++P   L        +DL  N+ +G +PE L N
Sbjct: 201 LEGSIPTRFGTLPELKTLDLSNNALRGDIP-PLLGSSPSFVYVDLGGNQLTGGIPEFLVN 259

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S+SL  L L+ N+ +G I P L  +  +TL  +YL  N   G IPP  +  + +  L L
Sbjct: 260 -SSSLQVLRLTQNSLTGEIPPALFNS--STLTTIYLDRNNLVGSIPPITAIAAPIQYLSL 316

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             N L+G IP+SLG+LS L  + L  N L G IP+ L  + TLE L+L +N+L
Sbjct: 317 EQNKLTGGIPASLGNLSSLVHVSLKANNLVGSIPKSLSKIPTLERLVLTYNNL 369

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 71/193 (36%), Positives = 97/193 (50%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ S + SL LS N F G++P + L ++  +  L+LS N   G +P+ L++ S +
Sbjct: 109 IPPCIGNLSSIASLDLSRNAFLGKIPSE-LGRLGQISYLNLSINSLEGRIPDELSSCS-N 166

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS+N+F G I P+L Q  +  LQ++ L NN   G IP       EL +L LS N 
Sbjct: 167 LQVLGLSNNSFEGEIPPSLTQCTR--LQQVILYNNKLEGSIPTRFGTLPELKTLDLSNNA 224

Query: 389 LSGTIPSSLGS------------------------LSKLRDLKLWLNMLEGEIPQELMYV 496
           L G IP  LGS                         S L+ L+L  N L GEIP  L   
Sbjct: 225 LRGDIPPLLGSSPSFVYVDLGGNQLTGGIPEFLVNSSSLQVLRLTQNSLTGEIPPALFNS 284

Query: 497 KTLETLILDFNDL 535
            TL T+ LD N+L
Sbjct: 285 STLTTIYLDRNNL 297

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 64/169 (37%), Positives = 91/169 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP  G+ S L  L+L+ NN SG +P D++  +  L    L  N F+G +P +L      
Sbjct: 545  IPPTIGNLSNLLVLSLAQNNLSGLIP-DSIGNLAQLTEFHLDGNNFNGSIPSNLGQWR-Q 602

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  LD S N+F G  LP+   N  +  Q L L +N FTG IP  + N   L S+ +S N 
Sbjct: 603  LEKLDFSHNSFGGS-LPSEVFNISSLSQSLDLSHNLFTGPIPLEIGNLINLGSISISNNR 661

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G IPS+LG    L  L +  N+L G IP+  M +K+++ L L  N L
Sbjct: 662  LTGEIPSTLGKCVLLEYLHMEGNLLTGSIPRSFMNLKSIKELDLSCNSL 710

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 61/169 (36%), Positives = 87/169 (51%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  GS      + L  N  +G +P + L+    L+VL L+ N  +GE+P +L N S++
Sbjct: 229 IPPLLGSSPSFVYVDLGGNQLTGGIP-EFLVNSSSLQVLRLTQNSLTGEIPPALFN-SST 286

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L T+ L  NN  G I P         +Q L L+ N  TG IP +L N S LV + L  N 
Sbjct: 287 LTTIYLDRNNLVGSIPPITAIAAP--IQYLSLEQNKLTGGIPASLGNLSSLVHVSLKANN 344

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G+IP SL  +  L  L L  N L G +PQ +  + +L+ L +  N L
Sbjct: 345 LVGSIPKSLSKIPTLERLVLTYNNLTGHVPQAIFNISSLKYLSMANNSL 393

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 67/167 (40%), Positives = 85/167 (50%), Gaps = 2/167 (1%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNF-SGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P FGS   L  L L  N   +G+   + +L     LK L L  N   G LP S+ NL + 
Sbjct: 447 PSFGSLPNLHDLDLGYNQLEAGDWSFLSSLANCTQLKKLALDANFLQGTLPSSVGNLPSQ 506

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N  SG I P+   N K+ L  LYL  N F+G IPPT+ N S L+ L L+ N 
Sbjct: 507 LNWLWLRQNKLSGTI-PSEIGNLKS-LSVLYLDENMFSGSIPPTIGNLSNLLVLSLAQNN 564

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG IP S+G+L++L +  L  N   G IP  L   + LE L    N
Sbjct: 565 LSGLIPDSIGNLAQLTEFHLDGNNFNGSIPSNLGQWRQLEKLDFSHN 611

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 55/139 (39%), Positives = 76/139 (54%), Gaps = 2/139 (1%)
 Frame = +2

Query: 68  LALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG 247
           L +SS   SG +P   +  +  +  LDLS N F G++P  L  L   +  L+LS N+  G
Sbjct: 98  LNVSSKGLSGSIP-PCIGNLSSIASLDLSRNAFLGKIPSELGRLG-QISYLNLSINSLEG 155

Query: 248 PILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
            I   L  C N    LQ L L NN F G+IPP+L+ C+ L  + L  N L G+IP+  G+
Sbjct: 156 RIPDELSSCSN----LQVLGLSNNSFEGEIPPSLTQCTRLQQVILYNNKLEGSIPTRFGT 211

Query: 422 LSKLRDLKLWLNMLEGEIP 478
           L +L+ L L  N L G+IP
Sbjct: 212 LPELKTLDLSNNALRGDIP 230

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 60/170 (35%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP   + S L ++ L  NN  G +P  T +    ++ L L  N+ +G +P SL 
Sbjct: 272 SLTGEIPPALFNSSTLTTIYLDRNNLVGSIPPITAI-AAPIQYLSLEQNKLTGGIPASLG 330

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NLS SL+ + L +NN  G I  +L + P  TL+ L L  N  TG +P  + N S L  L 
Sbjct: 331 NLS-SLVHVSLKANNLVGSIPKSLSKIP--TLERLVLTYNNLTGHVPQAIFNISSLKYLS 387

Query: 374 LSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
           ++ N L G +P  +G+ L  L  L L    L G IP  L  +  LE + L
Sbjct: 388 MANNSLIGQLPPDIGNRLPNLEALILSTTQLNGPIPASLRNMSKLEMVYL 437

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 60/164 (36%), Positives = 85/164 (51%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           GS S   + + +  N+ G    +T  ++R + VL++S    SG +P  + NLS S+ +LD
Sbjct: 66  GSLSSWSNTSQNFCNWQGVSCNNTQTQLR-VMVLNVSSKGLSGSIPPCIGNLS-SIASLD 123

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           LS N F G I   L +     +  L L  N   G+IP  LS+CS L  L LS N   G I
Sbjct: 124 LSRNAFLGKIPSELGR--LGQISYLNLSINSLEGRIPDELSSCSNLQVLGLSNNSFEGEI 181

Query: 404 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           P SL   ++L+ + L+ N LEG IP     +  L+TL L  N L
Sbjct: 182 PPSLTQCTRLQQVILYNNKLEGSIPTRFGTLPELKTLDLSNNAL 225

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 62/220 (28%), Positives = 89/220 (40%), Gaps = 51/220 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P        LE L L+ NN +G +P   +  +  LK L ++ N   G+LP  + N   +
Sbjct: 349 IPKSLSKIPTLERLVLTYNNLTGHVPQ-AIFNISSLKYLSMANNSLIGQLPPDIGNRLPN 407

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP----------------- 337
           L  L LS+   +GPI  +L    K  L+ +YL   G TG +P                  
Sbjct: 408 LEALILSTTQLNGPIPASLRNMSK--LEMVYLAAAGLTGIVPSFGSLPNLHDLDLGYNQL 465

Query: 338 ---------TLSNCSELVSLHLSFNYL-------------------------SGTIPSSL 415
                    +L+NC++L  L L  N+L                         SGTIPS +
Sbjct: 466 EAGDWSFLSSLANCTQLKKLALDANFLQGTLPSSVGNLPSQLNWLWLRQNKLSGTIPSEI 525

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G+L  L  L L  NM  G IP  +  +  L  L L  N+L
Sbjct: 526 GNLKSLSVLYLDENMFSGSIPPTIGNLSNLLVLSLAQNNL 565

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 43/129 (33%), Positives = 61/129 (47%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P   G+   L S+++S+N  +GE+P  TL K   L+ L +  N  +G +P S  NL  
Sbjct: 641 PIPLEIGNLINLGSISISNNRLTGEIP-STLGKCVLLEYLHMEGNLLTGSIPRSFMNLK- 698

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           S+  LDLS N+ S                          GK+P  L+  S L  L+LSFN
Sbjct: 699 SIKELDLSCNSLS--------------------------GKVPEFLTLLSSLQKLNLSFN 732

Query: 386 YLSGTIPSS 412
              G IPS+
Sbjct: 733 DFEGPIPSN 741

[87][TOP]
>UniRef100_A7Q1E6 Chromosome chr10 scaffold_43, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7Q1E6_VITVI
          Length = 543

 Score =  110 bits (276), Expect = 5e-23
 Identities = 77/193 (39%), Positives = 103/193 (53%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S L +++LS+NN SG LPMD       LK L+LS N  SG++P  + NLS +
Sbjct: 160 IPATIFNISSLLNISLSNNNLSGSLPMDMCYANPKLKKLNLSSNHLSGKIPTEIGNLS-N 218

Query: 209 LLTLDLSSNNFSGPI-----------------------LP-NLCQNPKNTLQELYLQNNG 316
           L  L LSSN  SGPI                       LP ++C++  N LQ L L  N 
Sbjct: 219 LNILQLSSNGISGPIPAEIFNVSSLQVIAFTDNSLSGSLPKDICKHLPN-LQGLSLSQNH 277

Query: 317 FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
            +G++P TLS C EL+ L LSFN   G+IP  +G+LSKL  + L  N L G IP     +
Sbjct: 278 LSGQLPTTLSLCGELLFLSLSFNKFRGSIPKEIGNLSKLEKIYLGTNSLIGSIPTSFGNL 337

Query: 497 KTLETLILDFNDL 535
           K L+ L L  N+L
Sbjct: 338 KALKFLNLGINNL 350

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 68/202 (33%), Positives = 105/202 (51%), Gaps = 27/202 (13%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLL----------------------- 121
           + LE  + P  G+ S L SL LS+N+F G LP D  +                       
Sbjct: 80  MGLEGTIAPQVGNLSFLVSLDLSNNHFHGSLPKDIAICNLSKLEELYLGNNQLIGEIPKK 139

Query: 122 --KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLC-QNPKNTLQ 292
              ++ LKVL    N  +G +P ++ N+S SLL + LS+NN SG +  ++C  NPK  L+
Sbjct: 140 MNHLQNLKVLSFPMNNLTGSIPATIFNIS-SLLNISLSNNNLSGSLPMDMCYANPK--LK 196

Query: 293 ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 472
           +L L +N  +GKIP  + N S L  L LS N +SG IP+ + ++S L+ +    N L G 
Sbjct: 197 KLNLSSNHLSGKIPTEIGNLSNLNILQLSSNGISGPIPAEIFNVSSLQVIAFTDNSLSGS 256

Query: 473 IPQEL-MYVKTLETLILDFNDL 535
           +P+++  ++  L+ L L  N L
Sbjct: 257 LPKDICKHLPNLQGLSLSQNHL 278

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 60/170 (35%), Positives = 91/170 (53%), Gaps = 1/170 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    + S L+ +A + N+ SG LP D    +  L+ L LS N  SG+LP +L+ L  
Sbjct: 232 PIPAEIFNVSSLQVIAFTDNSLSGSLPKDICKHLPNLQGLSLSQNHLSGQLPTTLS-LCG 290

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            LL L LS N F G I   +    K  L+++YL  N   G IP +  N   L  L+L  N
Sbjct: 291 ELLFLSLSFNKFRGSIPKEIGNLSK--LEKIYLGTNSLIGSIPTSFGNLKALKFLNLGIN 348

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFND 532
            L+GT+P ++ ++SKL+ L +  N L G +P  +  ++  LE L +  N+
Sbjct: 349 NLTGTVPEAIFNISKLQSLAMVKNHLSGSLPSSIGTWLSDLEGLFIAGNE 398

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 62/191 (32%), Positives = 92/191 (48%), Gaps = 25/191 (13%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S L+SLA+  N+ SG LP      +  L+ L ++ NEFSG +P S++N+S  
Sbjct: 354 VPEAIFNISKLQSLAMVKNHLSGSLPSSIGTWLSDLEGLFIAGNEFSGIIPMSISNMS-K 412

Query: 209 LLTLDLSSNNFSGPI-------------------------LPNLCQNPKNTLQELYLQNN 313
           L  L LS+N+F+G +                         LPN   N    L+       
Sbjct: 413 LTVLGLSANSFTGNVGFLTSLTNCKFLKNLWIGNNPFKGTLPNSLGNLPIALESFIASAC 472

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            F G IP  + N + L+ L L  N L+G+IP++LG L KL+ L +  N L G IP +L  
Sbjct: 473 QFRGTIPTRIGNLTNLIWLDLGANDLTGSIPTTLGRLKKLQKLHIVGNRLRGSIPNDLWP 532

Query: 494 VKTLETLILDF 526
            + L  L  +F
Sbjct: 533 FEELGILAFEF 543

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 44/135 (32%), Positives = 75/135 (55%), Gaps = 1/135 (0%)
 Frame = +2

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
           +  ++LS     G +   + NLS  L++LDLS+N+F G +  ++     + L+ELYL NN
Sbjct: 72  VSAINLSNMGLEGTIAPQVGNLSF-LVSLDLSNNHFHGSLPKDIAICNLSKLEELYLGNN 130

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
              G+IP  +++   L  L    N L+G+IP+++ ++S L ++ L  N L G +P ++ Y
Sbjct: 131 QLIGEIPKKMNHLQNLKVLSFPMNNLTGSIPATIFNISSLLNISLSNNNLSGSLPMDMCY 190

Query: 494 VK-TLETLILDFNDL 535
               L+ L L  N L
Sbjct: 191 ANPKLKKLNLSSNHL 205

[88][TOP]
>UniRef100_A7PDH2 Chromosome chr17 scaffold_12, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PDH2_VITVI
          Length = 1004

 Score =  110 bits (276), Expect = 5e-23
 Identities = 71/178 (39%), Positives = 95/178 (53%), Gaps = 24/178 (13%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS- 202
           P+PP  GS S LE L L +NNFS ++P ++LL +  L  LDLS N F GE+ E       
Sbjct: 270 PIPPELGSLSSLEGLFLGNNNFSRQVP-ESLLNLSSLAFLDLSKNNFGGEIQEIFGKFKQ 328

Query: 203 -----------------------ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
                                  +++  LDLS NNFSGP+   L + P  +L+ L L +N
Sbjct: 329 VRFLVLHTNSYTGGIYSSGILKLSNISRLDLSFNNFSGPLPVELSEMP--SLEFLILAHN 386

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            F+G IPP   N   L +L LSFN L+G+IPS++G L+ L  L L  N   GEIP E+
Sbjct: 387 QFSGSIPPEFGNIRRLQALDLSFNSLNGSIPSTIGKLNSLLWLMLANNRFSGEIPPEI 444

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 52/126 (41%), Positives = 75/126 (59%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           S +  L LS NNFSG LP++ L +M  L+ L L+ N+FSG +P    N+   L  LDLS 
Sbjct: 352 SNISRLDLSFNNFSGPLPVE-LSEMPSLEFLILAHNQFSGSIPPEFGNIRR-LQALDLSF 409

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           N+ +G I   +     N+L  L L NN F+G+IPP + NC+ L+ L+L+ N  SG IP  
Sbjct: 410 NSLNGSIPSTI--GKLNSLLWLMLANNRFSGEIPPEIGNCTSLLWLNLANNQFSGKIPPE 467

Query: 413 LGSLSK 430
           L ++ +
Sbjct: 468 LTTIGR 473

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 56/161 (34%), Positives = 82/161 (50%)
 Frame = +2

Query: 50  CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
           C  L    +S NNF+G +  +   + + LK LDLS N FSGE+ +      A L     S
Sbjct: 160 CDRLVLANISENNFTGSID-NCFDECKSLKYLDLSSNNFSGEIWQGF----ARLQQFSAS 214

Query: 230 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 409
            N F G + P++       L  L L  N F G++P  ++NC+ L  L+L  N+ +G IP 
Sbjct: 215 ENRFGGVVSPSIFGGVC-ALGLLELSKNSFGGEVPGEIANCTSLRILNLWGNHFTGPIPP 273

Query: 410 SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            LGSLS L  L L  N    ++P+ L+ + +L  L L  N+
Sbjct: 274 ELGSLSSLEGLFLGNNNFSRQVPESLLNLSSLAFLDLSKNN 314

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 59/163 (36%), Positives = 77/163 (47%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F  C  L+ L LSSNNFSGE+          L+    S N F G +  S+     +L  L
Sbjct: 181 FDECKSLKYLDLSSNNFSGEIWQG----FARLQQFSASENRFGGVVSPSIFGGVCALGLL 236

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
           +LS N+F G +   +      +L+ L L  N FTG IPP L + S L  L L  N  S  
Sbjct: 237 ELSKNSFGGEVPGEIANC--TSLRILNLWGNHFTGPIPPELGSLSSLEGLFLGNNNFSRQ 294

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           +P SL +LS L  L L  N   GEI +     K +  L+L  N
Sbjct: 295 VPESLLNLSSLAFLDLSKNNFGGEIQEIFGKFKQVRFLVLHTN 337

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 56/179 (31%), Positives = 87/179 (48%), Gaps = 29/179 (16%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLL-------------KMRGLKV--------- 142
           +PP  G+C+ L  L L++N FSG++P +                K RG+           
Sbjct: 440 IPPEIGNCTSLLWLNLANNQFSGKIPPELTTIGRNPFPTFEMNRKNRGIPAGSGECQVRT 499

Query: 143 ------LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 304
                 + +S N+FSGE+P  + N+    L + +++N F G + P + Q P   L    L
Sbjct: 500 LQISGYVQISGNQFSGEVPPEIRNMQNFSL-IQMAANKFYGKLPPAIGQLPVVVLN---L 555

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLN-MLEGEIP 478
             N F+G+IP  + N   L +L LS N  SGT P+SL +LS+L    +  N ++ G IP
Sbjct: 556 SENNFSGEIPMEIGNLGCLQNLDLSSNNFSGTFPTSLNNLSELNKFNISYNPLISGVIP 614

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 59/204 (28%), Positives = 92/204 (45%), Gaps = 28/204 (13%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
            F SL   +P   G  + L  L L++N FSGE+P + +     L  L+L+ N+FSG++P  
Sbjct: 409  FNSLNGSIPSTIGKLNSLLWLMLANNRFSGEIPPE-IGNCTSLLWLNLANNQFSGKIPPE 467

Query: 188  LTNLSASLLT----------------------------LDLSSNNFSGPILPNLCQNPKN 283
            LT +  +                               + +S N FSG + P + +N +N
Sbjct: 468  LTTIGRNPFPTFEMNRKNRGIPAGSGECQVRTLQISGYVQISGNQFSGEVPPEI-RNMQN 526

Query: 284  TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNML 463
                + +  N F GK+PP +     +V L+LS N  SG IP  +G+L  L++L L  N  
Sbjct: 527  -FSLIQMAANKFYGKLPPAIGQL-PVVVLNLSENNFSGEIPMEIGNLGCLQNLDLSSNNF 584

Query: 464  EGEIPQELMYVKTLETLILDFNDL 535
             G  P  L  +  L    + +N L
Sbjct: 585  SGTFPTSLNNLSELNKFNISYNPL 608

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 43/114 (37%), Positives = 69/114 (60%), Gaps = 1/114 (0%)
 Frame = +2

Query: 74  LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI 253
           +S N FSGE+P + +  M+   ++ ++ N+F G+LP ++  L   ++ L+LS NNFSG I
Sbjct: 508 ISGNQFSGEVPPE-IRNMQNFSLIQMAANKFYGKLPPAIGQLP--VVVLNLSENNFSGEI 564

Query: 254 LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN-YLSGTIPSS 412
              +       LQ L L +N F+G  P +L+N SEL   ++S+N  +SG IPS+
Sbjct: 565 PMEI--GNLGCLQNLDLSSNNFSGTFPTSLNNLSELNKFNISYNPLISGVIPST 616

 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 56/186 (30%), Positives = 82/186 (44%), Gaps = 22/186 (11%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F + + L  L LS N   G +P D L +   L  L+LS N  + EL  +   +   L+  
Sbjct: 108 FSALTKLSHLDLSKNTLGGRIPAD-LRRCESLVYLNLSHNIINDELNLTGLKICDRLVLA 166

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI----------------------P 334
           ++S NNF+G I  + C +   +L+ L L +N F+G+I                      P
Sbjct: 167 NISENNFTGSI--DNCFDECKSLKYLDLSSNNFSGEIWQGFARLQQFSASENRFGGVVSP 224

Query: 335 PTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETL 514
                   L  L LS N   G +P  + + + LR L LW N   G IP EL  + +LE L
Sbjct: 225 SIFGGVCALGLLELSKNSFGGEVPGEIANCTSLRILNLWGNHFTGPIPPELGSLSSLEGL 284

Query: 515 ILDFND 532
            L  N+
Sbjct: 285 FLGNNN 290

[89][TOP]
>UniRef100_Q8SB69 Os10g0155733 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q8SB69_ORYSJ
          Length = 1155

 Score =  110 bits (275), Expect = 6e-23
 Identities = 72/180 (40%), Positives = 105/180 (58%), Gaps = 3/180 (1%)
 Frame = +2

Query: 5   LFLS---LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE 175
           LFLS   L   +P FF S   L+ L L  N+F+GELP  ++ ++  L+ L ++ N F+G 
Sbjct: 268 LFLSYNNLTGEVPDFFASMPNLQKLYLDDNHFAGELPA-SIGELVSLEKLVVTANRFTGT 326

Query: 176 LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS 355
           +PE++ N    L+ L L+SNNF+G I P    N  + L+   +  NG TG IPP +  C 
Sbjct: 327 IPETIGNCRC-LIMLYLNSNNFTGSI-PAFIGN-LSRLEMFSMAENGITGSIPPEIGKCR 383

Query: 356 ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +LV L L  N L+GTIP  +G LS+L+ L L+ N+L G +PQ L  +  +  L L+ N L
Sbjct: 384 QLVDLQLHKNSLTGTIPPEIGELSRLQKLYLYNNLLHGPVPQALWRLVDMVELFLNDNRL 443

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 64/171 (37%), Positives = 93/171 (54%), Gaps = 1/171 (0%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+P   G+ S+L++L +SSN  +G +P + L   + L  LDL  N  +G +P  +T LS 
Sbjct: 592  PIPHELGALSILDTLLMSSNRLTGAIPHE-LGNCKRLAHLDLGNNLLNGSIPAEITTLSG 650

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS-LHLSF 382
             L  L L  N  +GPI  +       +L EL L +N   G IP ++ N   +   L++S 
Sbjct: 651  -LQNLLLGGNKLAGPIPDSFTAT--QSLLELQLGSNNLEGGIPQSVGNLQYISQGLNISN 707

Query: 383  NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            N LSG IP SLG+L KL  L L  N L G IP +L  + +L  + + FN+L
Sbjct: 708  NRLSGPIPHSLGNLQKLEVLDLSNNSLSGPIPSQLSNMISLSVVNISFNEL 758

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 64/162 (39%), Positives = 86/162 (53%)
 Frame = +2

Query: 50   CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
            C  L  + L++N  SG LP D L   RG+  LD+S N   G +P +L  L  +L  LD+S
Sbjct: 528  CESLYRVNLNNNKLSGSLPAD-LSTNRGVTHLDISGNLLKGRIPGAL-GLWHNLTRLDVS 585

Query: 230  SNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 409
             N FSGPI   L     + L  L + +N  TG IP  L NC  L  L L  N L+G+IP+
Sbjct: 586  GNKFSGPIPHEL--GALSILDTLLMSSNRLTGAIPHELGNCKRLAHLDLGNNLLNGSIPA 643

Query: 410  SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             + +LS L++L L  N L G IP      ++L  L L  N+L
Sbjct: 644  EITTLSGLQNLLLGGNKLAGPIPDSFTATQSLLELQLGSNNL 685

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/150 (37%), Positives = 81/150 (54%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+C  L  L L +N  +G +P + +  + GL+ L L  N+ +G +P+S T  + S
Sbjct: 617  IPHELGNCKRLAHLDLGNNLLNGSIPAE-ITTLSGLQNLLLGGNKLAGPIPDSFT-ATQS 674

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            LL L L SNN  G I P    N +   Q L + NN  +G IP +L N  +L  L LS N 
Sbjct: 675  LLELQLGSNNLEGGI-PQSVGNLQYISQGLNISNNRLSGPIPHSLGNLQKLEVLDLSNNS 733

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LSG IPS L ++  L  + +  N L G++P
Sbjct: 734  LSGPIPSQLSNMISLSVVNISFNELSGQLP 763

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 54/166 (32%), Positives = 87/166 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+C  L  L L+SNNF+G +P   +  +  L++  ++ N  +G +P  +      
Sbjct: 327 IPETIGNCRCLIMLYLNSNNFTGSIPA-FIGNLSRLEMFSMAENGITGSIPPEIGKCR-Q 384

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L L  N+ +G I P + +  +  LQ+LYL NN   G +P  L    ++V L L+ N 
Sbjct: 385 LVDLQLHKNSLTGTIPPEIGELSR--LQKLYLYNNLLHGPVPQALWRLVDMVELFLNDNR 442

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDF 526
           LSG +   +  +S LR++ L+ N   GE+PQ L    T   L +DF
Sbjct: 443 LSGEVHEDITQMSNLREITLYNNNFTGELPQALGMNTTSGLLRVDF 488

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 59/188 (31%), Positives = 88/188 (46%), Gaps = 21/188 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    +C+ + +L L  NN SG +P + LL  R L  +DL+ N  +GE+P    +    
Sbjct: 136 VPAALAACAGVATLLLGGNNLSGGVPPE-LLSSRQLVEVDLNGNALTGEIPAPAGS-PVV 193

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNT---------------------LQELYLQNNGFTG 325
           L  LDLS N+ SG + P L   P                        L+ L L  N   G
Sbjct: 194 LEYLDLSGNSLSGAVPPELAALPDLRYLDLSINRLTGPMPEFPVHCRLKFLGLYRNQIAG 253

Query: 326 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
           ++P +L NC  L  L LS+N L+G +P    S+  L+ L L  N   GE+P  +  + +L
Sbjct: 254 ELPKSLGNCGNLTVLFLSYNNLTGEVPDFFASMPNLQKLYLDDNHFAGELPASIGELVSL 313

Query: 506 ETLILDFN 529
           E L++  N
Sbjct: 314 EKLVVTAN 321

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 53/155 (34%), Positives = 82/155 (52%), Gaps = 1/155 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-TNLS 202
           P+P        +  L L+ N  SGE+  D + +M  L+ + L  N F+GELP++L  N +
Sbjct: 422 PVPQALWRLVDMVELFLNDNRLSGEVHED-ITQMSNLREITLYNNNFTGELPQALGMNTT 480

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           + LL +D + N F G I P LC   +  L  L L NN F G     ++ C  L  ++L+ 
Sbjct: 481 SGLLRVDFTRNRFRGAIPPGLCT--RGQLAVLDLGNNQFDGGFSSGIAKCESLYRVNLNN 538

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N LSG++P+ L +   +  L +  N+L+G IP  L
Sbjct: 539 NKLSGSLPADLSTNRGVTHLDISGNLLKGRIPGAL 573

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 60/174 (34%), Positives = 89/174 (51%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           L+ E+P P   GS  +LE L LS N+ SG +P + L  +  L+ LDLS N  +G +PE  
Sbjct: 180 LTGEIPAPA--GSPVVLEYLDLSGNSLSGAVPPE-LAALPDLRYLDLSINRLTGPMPEFP 236

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            +    L  L L  N  +G  LP    N  N L  L+L  N  TG++P   ++   L  L
Sbjct: 237 VH--CRLKFLGLYRNQIAGE-LPKSLGNCGN-LTVLFLSYNNLTGEVPDFFASMPNLQKL 292

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           +L  N+ +G +P+S+G L  L  L +  N   G IP+ +   + L  L L+ N+
Sbjct: 293 YLDDNHFAGELPASIGELVSLEKLVVTANRFTGTIPETIGNCRCLIMLYLNSNN 346

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 51/130 (39%), Positives = 65/130 (50%)
 Frame = +2

Query: 92  SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ 271
           S   P    L    L VLDLS N F+G +P +L    A + TL L  NN SG + P L  
Sbjct: 108 SASAPRLCALPASALPVLDLSGNGFTGAVPAALA-ACAGVATLLLGGNNLSGGVPPELLS 166

Query: 272 NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLW 451
           +    L E+ L  N  TG+IP    +   L  L LS N LSG +P  L +L  LR L L 
Sbjct: 167 S--RQLVEVDLNGNALTGEIPAPAGSPVVLEYLDLSGNSLSGAVPPELAALPDLRYLDLS 224

Query: 452 LNMLEGEIPQ 481
           +N L G +P+
Sbjct: 225 INRLTGPMPE 234

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 51/158 (32%), Positives = 74/158 (46%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP  G  S L+ L L +N   G +P   L ++  +  L L+ N  SGE+ E +T
Sbjct: 394 SLTGTIPPEIGELSRLQKLYLYNNLLHGPVPQ-ALWRLVDMVELFLNDNRLSGEVHEDIT 452

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            +S +L  + L +NNF+G +   L  N  + L  +    N F G IPP L    +L  L 
Sbjct: 453 QMS-NLREITLYNNNFTGELPQALGMNTTSGLLRVDFTRNRFRGAIPPGLCTRGQLAVLD 511

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           L  N   G   S +     L  + L  N L G +P +L
Sbjct: 512 LGNNQFDGGFSSGIAKCESLYRVNLNNNKLSGSLPADL 549

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 42/115 (36%), Positives = 58/115 (50%), Gaps = 3/115 (2%)
 Frame = +2

Query: 200 SASLLTLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           + ++  L+LS    +G +    P LC  P + L  L L  NGFTG +P  L+ C+ + +L
Sbjct: 90  TGAVAALNLSGVGLTGALSASAPRLCALPASALPVLDLSGNGFTGAVPAALAACAGVATL 149

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N LSG +P  L S  +L ++ L  N L GEIP        LE L L  N L
Sbjct: 150 LLGGNNLSGGVPPELLSSRQLVEVDLNGNALTGEIPAPAGSPVVLEYLDLSGNSL 204

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 48/135 (35%), Positives = 64/135 (47%), Gaps = 4/135 (2%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSA----SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN 310
           L+LS    +G L  S   L A    +L  LDLS N F+G +   L       +  L L  
Sbjct: 96  LNLSGVGLTGALSASAPRLCALPASALPVLDLSGNGFTGAVPAALAACAG--VATLLLGG 153

Query: 311 NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM 490
           N  +G +PP L +  +LV + L+ N L+G IP+  GS   L  L L  N L G +P EL 
Sbjct: 154 NNLSGGVPPELLSSRQLVEVDLNGNALTGEIPAPAGSPVVLEYLDLSGNSLSGAVPPELA 213

Query: 491 YVKTLETLILDFNDL 535
            +  L  L L  N L
Sbjct: 214 ALPDLRYLDLSINRL 228

[90][TOP]
>UniRef100_C5XPY8 Putative uncharacterized protein Sb03g005930 n=1 Tax=Sorghum
           bicolor RepID=C5XPY8_SORBI
          Length = 991

 Score =  110 bits (275), Expect = 6e-23
 Identities = 75/182 (41%), Positives = 105/182 (57%), Gaps = 7/182 (3%)
 Frame = +2

Query: 11  LSLELP-------LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS 169
           +SL LP       L P  G+ + L +L LSSN F GE+P +++ ++  L+VLDLS+N FS
Sbjct: 74  VSLSLPSYGLAGALSPAIGNLTFLRTLNLSSNWFQGEIP-ESIGRLARLQVLDLSYNAFS 132

Query: 170 GELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN 349
           G LP +L++   SLL L LSSN   G I P +  N    L+ L L NN  TG I  +L N
Sbjct: 133 GTLPANLSSC-VSLLLLSLSSNQIHGRI-PVVLGNKLTHLRGLLLANNSLTGTISGSLGN 190

Query: 350 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            S L  L L+ N L G +P  LGS+  L+ L L+ N L G +PQ L  + +L+   +++N
Sbjct: 191 LSSLDYLDLTDNQLEGPVPHELGSMGGLQVLLLFGNTLSGVLPQSLYNLSSLKNFGVEYN 250

Query: 530 DL 535
            L
Sbjct: 251 ML 252

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 68/174 (39%), Positives = 92/174 (52%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +LE P+P   G+   L    LS+N  +G +P   L   +    LDLS+N  SG LP  + 
Sbjct: 404 NLEGPIPRSLGNLKNLFVFDLSTNRLNGSIPKKVLKLPQLSWYLDLSYNALSGPLPVEVG 463

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           +L A++  L LS N  S  I P+   N  + L+ L L +N F G IP +L N   L  L+
Sbjct: 464 SL-ANVNQLILSGNQLSSSI-PDSIGNCIS-LERLLLDHNSFEGTIPQSLKNLKGLALLN 520

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+ N LSG+IP +L S+  L+ L L  N L G IP  L  +  L  L L FNDL
Sbjct: 521 LTMNKLSGSIPDALASIGNLQQLYLAHNNLSGLIPTALQNLTLLSKLDLSFNDL 574

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 64/178 (35%), Positives = 93/178 (52%), Gaps = 9/178 (5%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF--------SGELPE 184
           +PP   + S L  L L+ N F G +P   L K++GL VLDL  N          SG +P 
Sbjct: 281 VPPSVSNLSALIKLGLAGNGFIGHVP-PALGKLQGLTVLDLGDNRLEANDSQGISGAIPL 339

Query: 185 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
            + NL   L  L++++N+ SG ++P      +N L EL L N   +G IPP+L N ++L 
Sbjct: 340 DIGNL-VGLKLLEMANNSISG-VIPESIGRLEN-LVELGLYNTSLSGLIPPSLGNLTQLN 396

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE-TLILDFNDL 535
            L+  +  L G IP SLG+L  L    L  N L G IP++++ +  L   L L +N L
Sbjct: 397 RLYAYYGNLEGPIPRSLGNLKNLFVFDLSTNRLNGSIPKKVLKLPQLSWYLDLSYNAL 454

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 59/175 (33%), Positives = 89/175 (50%), Gaps = 6/175 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    + S L++  +  N  SG +P D   +   ++ L  S+N FSG +P S++NLSA 
Sbjct: 232 LPQSLYNLSSLKNFGVEYNMLSGTIPADIGDRFPSIETLSFSYNRFSGAVPPSVSNLSA- 290

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQEL---YLQNN---GFTGKIPPTLSNCSELVSL 370
           L+ L L+ N F G + P L +    T+ +L    L+ N   G +G IP  + N   L  L
Sbjct: 291 LIKLGLAGNGFIGHVPPALGKLQGLTVLDLGDNRLEANDSQGISGAIPLDIGNLVGLKLL 350

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            ++ N +SG IP S+G L  L +L L+   L G IP  L  +  L  L   + +L
Sbjct: 351 EMANNSISGVIPESIGRLENLVELGLYNTSLSGLIPPSLGNLTQLNRLYAYYGNL 405

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 53/131 (40%), Positives = 71/131 (54%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L  PLP   GS + +  L LS N  S  +P D++     L+ L L  N F G +P+SL 
Sbjct: 453 ALSGPLPVEVGSLANVNQLILSGNQLSSSIP-DSIGNCISLERLLLDHNSFEGTIPQSLK 511

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL   L  L+L+ N  SG I P+   +  N LQ+LYL +N  +G IP  L N + L  L 
Sbjct: 512 NLKG-LALLNLTMNKLSGSI-PDALASIGN-LQQLYLAHNNLSGLIPTALQNLTLLSKLD 568

Query: 374 LSFNYLSGTIP 406
           LSFN L G +P
Sbjct: 569 LSFNDLQGEVP 579

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 57/146 (39%), Positives = 77/146 (52%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           G+ S L+ L L+ N   G +P + L  M GL+VL L  N  SG LP+SL NLS SL    
Sbjct: 189 GNLSSLDYLDLTDNQLEGPVPHE-LGSMGGLQVLLLFGNTLSGVLPQSLYNLS-SLKNFG 246

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           +  N  SG I P    +   +++ L    N F+G +PP++SN S L+ L L+ N   G +
Sbjct: 247 VEYNMLSGTI-PADIGDRFPSIETLSFSYNRFSGAVPPSVSNLSALIKLGLAGNGFIGHV 305

Query: 404 PSSLGSLSKLRDLKLWLNMLEGEIPQ 481
           P +LG L  L  L L  N LE    Q
Sbjct: 306 PPALGKLQGLTVLDLGDNRLEANDSQ 331

[91][TOP]
>UniRef100_C5X984 Putative uncharacterized protein Sb02g033810 n=1 Tax=Sorghum
           bicolor RepID=C5X984_SORBI
          Length = 1255

 Score =  110 bits (275), Expect = 6e-23
 Identities = 72/177 (40%), Positives = 97/177 (54%), Gaps = 3/177 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP  G+   L+ L L +N  SG +P  TL  +  ++ +DLS N  SG LP  L 
Sbjct: 252 SLVGTIPPELGALGELQYLNLMNNRLSGRVPR-TLAALSRVRTIDLSGNMLSGALPAKLG 310

Query: 194 NLSASLLTLDLSSNNFSGPILPNLC---QNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
            L   L  L LS N  +G +  +LC   +   ++++ L L  N FTG+IP  LS C  L 
Sbjct: 311 RLP-ELTFLVLSDNQLTGSVPGDLCGGDEAESSSIEHLMLSTNNFTGEIPEGLSRCRALT 369

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L L+ N LSG IP++LG L  L DL L  N L GE+P EL  +  L+TL L  N+L
Sbjct: 370 QLDLANNSLSGGIPAALGELGNLTDLLLNNNSLSGELPPELFNLTELQTLALYHNEL 426

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 67/177 (37%), Positives = 98/177 (55%), Gaps = 1/177 (0%)
 Frame = +2

Query: 8    FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
            F  L  P+PP  G  + L  L +SSN  +G +P  TL + + L ++ LS N  SG +P+ 
Sbjct: 614  FNMLSGPIPPSLGGIAALTLLDVSSNALTGGIPA-TLAQCKQLSLIVLSHNRLSGAVPDW 672

Query: 188  LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
            L +L   L  L LS+N F+G I   L +  K  L +L L NN   G +PP L     L  
Sbjct: 673  LGSLP-QLGELTLSNNEFAGAIPVQLSKCSK--LLKLSLDNNQINGTVPPELGRLVSLNV 729

Query: 368  LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI-LDFNDL 535
            L+L+ N LSG IP+++  LS L +L L  N L G IP ++  ++ L++L+ L  N+L
Sbjct: 730  LNLAHNQLSGLIPTAVAKLSSLYELNLSQNYLSGPIPLDIGKLQELQSLLDLSSNNL 786

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 65/169 (38%), Positives = 89/169 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L  L L+S N +G +P  +L ++  L  L+L  N  SG +P  L  L AS
Sbjct: 161 IPDALGKLGNLTVLGLASCNLTGPIPA-SLGRLDALTALNLQQNALSGPIPRGLAGL-AS 218

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L+ N  +G I P L +     LQ+L L NN   G IPP L    EL  L+L  N 
Sbjct: 219 LQVLSLAGNQLTGAIPPELGR--LTGLQKLNLGNNSLVGTIPPELGALGELQYLNLMNNR 276

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG +P +L +LS++R + L  NML G +P +L  +  L  L+L  N L
Sbjct: 277 LSGRVPRTLAALSRVRTIDLSGNMLSGALPAKLGRLPELTFLVLSDNQL 325

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 70/170 (41%), Positives = 92/170 (54%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P + GS   L  L LS+N F+G +P+  L K   L  L L  N+ +G +P  L  L  S
Sbjct: 669  VPDWLGSLPQLGELTLSNNEFAGAIPVQ-LSKCSKLLKLSLDNNQINGTVPPELGRL-VS 726

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL-HLSFN 385
            L  L+L+ N  SG I   + +   ++L EL L  N  +G IP  +    EL SL  LS N
Sbjct: 727  LNVLNLAHNQLSGLIPTAVAK--LSSLYELNLSQNYLSGPIPLDIGKLQELQSLLDLSSN 784

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             LSG IP+SLGSLSKL DL L  N L G +P +L  + +L  L L  N L
Sbjct: 785  NLSGHIPASLGSLSKLEDLNLSHNALVGAVPSQLAGMSSLVQLDLSSNQL 834

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 66/177 (37%), Positives = 93/177 (52%), Gaps = 3/177 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LPP   + + L++LAL  N  SG LP D + ++  L+VL L  N+F GE+PES+ 
Sbjct: 401 SLSGELPPELFNLTELQTLALYHNELSGRLP-DAIGRLVNLEVLYLYENQFVGEIPESIG 459

Query: 194 NLSASLLTLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
           +  ASL  +D   N F+G I   + NL Q     L  L  + N  +G IPP L  C +L 
Sbjct: 460 DC-ASLQLIDFFGNRFNGSIPASMGNLSQ-----LTFLDFRQNELSGVIPPELGECQQLE 513

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L L+ N LSG+IP + G L  L    L+ N L G IP  +   + +  + +  N L
Sbjct: 514 ILDLADNALSGSIPKTFGKLRSLEQFMLYNNSLSGVIPDGMFECRNITRVNIAHNRL 570

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 62/169 (36%), Positives = 84/169 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G C  LE L L+ N  SG +P  T  K+R L+   L  N  SG +P+ +     +
Sbjct: 502 IPPELGECQQLEILDLADNALSGSIPK-TFGKLRSLEQFMLYNNSLSGVIPDGMFECR-N 559

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +  ++++ N  SG +LP LC   +  L      NN F G IP  L   S L  + L FN 
Sbjct: 560 ITRVNIAHNRLSGSLLP-LCGTAR--LLSFDATNNSFDGGIPAQLGRSSSLQRVRLGFNM 616

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP SLG ++ L  L +  N L G IP  L   K L  ++L  N L
Sbjct: 617 LSGPIPPSLGGIAALTLLDVSSNALTGGIPATLAQCKQLSLIVLSHNRL 665

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 65/183 (35%), Positives = 94/183 (51%), Gaps = 22/183 (12%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           S +E L LS+NNF+GE+P + L + R L  LDL+ N  SG +P +L  L  +L  L L++
Sbjct: 342 SSIEHLMLSTNNFTGEIP-EGLSRCRALTQLDLANNSLSGGIPAALGELG-NLTDLLLNN 399

Query: 233 NNFSGPILPNLCQNPKN----------------------TLQELYLQNNGFTGKIPPTLS 346
           N+ SG + P L    +                        L+ LYL  N F G+IP ++ 
Sbjct: 400 NSLSGELPPELFNLTELQTLALYHNELSGRLPDAIGRLVNLEVLYLYENQFVGEIPESIG 459

Query: 347 NCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDF 526
           +C+ L  +    N  +G+IP+S+G+LS+L  L    N L G IP EL   + LE L L  
Sbjct: 460 DCASLQLIDFFGNRFNGSIPASMGNLSQLTFLDFRQNELSGVIPPELGECQQLEILDLAD 519

Query: 527 NDL 535
           N L
Sbjct: 520 NAL 522

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 68/194 (35%), Positives = 90/194 (46%), Gaps = 24/194 (12%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPM------------------------DTLLKMRG 133
           P+P   G  + L+ L L SN+ +GE+P                         D L K+  
Sbjct: 111 PVPAALGGLANLQVLLLYSNHLTGEIPALLGALSALQVLRLGDNPGLSGAIPDALGKLGN 170

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
           L VL L+    +G +P SL  L A L  L+L  N  SGPI   L      +LQ L L  N
Sbjct: 171 LTVLGLASCNLTGPIPASLGRLDA-LTALNLQQNALSGPIPRGLA--GLASLQVLSLAGN 227

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
             TG IPP L   + L  L+L  N L GTIP  LG+L +L+ L L  N L G +P+ L  
Sbjct: 228 QLTGAIPPELGRLTGLQKLNLGNNSLVGTIPPELGALGELQYLNLMNNRLSGRVPRTLAA 287

Query: 494 VKTLETLILDFNDL 535
           +  + T+ L  N L
Sbjct: 288 LSRVRTIDLSGNML 301

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 60/156 (38%), Positives = 87/156 (55%), Gaps = 4/156 (2%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P     CS L  L+L +N  +G +P + L ++  L VL+L+ N+ SG +P ++  LS S
Sbjct: 693  IPVQLSKCSKLLKLSLDNNQINGTVPPE-LGRLVSLNVLNLAHNQLSGLIPTAVAKLS-S 750

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELY----LQNNGFTGKIPPTLSNCSELVSLHL 376
            L  L+LS N  SGPI  ++       LQEL     L +N  +G IP +L + S+L  L+L
Sbjct: 751  LYELNLSQNYLSGPIPLDI-----GKLQELQSLLDLSSNNLSGHIPASLGSLSKLEDLNL 805

Query: 377  SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
            S N L G +PS L  +S L  L L  N LEG++  E
Sbjct: 806  SHNALVGAVPSQLAGMSSLVQLDLSSNQLEGKLGTE 841

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 63/174 (36%), Positives = 87/174 (50%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G    L  L L++N+ SGELP + L  +  L+ L L  NE SG LP+++ 
Sbjct: 377 SLSGGIPAALGELGNLTDLLLNNNSLSGELPPE-LFNLTELQTLALYHNELSGRLPDAIG 435

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            L  +L  L L  N F G I  ++      +LQ +    N F G IP ++ N S+L  L 
Sbjct: 436 RL-VNLEVLYLYENQFVGEIPESI--GDCASLQLIDFFGNRFNGSIPASMGNLSQLTFLD 492

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              N LSG IP  LG   +L  L L  N L G IP+    +++LE  +L  N L
Sbjct: 493 FRQNELSGVIPPELGECQQLEILDLADNALSGSIPKTFGKLRSLEQFMLYNNSL 546

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 63/169 (37%), Positives = 85/169 (50%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G  S L+ + L  N  SG +P  +L  +  L +LD+S N  +G +P +L      
Sbjct: 597  IPAQLGRSSSLQRVRLGFNMLSGPIP-PSLGGIAALTLLDVSSNALTGGIPATLAQCK-Q 654

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  + LS N  SG +   L   P+  L EL L NN F G IP  LS CS+L+ L L  N 
Sbjct: 655  LSLIVLSHNRLSGAVPDWLGSLPQ--LGELTLSNNEFAGAIPVQLSKCSKLLKLSLDNNQ 712

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            ++GT+P  LG L  L  L L  N L G IP  +  + +L  L L  N L
Sbjct: 713  INGTVPPELGRLVSLNVLNLAHNQLSGLIPTAVAKLSSLYELNLSQNYL 761

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 59/157 (37%), Positives = 81/157 (51%), Gaps = 1/157 (0%)
 Frame = +2

Query: 68  LALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG 247
           L LS    +G +P   L ++  L+ +DLS N  +G +P +L  L A+L  L L SN+ +G
Sbjct: 77  LNLSGAGLAGTVPR-ALARLDALEAIDLSSNALTGPVPAALGGL-ANLQVLLLYSNHLTG 134

Query: 248 PILPNLCQNPKNTLQELYLQNN-GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
            I   L     + LQ L L +N G +G IP  L     L  L L+   L+G IP+SLG L
Sbjct: 135 EIPALL--GALSALQVLRLGDNPGLSGAIPDALGKLGNLTVLGLASCNLTGPIPASLGRL 192

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  L L  N L G IP+ L  + +L+ L L  N L
Sbjct: 193 DALTALNLQQNALSGPIPRGLAGLASLQVLSLAGNQL 229

[92][TOP]
>UniRef100_C0SW27 Receptor-like kinase n=1 Tax=Glycine max RepID=C0SW27_SOYBN
          Length = 854

 Score =  110 bits (275), Expect = 6e-23
 Identities = 72/170 (42%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C LL+SL LS+N  +G +P  +L     L  L+LSFN FSG LP SLT+ S S
Sbjct: 180 IPLSLGFCPLLQSLDLSNNLLTGAIPY-SLANSTKLYWLNLSFNSFSGPLPASLTH-SFS 237

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKN---TLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L  L L +NN SG +  +   N KN    LQ L L NN FTG +P +L +  EL  + LS
Sbjct: 238 LTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDNNFFTGDVPASLGSLRELNEISLS 297

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N  SG IP+ +G+LS+L+ L +  N L G +P  L  + +L  L  + N
Sbjct: 298 HNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNLSSLTLLNAENN 347

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 60/159 (37%), Positives = 86/159 (54%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L++L L +N F+G++P  +L  +R L  + LS N+FSG +P  +  LS  L TLD+S+N 
Sbjct: 267 LQNLILDNNFFTGDVPA-SLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNA 324

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G +   L      TL  L  +NN    +IP +L     L  L LS N  SG IPSS+ 
Sbjct: 325 LNGNLPATLSNLSSLTL--LNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIA 382

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++S LR L L LN   GEIP      ++L    + +N L
Sbjct: 383 NISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSL 421

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 23/152 (15%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   GS   L  ++LS N FSG +P +     R LK LD+S N  +G LP +L+NLS+ 
Sbjct: 281 VPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNALNGNLPATLSNLSSL 339

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 +L  L LS N FSG I  ++     ++L++L L  N F
Sbjct: 340 TLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIANI--SSLRQLDLSLNNF 397

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           +G+IP +  +   L   ++S+N LSG++P  L
Sbjct: 398 SGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLL 429

[93][TOP]
>UniRef100_B9HK67 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HK67_POPTR
          Length = 1081

 Score =  110 bits (275), Expect = 6e-23
 Identities = 76/192 (39%), Positives = 102/192 (53%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELP-----MDTLL------------------KMRGLK 139
           +P   G+C  L+SL LS N  SG LP     +++L+                  K + L+
Sbjct: 174 IPESIGNCRKLQSLPLSYNKLSGSLPEILTNLESLVELFVSHNSLEGRIPLGFGKCKNLE 233

Query: 140 VLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
            LDLSFN +SG LP  L N S SL TL +  +N  G I  +  Q  K  L  L L  N  
Sbjct: 234 TLDLSFNSYSGGLPPDLGNCS-SLATLAIIHSNLRGAIPSSFGQLKK--LSVLDLSENRL 290

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           +G IPP LSNC  L++L+L  N L G IPS LG L+KL DL+L+ N L G IP  +  + 
Sbjct: 291 SGTIPPELSNCKSLMTLNLYTNELEGKIPSELGRLNKLEDLELFNNHLSGAIPISIWKIA 350

Query: 500 TLETLILDFNDL 535
           +L+ L++  N L
Sbjct: 351 SLKYLLVYNNSL 362

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/175 (40%), Positives = 101/175 (57%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           L +  PL P  G    L+++ L++N FSG++P   L     L+ LDLS N F+G +P+S 
Sbjct: 48  LGISGPLGPETGQLKQLKTVDLNTNYFSGDIPSQ-LGNCSLLEYLDLSANSFTGGIPDSF 106

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
             L  +L TL + SN+ SG I  +L Q+    LQ LYL  N F G IP ++ N +EL+ L
Sbjct: 107 KYLQ-NLQTLIIFSNSLSGEIPESLFQDL--ALQVLYLDTNKFNGSIPRSVGNLTELLEL 163

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N LSGTIP S+G+  KL+ L L  N L G +P+ L  +++L  L +  N L
Sbjct: 164 SLFGNQLSGTIPESIGNCRKLQSLPLSYNKLSGSLPEILTNLESLVELFVSHNSL 218

 Score =  107 bits (268), Expect = 4e-22
 Identities = 72/167 (43%), Positives = 97/167 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+CSLLE L LS+N+F+G +P D+   ++ L+ L +  N  SGE+PESL     +
Sbjct: 78  IPSQLGNCSLLEYLDLSANSFTGGIP-DSFKYLQNLQTLIIFSNSLSGEIPESLFQ-DLA 135

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L +N F+G I P    N    L EL L  N  +G IP ++ NC +L SL LS+N 
Sbjct: 136 LQVLYLDTNKFNGSI-PRSVGNLTELL-ELSLFGNQLSGTIPESIGNCRKLQSLPLSYNK 193

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG++P  L +L  L +L +  N LEG IP      K LETL L FN
Sbjct: 194 LSGSLPEILTNLESLVELFVSHNSLEGRIPLGFGKCKNLETLDLSFN 240

 Score =  100 bits (250), Expect = 5e-20
 Identities = 69/204 (33%), Positives = 98/204 (48%), Gaps = 45/204 (22%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L + +N+ SGELP++ +  ++ LK L L  N+F G +P+SL  +++SLL LD + N 
Sbjct: 352 LKYLLVYNNSLSGELPLE-ITHLKNLKNLSLYNNQFFGVIPQSL-GINSSLLQLDFTDNK 409

Query: 239 FSGPILPNLCQNP--------KNTLQ---------------------------------- 292
           F+G I PNLC           +N LQ                                  
Sbjct: 410 FTGEIPPNLCHGKQLRVLNMGRNQLQGSIPSDVGGCLTLWRLILKENNLSGALPEFSENP 469

Query: 293 ---ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNML 463
               + +  N  TG IPP++ NCS L S+HLS N L+G IPS LG+L  L  + L  N L
Sbjct: 470 ILYHMDVSKNNITGPIPPSIGNCSGLTSIHLSMNKLTGFIPSELGNLVNLLVVDLSSNQL 529

Query: 464 EGEIPQELMYVKTLETLILDFNDL 535
           EG +P +L     L    + FN L
Sbjct: 530 EGSLPSQLSKCHNLGKFDVGFNSL 553

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 69/169 (40%), Positives = 91/169 (53%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SLE  +P  FG C  LE+L LS N++SG LP D L     L  L +  +   G +P S  
Sbjct: 217 SLEGRIPLGFGKCKNLETLDLSFNSYSGGLPPD-LGNCSSLATLAIIHSNLRGAIPSSFG 275

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            L   L  LDLS N  SG I P L  N K +L  L L  N   GKIP  L   ++L  L 
Sbjct: 276 QLK-KLSVLDLSENRLSGTIPPEL-SNCK-SLMTLNLYTNELEGKIPSELGRLNKLEDLE 332

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
           L  N+LSG IP S+  ++ L+ L ++ N L GE+P E+ ++K L+ L L
Sbjct: 333 LFNNHLSGAIPISIWKIASLKYLLVYNNSLSGELPLEITHLKNLKNLSL 381

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 68/171 (39%), Positives = 95/171 (55%), Gaps = 1/171 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+PP  G+CS L S+ LS N  +G +P + L  +  L V+DLS N+  G LP  L+    
Sbjct: 484 PIPPSIGNCSGLTSIHLSMNKLTGFIPSE-LGNLVNLLVVDLSSNQLEGSLPSQLSKCH- 541

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L   D+  N+ +G + P+  +N   +L  L L+ N F G IPP LS   +L  + L  N
Sbjct: 542 NLGKFDVGFNSLNGSV-PSSLRN-WTSLSTLILKENHFIGGIPPFLSELEKLTEIQLGGN 599

Query: 386 YLSGTIPSSLGSLSKLR-DLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +L G IPS +GSL  L+  L L  N L GE+P EL  +  LE L L  N+L
Sbjct: 600 FLGGEIPSWIGSLQSLQYALNLSSNGLFGELPSELGNLIKLEQLQLSNNNL 650

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 62/169 (36%), Positives = 92/169 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   +C  L +L L +N   G++P + L ++  L+ L+L  N  SG +P S+  + AS
Sbjct: 294 IPPELSNCKSLMTLNLYTNELEGKIPSE-LGRLNKLEDLELFNNHLSGAIPISIWKI-AS 351

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L + +N+ SG  LP    + KN L+ L L NN F G IP +L   S L+ L  + N 
Sbjct: 352 LKYLLVYNNSLSGE-LPLEITHLKN-LKNLSLYNNQFFGVIPQSLGINSSLLQLDFTDNK 409

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +G IP +L    +LR L +  N L+G IP ++    TL  LIL  N+L
Sbjct: 410 FTGEIPPNLCHGKQLRVLNMGRNQLQGSIPSDVGGCLTLWRLILKENNL 458

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 48/150 (32%), Positives = 72/150 (48%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F SL   +P    + + L +L L  N+F G +P   L ++  L  + L  N   GE+P  
Sbjct: 550 FNSLNGSVPSSLRNWTSLSTLILKENHFIGGIP-PFLSELEKLTEIQLGGNFLGGEIPSW 608

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           + +L +    L+LSSN   G +   L    K  L++L L NN  TG + P L     LV 
Sbjct: 609 IGSLQSLQYALNLSSNGLFGELPSELGNLIK--LEQLQLSNNNLTGTLAP-LDKIHSLVQ 665

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLN 457
           + +S+N+ SG IP +L +L        W N
Sbjct: 666 VDISYNHFSGPIPETLMNLLNSSPSSFWGN 695

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 32/90 (35%), Positives = 46/90 (51%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
           C +  + +  L L   G +G + P      +L ++ L+ NY SG IPS LG+ S L  L 
Sbjct: 33  CDHRSHCVVSLNLSGLGISGPLGPETGQLKQLKTVDLNTNYFSGDIPSQLGNCSLLEYLD 92

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N   G IP    Y++ L+TLI+  N L
Sbjct: 93  LSANSFTGGIPDSFKYLQNLQTLIIFSNSL 122

[94][TOP]
>UniRef100_B9G7K5 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9G7K5_ORYSJ
          Length = 1131

 Score =  110 bits (275), Expect = 6e-23
 Identities = 72/180 (40%), Positives = 105/180 (58%), Gaps = 3/180 (1%)
 Frame = +2

Query: 5   LFLS---LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE 175
           LFLS   L   +P FF S   L+ L L  N+F+GELP  ++ ++  L+ L ++ N F+G 
Sbjct: 244 LFLSYNNLTGEVPDFFASMPNLQKLYLDDNHFAGELPA-SIGELVSLEKLVVTANRFTGT 302

Query: 176 LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS 355
           +PE++ N    L+ L L+SNNF+G I P    N  + L+   +  NG TG IPP +  C 
Sbjct: 303 IPETIGNCRC-LIMLYLNSNNFTGSI-PAFIGN-LSRLEMFSMAENGITGSIPPEIGKCR 359

Query: 356 ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +LV L L  N L+GTIP  +G LS+L+ L L+ N+L G +PQ L  +  +  L L+ N L
Sbjct: 360 QLVDLQLHKNSLTGTIPPEIGELSRLQKLYLYNNLLHGPVPQALWRLVDMVELFLNDNRL 419

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 64/171 (37%), Positives = 93/171 (54%), Gaps = 1/171 (0%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+P   G+ S+L++L +SSN  +G +P + L   + L  LDL  N  +G +P  +T LS 
Sbjct: 568  PIPHELGALSILDTLLMSSNRLTGAIPHE-LGNCKRLAHLDLGNNLLNGSIPAEITTLSG 626

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS-LHLSF 382
             L  L L  N  +GPI  +       +L EL L +N   G IP ++ N   +   L++S 
Sbjct: 627  -LQNLLLGGNKLAGPIPDSFTAT--QSLLELQLGSNNLEGGIPQSVGNLQYISQGLNISN 683

Query: 383  NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            N LSG IP SLG+L KL  L L  N L G IP +L  + +L  + + FN+L
Sbjct: 684  NRLSGPIPHSLGNLQKLEVLDLSNNSLSGPIPSQLSNMISLSVVNISFNEL 734

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 64/162 (39%), Positives = 86/162 (53%)
 Frame = +2

Query: 50  CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
           C  L  + L++N  SG LP D L   RG+  LD+S N   G +P +L  L  +L  LD+S
Sbjct: 504 CESLYRVNLNNNKLSGSLPAD-LSTNRGVTHLDISGNLLKGRIPGAL-GLWHNLTRLDVS 561

Query: 230 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 409
            N FSGPI   L     + L  L + +N  TG IP  L NC  L  L L  N L+G+IP+
Sbjct: 562 GNKFSGPIPHEL--GALSILDTLLMSSNRLTGAIPHELGNCKRLAHLDLGNNLLNGSIPA 619

Query: 410 SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            + +LS L++L L  N L G IP      ++L  L L  N+L
Sbjct: 620 EITTLSGLQNLLLGGNKLAGPIPDSFTATQSLLELQLGSNNL 661

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/150 (37%), Positives = 81/150 (54%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+C  L  L L +N  +G +P + +  + GL+ L L  N+ +G +P+S T  + S
Sbjct: 593  IPHELGNCKRLAHLDLGNNLLNGSIPAE-ITTLSGLQNLLLGGNKLAGPIPDSFT-ATQS 650

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            LL L L SNN  G I P    N +   Q L + NN  +G IP +L N  +L  L LS N 
Sbjct: 651  LLELQLGSNNLEGGI-PQSVGNLQYISQGLNISNNRLSGPIPHSLGNLQKLEVLDLSNNS 709

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LSG IPS L ++  L  + +  N L G++P
Sbjct: 710  LSGPIPSQLSNMISLSVVNISFNELSGQLP 739

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 54/166 (32%), Positives = 87/166 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+C  L  L L+SNNF+G +P   +  +  L++  ++ N  +G +P  +      
Sbjct: 303 IPETIGNCRCLIMLYLNSNNFTGSIPA-FIGNLSRLEMFSMAENGITGSIPPEIGKCR-Q 360

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L L  N+ +G I P + +  +  LQ+LYL NN   G +P  L    ++V L L+ N 
Sbjct: 361 LVDLQLHKNSLTGTIPPEIGELSR--LQKLYLYNNLLHGPVPQALWRLVDMVELFLNDNR 418

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDF 526
           LSG +   +  +S LR++ L+ N   GE+PQ L    T   L +DF
Sbjct: 419 LSGEVHEDITQMSNLREITLYNNNFTGELPQALGMNTTSGLLRVDF 464

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 58/169 (34%), Positives = 86/169 (50%), Gaps = 2/169 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    +C+ L  + L+ N  +GE+P      +  L+ LDLS N  SG +P  L  L   
Sbjct: 136 VPAALAACAGLVEVDLNGNALTGEIPAPAGSPVV-LEYLDLSGNSLSGAVPPELAALP-D 193

Query: 209 LLTLDLSSNNFSGPI--LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           L  LDLS N  +GP+   P  C+     L+ L L  N   G++P +L NC  L  L LS+
Sbjct: 194 LRYLDLSINRLTGPMPEFPVHCR-----LKFLGLYRNQIAGELPKSLGNCGNLTVLFLSY 248

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           N L+G +P    S+  L+ L L  N   GE+P  +  + +LE L++  N
Sbjct: 249 NNLTGEVPDFFASMPNLQKLYLDDNHFAGELPASIGELVSLEKLVVTAN 297

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 53/155 (34%), Positives = 82/155 (52%), Gaps = 1/155 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-TNLS 202
           P+P        +  L L+ N  SGE+  D + +M  L+ + L  N F+GELP++L  N +
Sbjct: 398 PVPQALWRLVDMVELFLNDNRLSGEVHED-ITQMSNLREITLYNNNFTGELPQALGMNTT 456

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           + LL +D + N F G I P LC   +  L  L L NN F G     ++ C  L  ++L+ 
Sbjct: 457 SGLLRVDFTRNRFRGAIPPGLCT--RGQLAVLDLGNNQFDGGFSSGIAKCESLYRVNLNN 514

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N LSG++P+ L +   +  L +  N+L+G IP  L
Sbjct: 515 NKLSGSLPADLSTNRGVTHLDISGNLLKGRIPGAL 549

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 60/174 (34%), Positives = 89/174 (51%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           L+ E+P P   GS  +LE L LS N+ SG +P + L  +  L+ LDLS N  +G +PE  
Sbjct: 156 LTGEIPAPA--GSPVVLEYLDLSGNSLSGAVPPE-LAALPDLRYLDLSINRLTGPMPEFP 212

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            +    L  L L  N  +G  LP    N  N L  L+L  N  TG++P   ++   L  L
Sbjct: 213 VH--CRLKFLGLYRNQIAGE-LPKSLGNCGN-LTVLFLSYNNLTGEVPDFFASMPNLQKL 268

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           +L  N+ +G +P+S+G L  L  L +  N   G IP+ +   + L  L L+ N+
Sbjct: 269 YLDDNHFAGELPASIGELVSLEKLVVTANRFTGTIPETIGNCRCLIMLYLNSNN 322

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 51/158 (32%), Positives = 74/158 (46%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP  G  S L+ L L +N   G +P   L ++  +  L L+ N  SGE+ E +T
Sbjct: 370 SLTGTIPPEIGELSRLQKLYLYNNLLHGPVPQ-ALWRLVDMVELFLNDNRLSGEVHEDIT 428

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            +S +L  + L +NNF+G +   L  N  + L  +    N F G IPP L    +L  L 
Sbjct: 429 QMS-NLREITLYNNNFTGELPQALGMNTTSGLLRVDFTRNRFRGAIPPGLCTRGQLAVLD 487

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           L  N   G   S +     L  + L  N L G +P +L
Sbjct: 488 LGNNQFDGGFSSGIAKCESLYRVNLNNNKLSGSLPADL 525

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 52/148 (35%), Positives = 75/148 (50%)
 Frame = +2

Query: 92  SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ 271
           S   P    L    L VLDLS N F+G +P +L    A L+ +DL+ N  +G I P    
Sbjct: 108 SASAPRLCALPASALPVLDLSGNGFTGAVPAALA-ACAGLVEVDLNGNALTGEI-PAPAG 165

Query: 272 NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLW 451
           +P   L+ L L  N  +G +PP L+   +L  L LS N L+G +P       +L+ L L+
Sbjct: 166 SPV-VLEYLDLSGNSLSGAVPPELAALPDLRYLDLSINRLTGPMP-EFPVHCRLKFLGLY 223

Query: 452 LNMLEGEIPQELMYVKTLETLILDFNDL 535
            N + GE+P+ L     L  L L +N+L
Sbjct: 224 RNQIAGELPKSLGNCGNLTVLFLSYNNL 251

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 43/115 (37%), Positives = 59/115 (51%), Gaps = 3/115 (2%)
 Frame = +2

Query: 200 SASLLTLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           + ++  L+LS    +G +    P LC  P + L  L L  NGFTG +P  L+ C+ LV +
Sbjct: 90  TGAVAALNLSGVGLTGALSASAPRLCALPASALPVLDLSGNGFTGAVPAALAACAGLVEV 149

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+ N L+G IP+  GS   L  L L  N L G +P EL  +  L  L L  N L
Sbjct: 150 DLNGNALTGEIPAPAGSPVVLEYLDLSGNSLSGAVPPELAALPDLRYLDLSINRL 204

[95][TOP]
>UniRef100_B8ADC1 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ADC1_ORYSI
          Length = 1130

 Score =  110 bits (275), Expect = 6e-23
 Identities = 74/181 (40%), Positives = 97/181 (53%), Gaps = 7/181 (3%)
 Frame = +2

Query: 14  SLELP-------LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SL LP       L P  G+ + L  L LSSN   GE+P  ++ ++R L+ L+LS+N FSG
Sbjct: 74  SLSLPSSNLAGTLSPAIGNLTFLRRLNLSSNGLYGEIPT-SIGRLRRLQWLNLSYNSFSG 132

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
             P +LT+   SL  LDL  N   G I+P    N    LQ L L NN   G IPP+L+N 
Sbjct: 133 AFPVNLTSC-ISLKILDLDYNQLGG-IIPVELGNTLTQLQMLLLTNNSIIGPIPPSLANL 190

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           S L  L+L +N+L G IP  LG+   L +L L  NML GE P  L  +  L  + +  N 
Sbjct: 191 SLLQDLYLDYNHLEGLIPPCLGNFPVLHELSLEANMLTGEFPHSLWNLSALRVIGVGLNM 250

Query: 533 L 535
           L
Sbjct: 251 L 251

 Score =  100 bits (249), Expect = 7e-20
 Identities = 63/153 (41%), Positives = 84/153 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L+ L LS N+FSG  P++ L     LK+LDL +N+  G +P  L N    
Sbjct: 110 IPTSIGRLRRLQWLNLSYNSFSGAFPVN-LTSCISLKILDLDYNQLGGIIPVELGNTLTQ 168

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L++N+  GPI P+L     + LQ+LYL  N   G IPP L N   L  L L  N 
Sbjct: 169 LQMLLLTNNSIIGPIPPSLAN--LSLLQDLYLDYNHLEGLIPPCLGNFPVLHELSLEANM 226

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           L+G  P SL +LS LR + + LNML+G IP  +
Sbjct: 227 LTGEFPHSLWNLSALRVIGVGLNMLQGSIPANI 259

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 61/164 (37%), Positives = 89/164 (54%), Gaps = 1/164 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +CS L+ L LS N F G+LP   +     L++LDL  N FSG +P  ++NL   L  LDL
Sbjct: 340 NCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISNL-IGLRLLDL 398

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
             N  SG I  ++       L +L L N G +G IP T+ N ++L  L      L G IP
Sbjct: 399 GFNPISGVIPESI--GKLTNLVDLALYNTGLSGLIPSTIGNLTKLNRLLAFHTNLEGPIP 456

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI-LDFNDL 535
           +++G L  L +L L  N L G IP+E++ + +L  ++ L +N L
Sbjct: 457 ATIGRLKNLFNLDLSFNRLNGSIPREILELPSLAWILDLSYNSL 500

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 67/174 (38%), Positives = 93/174 (53%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +LE P+P   G    L +L LS N  +G +P + L       +LDLS+N  SG LP  + 
Sbjct: 450 NLEGPIPATIGRLKNLFNLDLSFNRLNGSIPREILELPSLAWILDLSYNSLSGHLPSEVG 509

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            L A+L  L LS N  SG I PN   N +  L+ L L NN F G +P +L+N   L  L+
Sbjct: 510 TL-ANLNQLILSGNQLSGQI-PNSIGNCE-VLEFLLLDNNSFGGDMPQSLTNLKGLNVLN 566

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+ N LSG IP+++ ++  L+ L L  N   G IP  L     L+ L + FN+L
Sbjct: 567 LTVNKLSGRIPNAISNIGNLQYLCLAHNNFSGPIPAALQNFTLLKQLDVSFNNL 620

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 64/167 (38%), Positives = 89/167 (53%), Gaps = 4/167 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF---SGELPESLTNL 199
           +P    + S L  L L+ NNF+G +P  TL  +  LK L +  N+    +G+  E +T+L
Sbjct: 280 IPSSLSNLSRLTDLYLADNNFTGFVP-PTLGMLHSLKYLYIGTNQLEADNGKGWEFVTSL 338

Query: 200 S-ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
           +  S L   + S+NF G  LP    N   TLQ L L+NN F+G IP  +SN   L  L L
Sbjct: 339 ANCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISNLIGLRLLDL 398

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 517
            FN +SG IP S+G L+ L DL L+   L G IP  +  +  L  L+
Sbjct: 399 GFNPISGVIPESIGKLTNLVDLALYNTGLSGLIPSTIGNLTKLNRLL 445

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/131 (41%), Positives = 73/131 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LP   G+ + L  L LS N  SG++P +++     L+ L L  N F G++P+SLT
Sbjct: 499 SLSGHLPSEVGTLANLNQLILSGNQLSGQIP-NSIGNCEVLEFLLLDNNSFGGDMPQSLT 557

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL   L  L+L+ N  SG I PN   N  N LQ L L +N F+G IP  L N + L  L 
Sbjct: 558 NLKG-LNVLNLTVNKLSGRI-PNAISNIGN-LQYLCLAHNNFSGPIPAALQNFTLLKQLD 614

Query: 374 LSFNYLSGTIP 406
           +SFN L G +P
Sbjct: 615 VSFNNLQGEVP 625

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 64/205 (31%), Positives = 98/205 (47%), Gaps = 32/205 (15%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN------------ 160
           LE  +PP  G+  +L  L+L +N  +GE P  +L  +  L+V+ +  N            
Sbjct: 203 LEGLIPPCLGNFPVLHELSLEANMLTGEFP-HSLWNLSALRVIGVGLNMLQGSIPANIGD 261

Query: 161 -------------EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY 301
                         F G +P SL+NLS  L  L L+ NNF+G + P L     ++L+ LY
Sbjct: 262 KFPAMRFFGLHENRFHGAIPSSLSNLS-RLTDLYLADNNFTGFVPPTL--GMLHSLKYLY 318

Query: 302 L------QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNM 460
           +       +NG   +   +L+NCS+L  L LS N+  G +P S+ +LS  L+ L L  N 
Sbjct: 319 IGTNQLEADNGKGWEFVTSLANCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNS 378

Query: 461 LEGEIPQELMYVKTLETLILDFNDL 535
             G IP ++  +  L  L L FN +
Sbjct: 379 FSGTIPHDISNLIGLRLLDLGFNPI 403

[96][TOP]
>UniRef100_A7QQF7 Chromosome undetermined scaffold_142, whole genome shotgun sequence
           n=1 Tax=Vitis vinifera RepID=A7QQF7_VITVI
          Length = 1023

 Score =  110 bits (275), Expect = 6e-23
 Identities = 69/191 (36%), Positives = 100/191 (52%), Gaps = 23/191 (12%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           PP   +C LLE+L LS N    ++P D L  +R L+ L L+ N F GE+P  L     +L
Sbjct: 220 PPSLRNCELLETLDLSHNVLEYKIPGDLLGNLRNLRWLSLAHNRFMGEIPPELAATCGTL 279

Query: 212 LTLDLSSNNFSGP-----------ILPNLCQNPKN------------TLQELYLQNNGFT 322
             LDLS+NN SG            +  NL  N  +            +L+ LY+  N  T
Sbjct: 280 QGLDLSANNLSGGFPLTFASCSSLVSLNLGNNRLSGDFLTMVISTLPSLKYLYVPFNNLT 339

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G +P +L+NC++L  + L+ N+LSGT+P  LG+  KLR + L  N L G IP E+  +  
Sbjct: 340 GSVPLSLTNCTQLQKILLADNFLSGTVPLELGNCQKLRSIDLSFNNLSGPIPYEIWTLPN 399

Query: 503 LETLILDFNDL 535
           L  L++  N+L
Sbjct: 400 LSDLVMWANNL 410

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 63/174 (36%), Positives = 97/174 (55%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F +L   +P    +C+ L+ + L+ N  SG +P++ L   + L+ +DLSFN  SG +P  
Sbjct: 335 FNNLTGSVPLSLTNCTQLQKILLADNFLSGTVPLE-LGNCQKLRSIDLSFNNLSGPIPYE 393

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           +  L  +L  L + +NN +G I   +C    N L+ L L NN   G IP +L+NC+ L+ 
Sbjct: 394 IWTLP-NLSDLVMWANNLTGEIPEGICIKGGN-LETLILNNNRINGTIPLSLANCTNLIW 451

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           + L+ N L+G IP+ +G+L  L  L+L  N L G IP EL   + L  L L+ N
Sbjct: 452 VSLASNQLTGEIPAGIGNLHNLAVLQLGNNTLNGRIPSELGKCQNLIWLDLNSN 505

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 59/169 (34%), Positives = 86/169 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    +C+ L  ++L+SN  +GE+P   +  +  L VL L  N  +G +P  L     +
Sbjct: 439 IPLSLANCTNLIWVSLASNQLTGEIPAG-IGNLHNLAVLQLGNNTLNGRIPSELGKCQ-N 496

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ LDL+SN FSG +   L          L      ++G    T S+   ++ L LS+N 
Sbjct: 497 LIWLDLNSNGFSGSVPSELASEAGLVTPGLVSGKQIYSGVTVYTFSSNGSMIYLDLSYNS 556

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSGTIP S GSL+ L+ L L  N L G IP  L  +K +  L L  N+L
Sbjct: 557 LSGTIPQSFGSLNYLQVLNLGHNQLTGNIPDSLGGLKAIGVLDLSHNNL 605

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 64/192 (33%), Positives = 88/192 (45%), Gaps = 24/192 (12%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA-- 205
           P  F SCS L SL L +N  SG+     +  +  LK L + FN  +G +P SLTN +   
Sbjct: 294 PLTFASCSSLVSLNLGNNRLSGDFLTMVISTLPSLKYLYVPFNNLTGSVPLSLTNCTQLQ 353

Query: 206 ---------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
                                 L ++DLS NN SGPI   +   P   L +L +  N  T
Sbjct: 354 KILLADNFLSGTVPLELGNCQKLRSIDLSFNNLSGPIPYEIWTLPN--LSDLVMWANNLT 411

Query: 323 GKIPPTLS-NCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           G+IP  +      L +L L+ N ++GTIP SL + + L  + L  N L GEIP  +  + 
Sbjct: 412 GEIPEGICIKGGNLETLILNNNRINGTIPLSLANCTNLIWVSLASNQLTGEIPAGIGNLH 471

Query: 500 TLETLILDFNDL 535
            L  L L  N L
Sbjct: 472 NLAVLQLGNNTL 483

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 62/192 (32%), Positives = 86/192 (44%), Gaps = 26/192 (13%)
 Frame = +2

Query: 38  FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 217
           F  +C  L    LS N  + +L   +L   + L  LDLS+N  SGE+P        +L  
Sbjct: 150 FLSNCQNLNLFNLSDNKLAAKLSASSLSPCKNLSTLDLSYNLLSGEMP---FGECGNLTV 206

Query: 218 LDLSSNNFSGPILPNLCQNPK------------------------NTLQELYLQNNGFTG 325
           LDLS N+FSG   P   +N +                          L+ L L +N F G
Sbjct: 207 LDLSHNDFSGTDFPPSLRNCELLETLDLSHNVLEYKIPGDLLGNLRNLRWLSLAHNRFMG 266

Query: 326 KIPPTL-SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE-IPQELMYVK 499
           +IPP L + C  L  L LS N LSG  P +  S S L  L L  N L G+ +   +  + 
Sbjct: 267 EIPPELAATCGTLQGLDLSANNLSGGFPLTFASCSSLVSLNLGNNRLSGDFLTMVISTLP 326

Query: 500 TLETLILDFNDL 535
           +L+ L + FN+L
Sbjct: 327 SLKYLYVPFNNL 338

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 34/80 (42%), Positives = 49/80 (61%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P  FGS + L+ L L  N  +G +P D+L  ++ + VLDLS N   G +P +L 
Sbjct: 556 SLSGTIPQSFGSLNYLQVLNLGHNQLTGNIP-DSLGGLKAIGVLDLSHNNLQGYIPGALG 614

Query: 194 NLSASLLTLDLSSNNFSGPI 253
           +LS  L  LD+S+NN +GPI
Sbjct: 615 SLSF-LSDLDVSNNNLTGPI 633

[97][TOP]
>UniRef100_A7Q1E5 Chromosome chr10 scaffold_43, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7Q1E5_VITVI
          Length = 978

 Score =  110 bits (275), Expect = 6e-23
 Identities = 68/175 (38%), Positives = 102/175 (58%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           + LE  + P  G+ S L SL LS+N F G LP D + K+    +L    N  +G +P ++
Sbjct: 35  MGLEGTIAPQVGNLSFLVSLDLSNNYFHGSLPKD-IGKILINFILSFPMNNLTGSIPTTI 93

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            N+S SLL + LS N+ SG +  ++C      L+EL L +N  +GK+P  L  C +L  +
Sbjct: 94  FNMS-SLLNISLSYNSLSGSLPMDICYTNLK-LKELNLSSNHLSGKVPTGLGQCIKLQGI 151

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LS+N  +G+IPS +G+L +L+ L L  N L GEIPQ L  + +L  L L+ N+L
Sbjct: 152 SLSYNDFTGSIPSGIGNLVELQSLSLQNNSLTGEIPQSLFNIYSLRFLNLEINNL 206

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 73/195 (37%), Positives = 96/195 (49%), Gaps = 26/195 (13%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S L +++LS N+ SG LPMD       LK L+LS N  SG++P  L      
Sbjct: 89  IPTTIFNMSSLLNISLSYNSLSGSLPMDICYTNLKLKELNLSSNHLSGKVPTGLGQC-IK 147

Query: 209 LLTLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTL------------ 343
           L  + LS N+F+G I   + NL +     LQ L LQNN  TG+IP +L            
Sbjct: 148 LQGISLSYNDFTGSIPSGIGNLVE-----LQSLSLQNNSLTGEIPQSLFNIYSLRFLNLE 202

Query: 344 -----------SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM 490
                      S+C EL  L LS N  +G IP +LGSLS L +L L  N L G IP+E+ 
Sbjct: 203 INNLEGEISSFSHCRELRVLKLSINQFTGGIPKALGSLSDLEELYLGYNKLTGGIPREIG 262

Query: 491 YVKTLETLILDFNDL 535
            +  L  L L  N L
Sbjct: 263 ILSNLNILHLATNSL 277

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 66/166 (39%), Positives = 86/166 (51%), Gaps = 1/166 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG    L  L+L SN  +  +PM +   +R L VL LS N  +G LP  + N+  S
Sbjct: 482 IPSCFGDLPALRELSLDSNVLAFNIPM-SFWSLRDLLVLSLSSNFLTGNLPPEVGNMK-S 539

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           + TLDLS N  SG I P      +N L  L L  N   G IP    +   L S+ LS N 
Sbjct: 540 ITTLDLSKNLISGYI-PRRMGELQN-LVNLCLSQNKLQGSIPVEFGDLLSLESMDLSQNN 597

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK-TLETLILD 523
           LSGTIP SL +L  L+ L +  N L+GEIP    +V  T E+ I +
Sbjct: 598 LSGTIPKSLEALIYLKHLNVSFNKLQGEIPDGGPFVNFTAESFIFN 643

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 60/163 (36%), Positives = 79/163 (48%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +C  L +L +  N   G LP         L+    S   F G +P  + NL+ +L+ LDL
Sbjct: 367 NCKFLRTLWIDYNPLKGTLPNSLGNLSVALESFTASACHFRGTIPTGIGNLT-NLIWLDL 425

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            +N+ +G I   L Q  K  LQ LY+  N   G IP  L +   L  LHLS N LSG+IP
Sbjct: 426 GANDLTGSIPTTLGQLQK--LQRLYIAGNRIQGSIPNDLFHLKNLGYLHLSSNKLSGSIP 483

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           S  G L  LR+L L  N+L   IP     ++ L  L L  N L
Sbjct: 484 SCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLVLSLSSNFL 526

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 58/169 (34%), Positives = 84/169 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L+ L ++ N   G +P D L  ++ L  L LS N+ SG +P    +L A 
Sbjct: 434 IPTTLGQLQKLQRLYIAGNRIQGSIPND-LFHLKNLGYLHLSSNKLSGSIPSCFGDLPA- 491

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L SN  +  I  +        L  L L +N  TG +PP + N   + +L LS N 
Sbjct: 492 LRELSLDSNVLAFNIPMSFWS--LRDLLVLSLSSNFLTGNLPPEVGNMKSITTLDLSKNL 549

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +SG IP  +G L  L +L L  N L+G IP E   + +LE++ L  N+L
Sbjct: 550 ISGYIPRRMGELQNLVNLCLSQNKLQGSIPVEFGDLLSLESMDLSQNNL 598

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 61/174 (35%), Positives = 91/174 (52%), Gaps = 6/174 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+   L+SL+L +N+ +GE+P  +L  +  L+ L+L  N   GE+  S  +    
Sbjct: 162 IPSGIGNLVELQSLSLQNNSLTGEIPQ-SLFNIYSLRFLNLEINNLEGEI--SSFSHCRE 218

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS N F+G I   L     + L+ELYL  N  TG IP  +   S L  LHL+ N 
Sbjct: 219 LRVLKLSINQFTGGIPKAL--GSLSDLEELYLGYNKLTGGIPREIGILSNLNILHLATNS 276

Query: 389 LSGTIPSSLGSLSKLRDLKLW-----LNMLEGEIPQEL-MYVKTLETLILDFND 532
           L G+IP+S G+L  L+ L+L       N L G +P  +  ++  LE L +  N+
Sbjct: 277 LIGSIPTSFGNLKALKFLQLGPLALAQNHLSGGLPSSISTWLPDLEGLFIGGNE 330

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 56/159 (35%), Positives = 83/159 (52%), Gaps = 6/159 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   GS S LE L L  N  +G +P +  + +  L +L L+ N   G +P S  NL A 
Sbjct: 233 IPKALGSLSDLEELYLGYNKLTGGIPREIGI-LSNLNILHLATNSLIGSIPTSFGNLKAL 291

Query: 206 ---SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
               L  L L+ N+ SG  LP+        L+ L++  N F+G IP ++SN S+L+ LH+
Sbjct: 292 KFLQLGPLALAQNHLSGG-LPSSISTWLPDLEGLFIGGNEFSGTIPVSISNMSKLIRLHI 350

Query: 377 SFNYLSGTIP--SSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           S NY  G +   +SL +   LR L +  N L+G +P  L
Sbjct: 351 SDNYFIGNVGFLTSLTNCKFLRTLWIDYNPLKGTLPNSL 389

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 30/90 (33%), Positives = 44/90 (48%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
           C  P+  +  +   N G  G I P + N S LVSL LS NY  G++P  +G +     L 
Sbjct: 20  CNAPQQRVSAINSSNMGLEGTIAPQVGNLSFLVSLDLSNNYFHGSLPKDIGKILINFILS 79

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             +N L G IP  +  + +L  + L +N L
Sbjct: 80  FPMNNLTGSIPTTIFNMSSLLNISLSYNSL 109

[98][TOP]
>UniRef100_A2Z558 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2Z558_ORYSI
          Length = 1155

 Score =  110 bits (275), Expect = 6e-23
 Identities = 72/180 (40%), Positives = 105/180 (58%), Gaps = 3/180 (1%)
 Frame = +2

Query: 5   LFLS---LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE 175
           LFLS   L   +P FF S   L+ L L  N+F+GELP  ++ ++  L+ L ++ N F+G 
Sbjct: 268 LFLSYNNLTGEVPDFFASMPNLQKLYLDDNHFAGELPA-SIGELVSLEKLVVTANRFTGT 326

Query: 176 LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS 355
           +PE++ N    L+ L L+SNNF+G I P    N  + L+   +  NG TG IPP +  C 
Sbjct: 327 IPETIGNCRC-LIMLYLNSNNFTGSI-PAFIGN-LSRLEMFSMAENGITGSIPPEIGKCR 383

Query: 356 ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +LV L L  N L+GTIP  +G LS+L+ L L+ N+L G +PQ L  +  +  L L+ N L
Sbjct: 384 QLVDLQLHKNSLTGTIPPEIGELSRLQKLYLYNNLLHGPVPQALWRLVDMVELFLNDNRL 443

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 64/171 (37%), Positives = 93/171 (54%), Gaps = 1/171 (0%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+P   G+ S+L++L +SSN  +G +P + L   + L  LDL  N  +G +P  +T LS 
Sbjct: 592  PIPHELGALSILDTLLMSSNRLTGAIPHE-LGNCKRLAHLDLGNNLLNGSIPAEITTLSG 650

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS-LHLSF 382
             L  L L  N  +GPI  +       +L EL L +N   G IP ++ N   +   L++S 
Sbjct: 651  -LQNLLLGGNKLAGPIPDSFTAT--QSLLELQLGSNNLEGGIPQSVGNLQYISQGLNISN 707

Query: 383  NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            N LSG IP SLG+L KL  L L  N L G IP +L  + +L  + + FN+L
Sbjct: 708  NRLSGPIPHSLGNLQKLEVLDLSNNSLSGPIPSQLSNMISLSVVNISFNEL 758

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 63/162 (38%), Positives = 85/162 (52%)
 Frame = +2

Query: 50   CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
            C  L  + L++N  SG LP D L   RG+  LD+S N     +P +L  L  +L  LD+S
Sbjct: 528  CESLYRVNLNNNKLSGSLPAD-LSTNRGVTHLDISGNLLKRRIPGAL-GLWHNLTRLDVS 585

Query: 230  SNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 409
             N FSGPI   L     + L  L + +N  TG IP  L NC  L  L L  N L+G+IP+
Sbjct: 586  GNKFSGPIPHEL--GALSILDTLLMSSNRLTGAIPHELGNCKRLAHLDLGNNLLNGSIPA 643

Query: 410  SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             + +LS L++L L  N L G IP      ++L  L L  N+L
Sbjct: 644  EITTLSGLQNLLLGGNKLAGPIPDSFTATQSLLELQLGSNNL 685

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/150 (37%), Positives = 81/150 (54%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+C  L  L L +N  +G +P + +  + GL+ L L  N+ +G +P+S T  + S
Sbjct: 617  IPHELGNCKRLAHLDLGNNLLNGSIPAE-ITTLSGLQNLLLGGNKLAGPIPDSFT-ATQS 674

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            LL L L SNN  G I P    N +   Q L + NN  +G IP +L N  +L  L LS N 
Sbjct: 675  LLELQLGSNNLEGGI-PQSVGNLQYISQGLNISNNRLSGPIPHSLGNLQKLEVLDLSNNS 733

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LSG IPS L ++  L  + +  N L G++P
Sbjct: 734  LSGPIPSQLSNMISLSVVNISFNELSGQLP 763

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 54/166 (32%), Positives = 87/166 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+C  L  L L+SNNF+G +P   +  +  L++  ++ N  +G +P  +      
Sbjct: 327 IPETIGNCRCLIMLYLNSNNFTGSIPA-FIGNLSRLEMFSMAENGITGSIPPEIGKCR-Q 384

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L L  N+ +G I P + +  +  LQ+LYL NN   G +P  L    ++V L L+ N 
Sbjct: 385 LVDLQLHKNSLTGTIPPEIGELSR--LQKLYLYNNLLHGPVPQALWRLVDMVELFLNDNR 442

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDF 526
           LSG +   +  +S LR++ L+ N   GE+PQ L    T   L +DF
Sbjct: 443 LSGEVHEDITQMSNLREITLYNNNFTGELPQALGMNTTSGLLRVDF 488

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 59/188 (31%), Positives = 88/188 (46%), Gaps = 21/188 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    +C+ + +L L  NN SG +P + LL  R L  +DL+ N  +GE+P    +    
Sbjct: 136 VPAALAACAGVATLLLGGNNLSGGVPPE-LLSSRQLVEVDLNGNALTGEIPAPAGS-PVV 193

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNT---------------------LQELYLQNNGFTG 325
           L  LDLS N+ SG + P L   P                        L+ L L  N   G
Sbjct: 194 LEYLDLSGNSLSGAVPPELAALPDLRYLDLSINRLTGPMPEFPVHCRLKFLGLYRNQIAG 253

Query: 326 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
           ++P +L NC  L  L LS+N L+G +P    S+  L+ L L  N   GE+P  +  + +L
Sbjct: 254 ELPKSLGNCGNLTVLFLSYNNLTGEVPDFFASMPNLQKLYLDDNHFAGELPASIGELVSL 313

Query: 506 ETLILDFN 529
           E L++  N
Sbjct: 314 EKLVVTAN 321

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 64/195 (32%), Positives = 94/195 (48%), Gaps = 25/195 (12%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-TNLS 202
           P+P        +  L L+ N  SGE+  D + +M  L+ + L  N F+GELP++L  N +
Sbjct: 422 PVPQALWRLVDMVELFLNDNRLSGEVHED-ITQMSNLREITLYNNNFTGELPQALGMNTT 480

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           + LL +D + N F G I P LC   +  L  L L NN F G     ++ C  L  ++L+ 
Sbjct: 481 SGLLRVDFTRNRFRGAIPPGLCT--RGQLAVLDLGNNQFDGGFSSGIAKCESLYRVNLNN 538

Query: 383 NYLSGTIPSSL------------GSLSKLR---DLKLWLNM---------LEGEIPQELM 490
           N LSG++P+ L            G+L K R    L LW N+           G IP EL 
Sbjct: 539 NKLSGSLPADLSTNRGVTHLDISGNLLKRRIPGALGLWHNLTRLDVSGNKFSGPIPHELG 598

Query: 491 YVKTLETLILDFNDL 535
            +  L+TL++  N L
Sbjct: 599 ALSILDTLLMSSNRL 613

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 60/174 (34%), Positives = 89/174 (51%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           L+ E+P P   GS  +LE L LS N+ SG +P + L  +  L+ LDLS N  +G +PE  
Sbjct: 180 LTGEIPAPA--GSPVVLEYLDLSGNSLSGAVPPE-LAALPDLRYLDLSINRLTGPMPEFP 236

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            +    L  L L  N  +G  LP    N  N L  L+L  N  TG++P   ++   L  L
Sbjct: 237 VH--CRLKFLGLYRNQIAGE-LPKSLGNCGN-LTVLFLSYNNLTGEVPDFFASMPNLQKL 292

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           +L  N+ +G +P+S+G L  L  L +  N   G IP+ +   + L  L L+ N+
Sbjct: 293 YLDDNHFAGELPASIGELVSLEKLVVTANRFTGTIPETIGNCRCLIMLYLNSNN 346

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 51/130 (39%), Positives = 65/130 (50%)
 Frame = +2

Query: 92  SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ 271
           S   P    L    L VLDLS N F+G +P +L    A + TL L  NN SG + P L  
Sbjct: 108 SASAPRLCALPASALPVLDLSGNGFTGAVPAALA-ACAGVATLLLGGNNLSGGVPPELLS 166

Query: 272 NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLW 451
           +    L E+ L  N  TG+IP    +   L  L LS N LSG +P  L +L  LR L L 
Sbjct: 167 S--RQLVEVDLNGNALTGEIPAPAGSPVVLEYLDLSGNSLSGAVPPELAALPDLRYLDLS 224

Query: 452 LNMLEGEIPQ 481
           +N L G +P+
Sbjct: 225 INRLTGPMPE 234

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 51/158 (32%), Positives = 74/158 (46%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP  G  S L+ L L +N   G +P   L ++  +  L L+ N  SGE+ E +T
Sbjct: 394 SLTGTIPPEIGELSRLQKLYLYNNLLHGPVPQ-ALWRLVDMVELFLNDNRLSGEVHEDIT 452

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            +S +L  + L +NNF+G +   L  N  + L  +    N F G IPP L    +L  L 
Sbjct: 453 QMS-NLREITLYNNNFTGELPQALGMNTTSGLLRVDFTRNRFRGAIPPGLCTRGQLAVLD 511

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           L  N   G   S +     L  + L  N L G +P +L
Sbjct: 512 LGNNQFDGGFSSGIAKCESLYRVNLNNNKLSGSLPADL 549

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 42/115 (36%), Positives = 58/115 (50%), Gaps = 3/115 (2%)
 Frame = +2

Query: 200 SASLLTLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           + ++  L+LS    +G +    P LC  P + L  L L  NGFTG +P  L+ C+ + +L
Sbjct: 90  TGAVAALNLSGVGLTGALSASAPRLCALPASALPVLDLSGNGFTGAVPAALAACAGVATL 149

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N LSG +P  L S  +L ++ L  N L GEIP        LE L L  N L
Sbjct: 150 LLGGNNLSGGVPPELLSSRQLVEVDLNGNALTGEIPAPAGSPVVLEYLDLSGNSL 204

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 48/135 (35%), Positives = 64/135 (47%), Gaps = 4/135 (2%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSA----SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN 310
           L+LS    +G L  S   L A    +L  LDLS N F+G +   L       +  L L  
Sbjct: 96  LNLSGVGLTGALSASAPRLCALPASALPVLDLSGNGFTGAVPAALAACAG--VATLLLGG 153

Query: 311 NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM 490
           N  +G +PP L +  +LV + L+ N L+G IP+  GS   L  L L  N L G +P EL 
Sbjct: 154 NNLSGGVPPELLSSRQLVEVDLNGNALTGEIPAPAGSPVVLEYLDLSGNSLSGAVPPELA 213

Query: 491 YVKTLETLILDFNDL 535
            +  L  L L  N L
Sbjct: 214 ALPDLRYLDLSINRL 228

[99][TOP]
>UniRef100_Q9ZWC8 Serine/threonine-protein kinase BRI1-like 1 n=2 Tax=Arabidopsis
           thaliana RepID=BRL1_ARATH
          Length = 1166

 Score =  110 bits (275), Expect = 6e-23
 Identities = 69/169 (40%), Positives = 103/169 (60%), Gaps = 5/169 (2%)
 Frame = +2

Query: 44  GSCSL-----LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           G CSL     LE + +++N  SG +PM+ L K + LK +DLSFNE +G +P+ +  L  +
Sbjct: 394 GFCSLQSSPVLEKILIANNYLSGTVPME-LGKCKSLKTIDLSFNELTGPIPKEIWMLP-N 451

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L + +NN +G I   +C    N L+ L L NN  TG IP ++S C+ ++ + LS N 
Sbjct: 452 LSDLVMWANNLTGTIPEGVCVKGGN-LETLILNNNLLTGSIPESISRCTNMIWISLSSNR 510

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G IPS +G+LSKL  L+L  N L G +P++L   K+L  L L+ N+L
Sbjct: 511 LTGKIPSGIGNLSKLAILQLGNNSLSGNVPRQLGNCKSLIWLDLNSNNL 559

 Score =  102 bits (254), Expect = 2e-20
 Identities = 68/178 (38%), Positives = 98/178 (55%), Gaps = 3/178 (1%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           L+ ++P   ++GS   L+ L+L+ N  SGE+P +  L  + L +LDLS N FSGELP   
Sbjct: 263 LAGKIPNGEYWGSFQNLKQLSLAHNRLSGEIPPELSLLCKTLVILDLSGNTFSGELPSQF 322

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           T     L  L+L +N  SG  L N   +    +  LY+  N  +G +P +L+NCS L  L
Sbjct: 323 T-ACVWLQNLNLGNNYLSGDFL-NTVVSKITGITYLYVAYNNISGSVPISLTNCSNLRVL 380

Query: 371 HLSFNYLSGTIPS---SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LS N  +G +PS   SL S   L  + +  N L G +P EL   K+L+T+ L FN+L
Sbjct: 381 DLSSNGFTGNVPSGFCSLQSSPVLEKILIANNYLSGTVPMELGKCKSLKTIDLSFNEL 438

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 67/171 (39%), Positives = 90/171 (52%), Gaps = 8/171 (4%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES-LTNLSASLLT 217
           F  CS L S+ +S+N   G+L       ++ L  +DLS+N  S ++PES +++  ASL  
Sbjct: 147 FSKCSNLVSVNISNNKLVGKLGFAPS-SLQSLTTVDLSYNILSDKIPESFISDFPASLKY 205

Query: 218 LDLSSNNFSGPILP---NLCQNPKNTLQELYLQNNGFTG-KIPPTLSNCSELVSLHLSFN 385
           LDL+ NN SG        +C N    L    L  N  +G K P TL NC  L +L++S N
Sbjct: 206 LDLTHNNLSGDFSDLSFGICGN----LTFFSLSQNNLSGDKFPITLPNCKFLETLNISRN 261

Query: 386 YLSGTIPSS--LGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFN 529
            L+G IP+    GS   L+ L L  N L GEIP EL +  KTL  L L  N
Sbjct: 262 NLAGKIPNGEYWGSFQNLKQLSLAHNRLSGEIPPELSLLCKTLVILDLSGN 312

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 46/142 (32%), Positives = 72/142 (50%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F  L  P+P        L  L + +NN +G +P    +K   L+ L L+ N  +G +PES
Sbjct: 435 FNELTGPIPKEIWMLPNLSDLVMWANNLTGTIPEGVCVKGGNLETLILNNNLLTGSIPES 494

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           ++  + +++ + LSSN  +G I   +    K  L  L L NN  +G +P  L NC  L+ 
Sbjct: 495 ISRCT-NMIWISLSSNRLTGKIPSGIGNLSK--LAILQLGNNSLSGNVPRQLGNCKSLIW 551

Query: 368 LHLSFNYLSGTIPSSLGSLSKL 433
           L L+ N L+G +P  L S + L
Sbjct: 552 LDLNSNNLTGDLPGELASQAGL 573

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 63/199 (31%), Positives = 80/199 (40%), Gaps = 44/199 (22%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN----------- 160
            SL   +P   G+C  L  L L+SNN +G+LP + L    GL V+  S +           
Sbjct: 534  SLSGNVPRQLGNCKSLIWLDLNSNNLTGDLPGE-LASQAGL-VMPGSVSGKQFAFVRNEG 591

Query: 161  -----------EFSGELPESLTNL----------------------SASLLTLDLSSNNF 241
                       EF G   E L  L                      + S++  D+S N  
Sbjct: 592  GTDCRGAGGLVEFEGIRAERLERLPMVHSCPATRIYSGMTMYTFSANGSMIYFDISYNAV 651

Query: 242  SGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
            SG I P         LQ L L +N  TG IP +      +  L LS N L G +P SLGS
Sbjct: 652  SGFIPPGY--GNMGYLQVLNLGHNRITGTIPDSFGGLKAIGVLDLSHNNLQGYLPGSLGS 709

Query: 422  LSKLRDLKLWLNMLEGEIP 478
            LS L DL +  N L G IP
Sbjct: 710  LSFLSDLDVSNNNLTGPIP 728

[100][TOP]
>UniRef100_B8ADC3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ADC3_ORYSI
          Length = 987

 Score =  110 bits (274), Expect = 8e-23
 Identities = 70/167 (41%), Positives = 96/167 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LPP  G+ + L  L LSSN   GE+P  +L +++ L++LDL  N FSG  P++L++   S
Sbjct: 76  LPPAIGNLTFLRWLNLSSNGLHGEIP-PSLGRLQHLRILDLGSNSFSGAFPDNLSSC-IS 133

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L L  N  SG I P    N    LQ+L+L NN FTG IP +L+N S L  L L FN+
Sbjct: 134 LINLTLGYNQLSGHI-PVKLGNTLTWLQKLHLGNNSFTGPIPASLANLSSLEFLKLDFNH 192

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           L G IPSSLG++  L+       +  G IP  L  + +L  + LD N
Sbjct: 193 LKGLIPSSLGNIPNLQ------KIFSGVIPSSLFNLSSLTDVYLDGN 233

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/192 (32%), Positives = 93/192 (48%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + L  LA    +  G +P  TL K++ L  LDLS N  +G +P+ +  L + 
Sbjct: 366 IPSVIGNLTNLNILAAYDAHLEGPIPA-TLGKLKKLFALDLSINHLNGSVPKEIFELPSL 424

Query: 209 LLTLDLSSNNFSGPI-----------------------LPNLCQNPKNTLQELYLQNNGF 319
              L LS N  SGPI                       +P+   N +  L+ L L +N F
Sbjct: 425 SWFLILSDNTLSGPIPSEVGTLVNLNSIELSGNQLSDQIPDSIGNCE-VLEYLLLDSNSF 483

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
            G IP +L+    L  L+L+ N  SG+IP+++GS+  L+ L L  N L G IP+ L  + 
Sbjct: 484 EGGIPQSLTKLKGLAILNLTMNKFSGSIPNAIGSMGNLQQLCLAHNNLSGSIPETLQNLT 543

Query: 500 TLETLILDFNDL 535
            L  L + FN+L
Sbjct: 544 QLWHLDVSFNNL 555

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 56/164 (34%), Positives = 85/164 (51%), Gaps = 1/164 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +CS L+ L ++ N+F G+LP+  +     L+   L  N  SG +P  + NL   L TLDL
Sbjct: 275 NCSQLQQLDIAENSFIGQLPISIVNLSTTLQKFFLRGNSVSGSIPTDIGNL-IGLDTLDL 333

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            S + SG I  ++ +     +  LY  +   +G IP  + N + L  L     +L G IP
Sbjct: 334 GSTSLSGVIPESIGKLADLAIITLY--STRLSGLIPSVIGNLTNLNILAAYDAHLEGPIP 391

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE-TLILDFNDL 535
           ++LG L KL  L L +N L G +P+E+  + +L   LIL  N L
Sbjct: 392 ATLGKLKKLFALDLSINHLNGSVPKEIFELPSLSWFLILSDNTL 435

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 60/174 (34%), Positives = 85/174 (48%), Gaps = 5/174 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSN-----NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +PP  G    L  L+LSSN     N  G   + +L     L+ LD++ N F G+LP S+ 
Sbjct: 239 VPPTVGRLKSLVRLSLSSNRLEANNMKGWEFITSLANCSQLQQLDIAENSFIGQLPISIV 298

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NLS +L    L  N+ SG I  ++       L  L L +   +G IP ++   ++L  + 
Sbjct: 299 NLSTTLQKFFLRGNSVSGSIPTDI--GNLIGLDTLDLGSTSLSGVIPESIGKLADLAIIT 356

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L    LSG IPS +G+L+ L  L  +   LEG IP  L  +K L  L L  N L
Sbjct: 357 LYSTRLSGLIPSVIGNLTNLNILAAYDAHLEGPIPATLGKLKKLFALDLSINHL 410

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 57/168 (33%), Positives = 80/168 (47%), Gaps = 6/168 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG------ELPESL 190
           +P    + S L  + L  N FSG +P  T+ +++ L  L LS N          E   SL
Sbjct: 215 IPSSLFNLSSLTDVYLDGNKFSGFVP-PTVGRLKSLVRLSLSSNRLEANNMKGWEFITSL 273

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            N S  L  LD++ N+F G  LP    N   TLQ+ +L+ N  +G IP  + N   L +L
Sbjct: 274 ANCS-QLQQLDIAENSFIGQ-LPISIVNLSTTLQKFFLRGNSVSGSIPTDIGNLIGLDTL 331

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETL 514
            L    LSG IP S+G L+ L  + L+   L G IP  +  +  L  L
Sbjct: 332 DLGSTSLSGVIPESIGKLADLAIITLYSTRLSGLIPSVIGNLTNLNIL 379

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 52/144 (36%), Positives = 79/144 (54%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           SL   L LS N  SG +P + +  +  L  ++LS N+ S ++P+S+ N    L  L L S
Sbjct: 423 SLSWFLILSDNTLSGPIPSE-VGTLVNLNSIELSGNQLSDQIPDSIGNCEV-LEYLLLDS 480

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           N+F G I  +L +     L  L L  N F+G IP  + +   L  L L+ N LSG+IP +
Sbjct: 481 NSFEGGIPQSLTK--LKGLAILNLTMNKFSGSIPNAIGSMGNLQQLCLAHNNLSGSIPET 538

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQE 484
           L +L++L  L +  N L+G++P E
Sbjct: 539 LQNLTQLWHLDVSFNNLQGKVPDE 562

[101][TOP]
>UniRef100_A9TT41 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
            RepID=A9TT41_PHYPA
          Length = 1095

 Score =  110 bits (274), Expect = 8e-23
 Identities = 72/168 (42%), Positives = 98/168 (58%), Gaps = 2/168 (1%)
 Frame = +2

Query: 38   FFGSCSLLESLA--LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
            FF  C   +  A  LSSN   GELP++ + +   L  LD++ N+ +G +P S   L+ +L
Sbjct: 511  FFSLCKGFQEFAVNLSSNQLLGELPLE-VGECETLWYLDVAGNQLTGSIPVSTGTLT-NL 568

Query: 212  LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
            + L+LS N   G I   L + P   L+ L+L NN   G IPP+L N S LV L LSFN+L
Sbjct: 569  VILNLSHNQLRGEIPWQLGELPN--LEVLFLDNNRILGSIPPSLGNLSRLVMLDLSFNHL 626

Query: 392  SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +G IP  L +LS+L+ L L  N L G IP+EL  +  LE L L FN+L
Sbjct: 627  NGNIPKGLANLSQLKSLLLNHNSLSGSIPKELSSLTALEQLNLSFNNL 674

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 71/189 (37%), Positives = 97/189 (51%), Gaps = 25/189 (13%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+   LE+L L +N+FSG +P + + ++  L+VL+L+ N   G +P  L+  S S
Sbjct: 103 VPREVGNLKHLETLDLEANSFSGIIPTE-IGQLSELRVLNLANNLLQGSIPAELSG-STS 160

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQ-------------------------ELYLQNN 313
           L  L L+ N   G I P++     NTLQ                          L L NN
Sbjct: 161 LCFLSLAGNTLRGRIPPSV--GTLNTLQWLSLSSNLLDGEIPPQLGGGCDCLVHLDLANN 218

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            FTG IP  L+NC +L SL L+ N L G+IP  LG LSKL++L L LN L G +P  L  
Sbjct: 219 YFTGPIPSELANCKQLQSLLLNANSLVGSIPPDLGRLSKLQNLHLALNKLSGVLPPALGN 278

Query: 494 VKTLETLIL 520
              L TL+L
Sbjct: 279 CNELSTLVL 287

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 62/147 (42%), Positives = 83/147 (56%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +CS  ES  + + NFSG           GL +L L +N FSGE+P  + NL   L TLDL
Sbjct: 72  TCS--ESRRVLALNFSG----------LGLVILSLPYNGFSGEVPREVGNLK-HLETLDL 118

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            +N+FSG I   + Q   + L+ L L NN   G IP  LS  + L  L L+ N L G IP
Sbjct: 119 EANSFSGIIPTEIGQ--LSELRVLNLANNLLQGSIPAELSGSTSLCFLSLAGNTLRGRIP 176

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            S+G+L+ L+ L L  N+L+GEIP +L
Sbjct: 177 PSVGTLNTLQWLSLSSNLLDGEIPPQL 203

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 54/129 (41%), Positives = 71/129 (55%), Gaps = 3/129 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + L  L LS N   GE+P   L ++  L+VL L  N   G +P SL NLS  
Sbjct: 558 IPVSTGTLTNLVILNLSHNQLRGEIPWQ-LGELPNLEVLFLDNNRILGSIPPSLGNLSR- 615

Query: 209 LLTLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L+ LDLS N+ +G I   L NL Q     L+ L L +N  +G IP  LS+ + L  L+LS
Sbjct: 616 LVMLDLSFNHLNGNIPKGLANLSQ-----LKSLLLNHNSLSGSIPKELSSLTALEQLNLS 670

Query: 380 FNYLSGTIP 406
           FN LSG  P
Sbjct: 671 FNNLSGQFP 679

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 66/217 (30%), Positives = 91/217 (41%), Gaps = 48/217 (22%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ + L+ L+LSSN   GE+P         L  LDL+ N F+G +P  L N    
Sbjct: 175 IPPSVGTLNTLQWLSLSSNLLDGEIPPQLGGGCDCLVHLDLANNYFTGPIPSELANCK-Q 233

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L +L L++N+  G I P+L +  K  LQ L+L  N  +G +PP L NC+EL +L L+ + 
Sbjct: 234 LQSLLLNANSLVGSIPPDLGRLSK--LQNLHLALNKLSGVLPPALGNCNELSTLVLTASQ 291

Query: 389 ------------------------------------------------LSGTIPSSLGSL 424
                                                           LSG +P+  G  
Sbjct: 292 GCSYGLNSSGMPHFVDTHRRERNLFSGSFPSQFALLPRIQVIWGPGCGLSGVLPADWGLC 351

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  L L  N L G IP  L   K+L  L L  N L
Sbjct: 352 CALEILNLAKNSLTGPIPVGLGNCKSLVVLDLSSNQL 388

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/80 (43%), Positives = 46/80 (57%)
 Frame = +2

Query: 296 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 475
           L L  NGF+G++P  + N   L +L L  N  SG IP+ +G LS+LR L L  N+L+G I
Sbjct: 92  LSLPYNGFSGEVPREVGNLKHLETLDLEANSFSGIIPTEIGQLSELRVLNLANNLLQGSI 151

Query: 476 PQELMYVKTLETLILDFNDL 535
           P EL    +L  L L  N L
Sbjct: 152 PAELSGSTSLCFLSLAGNTL 171

[102][TOP]
>UniRef100_A2YEG3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2YEG3_ORYSI
          Length = 877

 Score =  110 bits (274), Expect = 8e-23
 Identities = 71/169 (42%), Positives = 97/169 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG    LE + L++N  +G++P  +L     L  ++L  N  +G +PES+ N S+S
Sbjct: 188 IPSGFGELPRLEVIVLTTNRLTGDIPA-SLGSSLSLTYVNLESNALTGIIPESIGN-SSS 245

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L+SNN +G I   L  +  ++L  +YL  N F G IPP  +    L  L+L  N 
Sbjct: 246 LEVLVLTSNNLTGEIPKPLFNS--SSLTAIYLDENSFVGYIPPVTATSPPLQYLYLGGNM 303

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSGTIPSSLG+LS L DL L  N L G IP  L ++ TL  L LD N+L
Sbjct: 304 LSGTIPSSLGNLSSLLDLSLTENNLIGSIPDSLGHIPTLRLLSLDTNNL 352

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 71/171 (41%), Positives = 90/171 (52%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGE--LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           L PFFGS   +E L LS N    +    M +L     L  L +  N   G+LP S+ NLS
Sbjct: 428 LIPFFGSLPNMEKLMLSYNKLEADDWSFMSSLSNCSKLTKLLIDGNNLKGKLPHSIGNLS 487

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           +SL  L +  NN SG I P +  N K  L+ LY+  N  TG IP  + N + LV L ++ 
Sbjct: 488 SSLKWLWIRDNNISGHIPPEI-GNLKG-LEMLYMDYNILTGNIPSEIGNLNNLVVLAMAQ 545

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N LSG IP ++G+L KL DLKL  N   G IP  L +   LE L L  N L
Sbjct: 546 NNLSGQIPDTIGNLVKLTDLKLDRNNFSGGIPTTLEHCTQLEILNLAHNSL 596

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 63/169 (37%), Positives = 92/169 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS   L  + L SN  +G +P +++     L+VL L+ N  +GE+P+ L N S+S
Sbjct: 212 IPASLGSSLSLTYVNLESNALTGIIP-ESIGNSSSLEVLVLTSNNLTGEIPKPLFN-SSS 269

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + L  N+F G I P    +P   LQ LYL  N  +G IP +L N S L+ L L+ N 
Sbjct: 270 LTAIYLDENSFVGYIPPVTATSPP--LQYLYLGGNMLSGTIPSSLGNLSSLLDLSLTENN 327

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G+IP SLG +  LR L L  N L G +P  +  + +L+ + +  N L
Sbjct: 328 LIGSIPDSLGHIPTLRLLSLDTNNLTGHVPSSIFNLSSLKIISMVNNSL 376

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 64/172 (37%), Positives = 91/172 (52%), Gaps = 3/172 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L  L+L+ NN  G +P D+L  +  L++L L  N  +G +P S+ NLS S
Sbjct: 308 IPSSLGNLSSLLDLSLTENNLIGSIP-DSLGHIPTLRLLSLDTNNLTGHVPSSIFNLS-S 365

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + + +N+ +G  LP+        ++ L L NN F G IPPTL N S L SL+L  N 
Sbjct: 366 LKIISMVNNSLTGE-LPSYLGYTLPNIEALALSNNRFKGSIPPTLLNASHLSSLYLRNNS 424

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGE---IPQELMYVKTLETLILDFNDL 535
           L+G IP   GSL  +  L L  N LE +       L     L  L++D N+L
Sbjct: 425 LTGLIP-FFGSLPNMEKLMLSYNKLEADDWSFMSSLSNCSKLTKLLIDGNNL 475

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 60/168 (35%), Positives = 86/168 (51%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+   L  L L  NNFSG +P  TL     L++L+L+ N   G+LP  +  L+  
Sbjct: 552  IPDTIGNLVKLTDLKLDRNNFSGGIPT-TLEHCTQLEILNLAHNSLDGKLPNQIFKLATL 610

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               LDLS N   G I P    N  N L++L + NN  +G IP T+  C  L SL +  N 
Sbjct: 611  SQELDLSHNYLFGGI-PEEVGNLIN-LKKLSISNNRMSGNIPSTMGQCVVLESLEMQCNL 668

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             +G+IP S  +L+ ++ + +  N L G+IP  L     L  L L FN+
Sbjct: 669  FTGSIPKSFVNLAGIQKMDISRNNLSGKIPDFLANFSLLYDLNLSFNN 716

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 65/200 (32%), Positives = 97/200 (48%), Gaps = 27/200 (13%)
 Frame = +2

Query: 14  SLELPLPPFFG-SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP--- 181
           SL   LP + G +   +E+LALS+N F G +P  TLL    L  L L  N  +G +P   
Sbjct: 375 SLTGELPSYLGYTLPNIEALALSNNRFKGSIP-PTLLNASHLSSLYLRNNSLTGLIPFFG 433

Query: 182 -----------------------ESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ 292
                                   SL+N S  L  L +  NN  G  LP+   N  ++L+
Sbjct: 434 SLPNMEKLMLSYNKLEADDWSFMSSLSNCS-KLTKLLIDGNNLKGK-LPHSIGNLSSSLK 491

Query: 293 ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 472
            L++++N  +G IPP + N   L  L++ +N L+G IPS +G+L+ L  L +  N L G+
Sbjct: 492 WLWIRDNNISGHIPPEIGNLKGLEMLYMDYNILTGNIPSEIGNLNNLVVLAMAQNNLSGQ 551

Query: 473 IPQELMYVKTLETLILDFND 532
           IP  +  +  L  L LD N+
Sbjct: 552 IPDTIGNLVKLTDLKLDRNN 571

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 56/169 (33%), Positives = 89/169 (52%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ + L  LA++ NN SG++P DT+  +  L  L L  N FSG +P +L + +  
Sbjct: 528  IPSEIGNLNNLVVLAMAQNNLSGQIP-DTIGNLVKLTDLKLDRNNFSGGIPTTLEHCT-Q 585

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L+L+ N+  G  LPN         QEL L +N   G IP  + N   L  L +S N 
Sbjct: 586  LEILNLAHNSLDGK-LPNQIFKLATLSQELDLSHNYLFGGIPEEVGNLINLKKLSISNNR 644

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +SG IPS++G    L  L++  N+  G IP+  + +  ++ + +  N+L
Sbjct: 645  MSGNIPSTMGQCVVLESLEMQCNLFTGSIPKSFVNLAGIQKMDISRNNL 693

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 58/151 (38%), Positives = 82/151 (54%), Gaps = 1/151 (0%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGL-KVLDLSFNEFSGELPESLTNLSA 205
            +P     C+ LE L L+ N+  G+LP + + K+  L + LDLS N   G +PE + NL  
Sbjct: 576  IPTTLEHCTQLEILNLAHNSLDGKLP-NQIFKLATLSQELDLSHNYLFGGIPEEVGNL-I 633

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            +L  L +S+N  SG I   + Q     L+ L +Q N FTG IP +  N + +  + +S N
Sbjct: 634  NLKKLSISNNRMSGNIPSTMGQCV--VLESLEMQCNLFTGSIPKSFVNLAGIQKMDISRN 691

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
             LSG IP  L + S L DL L  N  EGE+P
Sbjct: 692  NLSGKIPDFLANFSLLYDLNLSFNNFEGEVP 722

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 57/169 (33%), Positives = 87/169 (51%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           + P   + + L  L LS N+  G +P + + ++  L  L+LS N   G +P  L++ S  
Sbjct: 92  ISPCIANLTTLTRLQLSDNSLYGSIPSE-IGQLGQLNNLNLSMNSLEGNIPSELSSCS-K 149

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDLS+N+  G I  +L +   N L+ + L  N   G+IP        L  + L+ N 
Sbjct: 150 LEILDLSNNSIQGEIPASLSRC--NHLKYVDLSKNKLHGRIPSGFGELPRLEVIVLTTNR 207

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G IP+SLGS   L  + L  N L G IP+ +    +LE L+L  N+L
Sbjct: 208 LTGDIPASLGSSLSLTYVNLESNALTGIIPESIGNSSSLEVLVLTSNNL 256

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 56/157 (35%), Positives = 77/157 (49%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           ++ L+S  FSG +    +  +  L  L LS N   G +P  +  L   L  L+LS N+  
Sbjct: 80  AIDLASEGFSGSIS-PCIANLTTLTRLQLSDNSLYGSIPSEIGQLG-QLNNLNLSMNSLE 137

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I   L    K  L+ L L NN   G+IP +LS C+ L  + LS N L G IPS  G L
Sbjct: 138 GNIPSELSSCSK--LEILDLSNNSIQGEIPASLSRCNHLKYVDLSKNKLHGRIPSGFGEL 195

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +L  + L  N L G+IP  L    +L  + L+ N L
Sbjct: 196 PRLEVIVLTTNRLTGDIPASLGSSLSLTYVNLESNAL 232

[103][TOP]
>UniRef100_Q7XUH4 OSJNBa0020J04.8 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q7XUH4_ORYSJ
          Length = 1104

 Score =  109 bits (273), Expect = 1e-22
 Identities = 72/169 (42%), Positives = 96/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  F S   L  L LS N+F+G +P  T   +  L+VL  S N   GELP  L N S +
Sbjct: 500 VPEGFSSLWSLRHLNLSVNSFTGSMPA-TYGYLPSLQVLSASHNRICGELPVELANCS-N 557

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDL SN  +GPI  +  +     L+EL L +N  + KIPP +SNCS LV+L L  N+
Sbjct: 558 LTVLDLRSNQLTGPIPGDFAR--LGELEELDLSHNQLSRKIPPEISNCSSLVTLKLDDNH 615

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IP+SL +LSKL+ L L  N L G IP  L  +  + +L +  N+L
Sbjct: 616 LGGEIPASLSNLSKLQTLDLSSNNLTGSIPASLAQIPGMLSLNVSQNEL 664

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 65/168 (38%), Positives = 88/168 (52%), Gaps = 1/168 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C  L+ L L  N FSGE+P   L  +R L+ + L  N FSG++P SL NLS  
Sbjct: 331 VPAEIGRCGALQVLDLEDNRFSGEVPA-ALGGLRRLREVYLGGNSFSGQIPASLGNLSW- 388

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L    N  +G +   L       L  L L +N   G+IPP++ N + L SL+LS N 
Sbjct: 389 LEALSTPGNRLTGDLPSELFV--LGNLTFLDLSDNKLAGEIPPSIGNLAALQSLNLSGNS 446

Query: 389 LSGTIPSSLGSLSKLRDLKL-WLNMLEGEIPQELMYVKTLETLILDFN 529
            SG IPS++G+L  LR L L     L G +P EL  +  L+ + L  N
Sbjct: 447 FSGRIPSNIGNLLNLRVLDLSGQKNLSGNLPAELFGLPQLQYVSLAGN 494

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 62/168 (36%), Positives = 85/168 (50%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P P +      L  L LS N F+GE+P   + ++  L+ L L  N F+G +P  +    A
Sbjct: 282 PFPSWLAGAGGLTVLDLSGNAFTGEVP-PAVGQLTALQELRLGGNAFTGTVPAEIGRCGA 340

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  LDL  N FSG +   L       L+E+YL  N F+G+IP +L N S L +L    N
Sbjct: 341 -LQVLDLEDNRFSGEVPAAL--GGLRRLREVYLGGNSFSGQIPASLGNLSWLEALSTPGN 397

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L+G +PS L  L  L  L L  N L GEIP  +  +  L++L L  N
Sbjct: 398 RLTGDLPSELFVLGNLTFLDLSDNKLAGEIPPSIGNLAALQSLNLSGN 445

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/194 (31%), Positives = 90/194 (46%), Gaps = 25/194 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELP------------------------MDTLLKM-RG 133
           LPP   +   L+ L++S N  +G +P                        +D  + + + 
Sbjct: 209 LPPAVAAIPSLQILSVSRNRLTGAIPAAAFGGVGNSSLRIVQVGGNAFSQVDVPVSLGKD 268

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
           L+V+DL  N+ +G  P  L   +  L  LDLS N F+G + P + Q     LQEL L  N
Sbjct: 269 LQVVDLRANKLAGPFPSWLAG-AGGLTVLDLSGNAFTGEVPPAVGQ--LTALQELRLGGN 325

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            FTG +P  +  C  L  L L  N  SG +P++LG L +LR++ L  N   G+IP  L  
Sbjct: 326 AFTGTVPAEIGRCGALQVLDLEDNRFSGEVPAALGGLRRLREVYLGGNSFSGQIPASLGN 385

Query: 494 VKTLETLILDFNDL 535
           +  LE L    N L
Sbjct: 386 LSWLEALSTPGNRL 399

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ + L +N  +G  P   L    GL VLDLS N F+GE+P ++  L+A L  L L  N 
Sbjct: 269 LQVVDLRANKLAGPFP-SWLAGAGGLTVLDLSGNAFTGEVPPAVGQLTA-LQELRLGGNA 326

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           F+G +   + +     LQ L L++N F+G++P  L     L  ++L  N  SG IP+SLG
Sbjct: 327 FTGTVPAEIGRC--GALQVLDLEDNRFSGEVPAALGGLRRLREVYLGGNSFSGQIPASLG 384

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +LS L  L    N L G++P EL  +  L  L L  N L
Sbjct: 385 NLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKL 423

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/131 (41%), Positives = 76/131 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    +CS L  L L SN  +G +P D   ++  L+ LDLS N+ S ++P  ++N S S
Sbjct: 548 LPVELANCSNLTVLDLRSNQLTGPIPGD-FARLGELEELDLSHNQLSRKIPPEISNCS-S 605

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+TL L  N+  G I  +L    K  LQ L L +N  TG IP +L+    ++SL++S N 
Sbjct: 606 LVTLKLDDNHLGGEIPASLSNLSK--LQTLDLSSNNLTGSIPASLAQIPGMLSLNVSQNE 663

Query: 389 LSGTIPSSLGS 421
           LSG IP+ LGS
Sbjct: 664 LSGEIPAMLGS 674

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 56/162 (34%), Positives = 84/162 (51%), Gaps = 8/162 (4%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLA-----LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP 181
           +EL LP    S ++  +L+     +S N  SG +P+        LK L+LS N FSG +P
Sbjct: 81  VELALPKLRLSGAISPALSSLTFDVSGNLLSGPVPVSF---PPSLKYLELSSNAFSGTIP 137

Query: 182 ESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY---LQNNGFTGKIPPTLSNC 352
            +++  + SL  L+L+ N   G +  +L      TLQ+L+   L  N   G IP  LSNC
Sbjct: 138 ANVSASATSLQFLNLAVNRLRGTVPASL-----GTLQDLHYLWLDGNLLEGTIPSALSNC 192

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           S L+ L L  N L G +P ++ ++  L+ L +  N L G IP
Sbjct: 193 SALLHLSLQGNALRGILPPAVAAIPSLQILSVSRNRLTGAIP 234

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 50/130 (38%), Positives = 67/130 (51%)
 Frame = +2

Query: 146 DLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 325
           D+S N  SG +P S      SL  L+LSSN FSG I  N+  +   +LQ L L  N   G
Sbjct: 104 DVSGNLLSGPVPVSFP---PSLKYLELSSNAFSGTIPANVSASA-TSLQFLNLAVNRLRG 159

Query: 326 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            +P +L    +L  L L  N L GTIPS+L + S L  L L  N L G +P  +  + +L
Sbjct: 160 TVPASLGTLQDLHYLWLDGNLLEGTIPSALSNCSALLHLSLQGNALRGILPPAVAAIPSL 219

Query: 506 ETLILDFNDL 535
           + L +  N L
Sbjct: 220 QILSVSRNRL 229

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 43/118 (36%), Positives = 59/118 (50%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L LSSN FSG +P +       L+ L+L+ N   G +P SL  L   L  L L  N 
Sbjct: 122 LKYLELSSNAFSGTIPANVSASATSLQFLNLAVNRLRGTVPASLGTLQ-DLHYLWLDGNL 180

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
             G I P+   N  + L  L LQ N   G +PP ++    L  L +S N L+G IP++
Sbjct: 181 LEGTI-PSALSNC-SALLHLSLQGNALRGILPPAVAAIPSLQILSVSRNRLTGAIPAA 236

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 38/113 (33%), Positives = 58/113 (51%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L   +PP   +CS L +L L  N+  GE+P  +L  +  L+ LDLS N  +G +P SL  
Sbjct: 592 LSRKIPPEISNCSSLVTLKLDDNHLGGEIPA-SLSNLSKLQTLDLSSNNLTGSIPASLAQ 650

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS 355
           +   +L+L++S N  SG I P +  +   T   ++  N    G  PP  + CS
Sbjct: 651 I-PGMLSLNVSQNELSGEI-PAMLGSRFGT-PSVFASNPNLCG--PPLENECS 698

[104][TOP]
>UniRef100_Q6YTK4 Os08g0266400 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6YTK4_ORYSJ
          Length = 768

 Score =  109 bits (273), Expect = 1e-22
 Identities = 68/170 (40%), Positives = 102/170 (60%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FGS   + ++ L+SN+FSGE P+ T  ++  L++LDLS N   GE+P  L +L   
Sbjct: 348 IPSDFGSRQFV-TIVLASNSFSGEFPL-TFCQLDSLEILDLSNNHLHGEIPSCLWHLQ-D 404

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ +DLS N+FSG + P +   P ++L+ ++L NN  TG  P  L  C  L+ L L  N+
Sbjct: 405 LVFMDLSYNSFSGEV-PPMSAYPNSSLESVHLANNNLTGGYPMVLKGCKWLIILDLGGNH 463

Query: 389 LSGTIPSSLGSLSK-LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +GTIPS +G+ +  LR L L  N+  G IP+EL  +  L+ L L  N+L
Sbjct: 464 FTGTIPSWIGTCNPLLRFLILRSNVFNGSIPKELSQLSHLQLLDLAMNNL 513

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 57/169 (33%), Positives = 90/169 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   + + L+ L L+ N  +GE+P + + ++  L+ L+L+ N  +G +P S+ NL+  
Sbjct: 228 IPPTICNTTKLKYLRLAKNKLTGEIPAE-IGRLASLQALELADNFLTGPIPNSVGNLT-D 285

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           LL +DL SN F+G I P +       L+ + +  N   G++P ++S+   L  L LS N 
Sbjct: 286 LLVMDLFSNGFTGVIPPEIFN--LTALRTIDVGTNRLEGEVPASISSLRNLYGLDLSNNR 343

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            SGTIPS  GS  +   + L  N   GE P     + +LE L L  N L
Sbjct: 344 FSGTIPSDFGS-RQFVTIVLASNSFSGEFPLTFCQLDSLEILDLSNNHL 391

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 56/171 (32%), Positives = 88/171 (51%)
 Frame = +2

Query: 23  LPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           LPL P   +   L  L LSSN   G + + +L  M  + V D+S N  + ++P  L    
Sbjct: 155 LPLSP--ATLQQLSYLNLSSNGLYGPI-LRSLSAMGKMTVFDVSRNRLNSDIPSELFTNW 211

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
             L    + +N+ +G I P +C   K  L+ L L  N  TG+IP  +   + L +L L+ 
Sbjct: 212 VELTQFRVQNNSITGSIPPTICNTTK--LKYLRLAKNKLTGEIPAEIGRLASLQALELAD 269

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N+L+G IP+S+G+L+ L  + L+ N   G IP E+  +  L T+ +  N L
Sbjct: 270 NFLTGPIPNSVGNLTDLLVMDLFSNGFTGVIPPEIFNLTALRTIDVGTNRL 320

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 52/142 (36%), Positives = 78/142 (54%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L    + +N+ +G +P  T+     LK L L+ N+ +GE+P  +  L ASL  L+L+ N 
Sbjct: 214 LTQFRVQNNSITGSIP-PTICNTTKLKYLRLAKNKLTGEIPAEIGRL-ASLQALELADNF 271

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +GPI PN   N  + L  + L +NGFTG IPP + N + L ++ +  N L G +P+S+ 
Sbjct: 272 LTGPI-PNSVGNLTDLLV-MDLFSNGFTGVIPPEIFNLTALRTIDVGTNRLEGEVPASIS 329

Query: 419 SLSKLRDLKLWLNMLEGEIPQE 484
           SL  L  L L  N   G IP +
Sbjct: 330 SLRNLYGLDLSNNRFSGTIPSD 351

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 61/198 (30%), Positives = 86/198 (43%), Gaps = 48/198 (24%)
 Frame = +2

Query: 29   LPPFFGSCS-LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS- 202
            +P + G+C+ LL  L L SN F+G +P + L ++  L++LDL+ N   G +P S  N + 
Sbjct: 468  IPSWIGTCNPLLRFLILRSNVFNGSIPKE-LSQLSHLQLLDLAMNNLVGSIPRSFGNFTS 526

Query: 203  ----------------------------------------------ASLLTLDLSSNNFS 244
                                                          A +  +DLSSN  S
Sbjct: 527  MIQPKTELNLPWKVQHHILDGRVDYTYTDRIGINWKRQNQTFQGTVALMAGIDLSSNYLS 586

Query: 245  GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
              I   LC     +++ L L  N  +G IP  + N   L SL  S+N LSG+IPSS+ +L
Sbjct: 587  NEIPSELCN--LESMRFLNLSRNHLSGIIPKEIGNLKILESLDFSWNELSGSIPSSISNL 644

Query: 425  SKLRDLKLWLNMLEGEIP 478
              L  L L  N L GEIP
Sbjct: 645  MSLSSLNLSNNHLSGEIP 662

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 58/170 (34%), Positives = 81/170 (47%), Gaps = 27/170 (15%)
 Frame = +2

Query: 59  LESLALSSNNFS-GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL---DL 226
           L  L L  NN + G +  +   +   L  LDLS N F+G + + L    A+L  L   +L
Sbjct: 111 LAKLDLRRNNITAGVVAANVSTRASNLTYLDLSDNAFAGHILDVLPLSPATLQQLSYLNL 170

Query: 227 SSNNFSGPILPNLCQNPKNT-----------------------LQELYLQNNGFTGKIPP 337
           SSN   GPIL +L    K T                       L +  +QNN  TG IPP
Sbjct: 171 SSNGLYGPILRSLSAMGKMTVFDVSRNRLNSDIPSELFTNWVELTQFRVQNNSITGSIPP 230

Query: 338 TLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           T+ N ++L  L L+ N L+G IP+ +G L+ L+ L+L  N L G IP  +
Sbjct: 231 TICNTTKLKYLRLAKNKLTGEIPAEIGRLASLQALELADNFLTGPIPNSV 280

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 64/209 (30%), Positives = 89/209 (42%), Gaps = 48/209 (22%)
 Frame = +2

Query: 53   SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
            S LES+ L++NN +G  PM  L   + L +LDL  N F+G +P  +   +  L  L L S
Sbjct: 428  SSLESVHLANNNLTGGYPM-VLKGCKWLIILDLGGNHFTGTIPSWIGTCNPLLRFLILRS 486

Query: 233  NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS--------------- 367
            N F+G I   L Q   + LQ L L  N   G IP +  N + ++                
Sbjct: 487  NVFNGSIPKELSQ--LSHLQLLDLAMNNLVGSIPRSFGNFTSMIQPKTELNLPWKVQHHI 544

Query: 368  ---------------------------------LHLSFNYLSGTIPSSLGSLSKLRDLKL 448
                                             + LS NYLS  IPS L +L  +R L L
Sbjct: 545  LDGRVDYTYTDRIGINWKRQNQTFQGTVALMAGIDLSSNYLSNEIPSELCNLESMRFLNL 604

Query: 449  WLNMLEGEIPQELMYVKTLETLILDFNDL 535
              N L G IP+E+  +K LE+L   +N+L
Sbjct: 605  SRNHLSGIIPKEIGNLKILESLDFSWNEL 633

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 45/105 (42%), Positives = 59/105 (56%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           +DLS N  S E+P  L NL  S+  L+LS N+ SG I+P    N K  L+ L    N  +
Sbjct: 578 IDLSSNYLSNEIPSELCNLE-SMRFLNLSRNHLSG-IIPKEIGNLK-ILESLDFSWNELS 634

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLN 457
           G IP ++SN   L SL+LS N+LSG IPS    L  L D  ++ N
Sbjct: 635 GSIPSSISNLMSLSSLNLSNNHLSGEIPSGY-QLRTLADPSIYSN 678

[105][TOP]
>UniRef100_Q0JAU5 Os04g0576900 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group
           RepID=Q0JAU5_ORYSJ
          Length = 622

 Score =  109 bits (273), Expect = 1e-22
 Identities = 72/169 (42%), Positives = 96/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  F S   L  L LS N+F+G +P  T   +  L+VL  S N   GELP  L N S +
Sbjct: 18  VPEGFSSLWSLRHLNLSVNSFTGSMPA-TYGYLPSLQVLSASHNRICGELPVELANCS-N 75

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDL SN  +GPI  +  +     L+EL L +N  + KIPP +SNCS LV+L L  N+
Sbjct: 76  LTVLDLRSNQLTGPIPGDFAR--LGELEELDLSHNQLSRKIPPEISNCSSLVTLKLDDNH 133

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IP+SL +LSKL+ L L  N L G IP  L  +  + +L +  N+L
Sbjct: 134 LGGEIPASLSNLSKLQTLDLSSNNLTGSIPASLAQIPGMLSLNVSQNEL 182

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/131 (41%), Positives = 76/131 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    +CS L  L L SN  +G +P D   ++  L+ LDLS N+ S ++P  ++N S S
Sbjct: 66  LPVELANCSNLTVLDLRSNQLTGPIPGD-FARLGELEELDLSHNQLSRKIPPEISNCS-S 123

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+TL L  N+  G I  +L    K  LQ L L +N  TG IP +L+    ++SL++S N 
Sbjct: 124 LVTLKLDDNHLGGEIPASLSNLSK--LQTLDLSSNNLTGSIPASLAQIPGMLSLNVSQNE 181

Query: 389 LSGTIPSSLGS 421
           LSG IP+ LGS
Sbjct: 182 LSGEIPAMLGS 192

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 38/113 (33%), Positives = 58/113 (51%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L   +PP   +CS L +L L  N+  GE+P  +L  +  L+ LDLS N  +G +P SL  
Sbjct: 110 LSRKIPPEISNCSSLVTLKLDDNHLGGEIPA-SLSNLSKLQTLDLSSNNLTGSIPASLAQ 168

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS 355
           +   +L+L++S N  SG I P +  +   T   ++  N    G  PP  + CS
Sbjct: 169 I-PGMLSLNVSQNELSGEI-PAMLGSRFGT-PSVFASNPNLCG--PPLENECS 216

[106][TOP]
>UniRef100_C5Z570 Putative uncharacterized protein Sb10g022910 n=1 Tax=Sorghum
           bicolor RepID=C5Z570_SORBI
          Length = 1076

 Score =  109 bits (273), Expect = 1e-22
 Identities = 72/169 (42%), Positives = 93/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   SCS L  L LS N  +GE+P   L ++  L+ L LS N+ +G +P  L+NLS S
Sbjct: 307 IPPELSSCSALVVLDLSGNRLTGEVP-GALGRLGALEQLHLSDNQLTGRIPPELSNLS-S 364

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N FSG I P L +     LQ L+L  N  +G IPP+L NC+EL +L LS N 
Sbjct: 365 LTALQLDKNGFSGAIPPQLGE--LKALQVLFLWGNALSGAIPPSLGNCTELYALDLSKNR 422

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            SG IP  + +L KL  L L  N L G +P  +    +L  L L  N L
Sbjct: 423 FSGGIPDEVFALQKLSKLLLLGNELSGPLPPSVANCVSLVRLRLGENQL 471

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 65/162 (40%), Positives = 86/162 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   + S L +L L  N FSG +P   L +++ L+VL L  N  SG +P SL N +  
Sbjct: 355 IPPELSNLSSLTALQLDKNGFSGAIPPQ-LGELKALQVLFLWGNALSGAIPPSLGNCT-E 412

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDLS N FSG I   +    K  L +L L  N  +G +PP+++NC  LV L L  N 
Sbjct: 413 LYALDLSKNRFSGGIPDEVFALQK--LSKLLLLGNELSGPLPPSVANCVSLVRLRLGENQ 470

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETL 514
           L G IP  +G L  L  L L+ N   G +P EL  +  LE L
Sbjct: 471 LVGEIPREIGKLQNLVFLDLYSNRFTGSLPAELANITVLELL 512

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 66/167 (39%), Positives = 89/167 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C  L +L L  N  +G +P + L +++ L  L L  N  SG++P  L++ SA 
Sbjct: 259 IPAALGGCVELRNLYLHMNKLTGPIPPE-LGRLQKLTSLLLWGNALSGKIPPELSSCSA- 316

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ LDLS N  +G +   L +     L++L+L +N  TG+IPP LSN S L +L L  N 
Sbjct: 317 LVVLDLSGNRLTGEVPGALGR--LGALEQLHLSDNQLTGRIPPELSNLSSLTALQLDKNG 374

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            SG IP  LG L  L+ L LW N L G IP  L     L  L L  N
Sbjct: 375 FSGAIPPQLGELKALQVLFLWGNALSGAIPPSLGNCTELYALDLSKN 421

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 67/169 (39%), Positives = 91/169 (53%), Gaps = 2/169 (1%)
 Frame = +2

Query: 5   LFLSLEL--PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGEL 178
           L L  EL  PLPP   +C  L  L L  N   GE+P + + K++ L  LDL  N F+G L
Sbjct: 441 LLLGNELSGPLPPSVANCVSLVRLRLGENQLVGEIPRE-IGKLQNLVFLDLYSNRFTGSL 499

Query: 179 PESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSE 358
           P  L N++  L  LD+ +N+F+G I P   +     L++L L  N  TG+IP +  N S 
Sbjct: 500 PAELANITV-LELLDVHNNSFTGGIPPQFGE--LMNLEQLDLSMNKLTGEIPASFGNFSY 556

Query: 359 LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
           L  L LS N LSG +P S+ +L KL  L L  N   G IP E+  + +L
Sbjct: 557 LNKLILSGNNLSGPLPKSIRNLQKLTMLDLSNNSFSGPIPPEIGALSSL 605

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 66/168 (39%), Positives = 85/168 (50%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P   G+ S L     ++   SG +P + L  +  L+ L L     SG +P +L     
Sbjct: 210 PIPASLGALSNLTVFGAAATALSGPIP-EELGSLVNLQTLALYDTSVSGSIPAALGGC-V 267

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  L L  N  +GPI P L +  K  L  L L  N  +GKIPP LS+CS LV L LS N
Sbjct: 268 ELRNLYLHMNKLTGPIPPELGRLQK--LTSLLLWGNALSGKIPPELSSCSALVVLDLSGN 325

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L+G +P +LG L  L  L L  N L G IP EL  + +L  L LD N
Sbjct: 326 RLTGEVPGALGRLGALEQLHLSDNQLTGRIPPELSNLSSLTALQLDKN 373

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 67/190 (35%), Positives = 91/190 (47%), Gaps = 23/190 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +PP  G+C+ L +L LS N FSG +P D +  ++ L  L L  NE SG LP S+ N  + 
Sbjct: 403 IPPSLGNCTELYALDLSKNRFSGGIP-DEVFALQKLSKLLLLGNELSGPLPPSVANCVSL 461

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 +L+ LDL SN F+G +   L       L+ L + NN F
Sbjct: 462 VRLRLGENQLVGEIPREIGKLQNLVFLDLYSNRFTGSLPAELANI--TVLELLDVHNNSF 519

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           TG IPP       L  L LS N L+G IP+S G+ S L  L L  N L G +P+ +  ++
Sbjct: 520 TGGIPPQFGELMNLEQLDLSMNKLTGEIPASFGNFSYLNKLILSGNNLSGPLPKSIRNLQ 579

Query: 500 TLETLILDFN 529
            L  L L  N
Sbjct: 580 KLTMLDLSNN 589

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 73/216 (33%), Positives = 94/216 (43%), Gaps = 47/216 (21%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP + S S L  L LSSN  +G++P D L  + GL+ L L+ N  +G +P SL NLSA 
Sbjct: 114 VPPSYASLSALRVLDLSSNALTGDIP-DELGALSGLQFLLLNSNRLTGGIPRSLANLSA- 171

Query: 209 LLTLDLSSNNFSGPILPNLCQ-----------NPKNT----------------------- 286
           L  L +  N  +G I  +L             NP+ +                       
Sbjct: 172 LQVLCVQDNLLNGTIPASLGALAALQQFRVGGNPELSGPIPASLGALSNLTVFGAAATAL 231

Query: 287 -------------LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS 427
                        LQ L L +   +G IP  L  C EL +L+L  N L+G IP  LG L 
Sbjct: 232 SGPIPEELGSLVNLQTLALYDTSVSGSIPAALGGCVELRNLYLHMNKLTGPIPPELGRLQ 291

Query: 428 KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           KL  L LW N L G+IP EL     L  L L  N L
Sbjct: 292 KLTSLLLWGNALSGKIPPELSSCSALVVLDLSGNRL 327

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 52/126 (41%), Positives = 72/126 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG+ S L  L LS NN SG LP  ++  ++ L +LDLS N FSG +P  +  LS+ 
Sbjct: 547 IPASFGNFSYLNKLILSGNNLSGPLPK-SIRNLQKLTMLDLSNNSFSGPIPPEIGALSSL 605

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            ++LDLSSN F G +   +  +    LQ L L +NG  G I   L   + L SL++S+N 
Sbjct: 606 GISLDLSSNRFVGELPDEM--SGLTQLQSLNLASNGLYGSI-SVLGELTSLTSLNISYNN 662

Query: 389 LSGTIP 406
            SG IP
Sbjct: 663 FSGAIP 668

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = +2

Query: 272 NPKNTLQELYLQNNGFT-GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL 448
           +P++ +  L L N       +PP L+  S L  L+LS   +SGT+P S  SLS LR L L
Sbjct: 70  SPQSRVVSLSLPNTFLNLSSLPPPLATLSSLQLLNLSTCNISGTVPPSYASLSALRVLDL 129

Query: 449 WLNMLEGEIPQELMYVKTLETLILDFNDL 535
             N L G+IP EL  +  L+ L+L+ N L
Sbjct: 130 SSNALTGDIPDELGALSGLQFLLLNSNRL 158

[107][TOP]
>UniRef100_C5YEF7 Putative uncharacterized protein Sb06g026090 n=1 Tax=Sorghum bicolor
            RepID=C5YEF7_SORBI
          Length = 1164

 Score =  109 bits (273), Expect = 1e-22
 Identities = 71/169 (42%), Positives = 96/169 (56%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  F S   L +L LS N+F+G +P  T   +  L+VL  S N  SGELP  L N S +
Sbjct: 559  VPEGFSSLWSLRNLNLSGNSFTGSIPA-TYGYLPSLQVLSASHNHISGELPAELANCS-N 616

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L+LS N  +G I  +L +   + L+EL L  N  +GKIPP +SNCS L  L L  N+
Sbjct: 617  LTVLELSGNQLTGSIPSDLSR--LDELEELDLSYNQLSGKIPPEISNCSSLALLKLDDNH 674

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            + G IP+SL +LSKL+ L L  N L G IP  L  +  L +  +  N+L
Sbjct: 675  IGGDIPASLANLSKLQTLDLSSNNLTGSIPASLAQIPGLLSFNVSHNEL 723

 Score =  100 bits (248), Expect = 9e-20
 Identities = 69/176 (39%), Positives = 96/176 (54%), Gaps = 1/176 (0%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           L L  P+ P  GS   LE L+L SN+ SG +P  +L ++  L+ + L  N  SG +P+S 
Sbjct: 94  LRLSGPISPALGSLPYLERLSLRSNDLSGAIPA-SLARVTSLRAVFLQSNSLSGPIPQSF 152

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS-NCSELVS 367
                +L T D+S N  SGP+  +       +L+ L L +N F+G IP  +S + + L  
Sbjct: 153 LANLTNLDTFDVSGNLLSGPVPVSF----PPSLKYLDLSSNAFSGTIPANISASTANLQF 208

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+LSFN L GT+P+SLG+L  L  L L  N+LEG IP  L     L  L L  N L
Sbjct: 209 LNLSFNRLRGTVPASLGNLQNLHYLWLDGNLLEGTIPAALANCSALLHLSLQGNSL 264

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 61/153 (39%), Positives = 85/153 (55%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  +G    L+ L+ S N+ SGELP + L     L VL+LS N+ +G +P  L+ L   
Sbjct: 583  IPATYGYLPSLQVLSASHNHISGELPAE-LANCSNLTVLELSGNQLTGSIPSDLSRLD-E 640

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  LDLS N  SG I P +     ++L  L L +N   G IP +L+N S+L +L LS N 
Sbjct: 641  LEELDLSYNQLSGKIPPEISNC--SSLALLKLDDNHIGGDIPASLANLSKLQTLDLSSNN 698

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            L+G+IP+SL  +  L    +  N L GEIP  L
Sbjct: 699  LTGSIPASLAQIPGLLSFNVSHNELSGEIPAML 731

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 55/131 (41%), Positives = 76/131 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    +CS L  L LS N  +G +P D L ++  L+ LDLS+N+ SG++P  ++N S S
Sbjct: 607 LPAELANCSNLTVLELSGNQLTGSIPSD-LSRLDELEELDLSYNQLSGKIPPEISNCS-S 664

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N+  G I  +L    K  LQ L L +N  TG IP +L+    L+S ++S N 
Sbjct: 665 LALLKLDDNHIGGDIPASLANLSK--LQTLDLSSNNLTGSIPASLAQIPGLLSFNVSHNE 722

Query: 389 LSGTIPSSLGS 421
           LSG IP+ LGS
Sbjct: 723 LSGEIPAMLGS 733

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 65/193 (33%), Positives = 95/193 (49%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  FG+ S LE+L++  N  +G L  + L ++  L  LDLS N  +GE+P ++ NL A 
Sbjct: 438  IPASFGNLSWLEALSIQRNRLTGRLSGE-LFRLGNLTFLDLSENNLTGEIPPAIGNLLA- 495

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNT------------------------LQELYLQNNG 316
            L +L+LS N FSG I P    N +N                         LQ +   +N 
Sbjct: 496  LQSLNLSGNAFSGHI-PTTIGNLQNLRVLDLSGQKNLSGNVPAELFGLPQLQYVSFADNS 554

Query: 317  FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
            F+G +P   S+   L +L+LS N  +G+IP++ G L  L+ L    N + GE+P EL   
Sbjct: 555  FSGDVPEGFSSLWSLRNLNLSGNSFTGSIPATYGYLPSLQVLSASHNHISGELPAELANC 614

Query: 497  KTLETLILDFNDL 535
              L  L L  N L
Sbjct: 615  SNLTVLELSGNQL 627

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 61/159 (38%), Positives = 83/159 (52%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ + L  N  +G  P   L    GL +LDLS N F+GELP ++  L+A LL L L  N 
Sbjct: 328 LQVVDLGGNKLAGPFPT-WLAGAGGLTLLDLSGNAFTGELPPAVGQLTA-LLELRLGGNA 385

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           FSG +   + +     LQ L L++N FTG +P +L     L   +L  N  SG IP+S G
Sbjct: 386 FSGAVPAEIGRC--GALQVLDLEDNHFTGDVPSSLGGLPRLREAYLGGNTFSGQIPASFG 443

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +LS L  L +  N L G +  EL  +  L  L L  N+L
Sbjct: 444 NLSWLEALSIQRNRLTGRLSGELFRLGNLTFLDLSENNL 482

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 61/168 (36%), Positives = 85/168 (50%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P P +      L  L LS N F+GELP   + ++  L  L L  N FSG +P  +    A
Sbjct: 341 PFPTWLAGAGGLTLLDLSGNAFTGELP-PAVGQLTALLELRLGGNAFSGAVPAEIGRCGA 399

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  LDL  N+F+G +  +L   P+  L+E YL  N F+G+IP +  N S L +L +  N
Sbjct: 400 -LQVLDLEDNHFTGDVPSSLGGLPR--LREAYLGGNTFSGQIPASFGNLSWLEALSIQRN 456

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L+G +   L  L  L  L L  N L GEIP  +  +  L++L L  N
Sbjct: 457 RLTGRLSGELFRLGNLTFLDLSENNLTGEIPPAIGNLLALQSLNLSGN 504

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 59/166 (35%), Positives = 79/166 (47%), Gaps = 5/166 (3%)
 Frame = +2

Query: 53  SLLESLALSSNNFS-----GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 217
           S L  + L  N FS     G L  D       L+V+DL  N+ +G  P  L   +  L  
Sbjct: 303 SSLRIVQLGGNEFSQVDVPGALAAD-------LQVVDLGGNKLAGPFPTWLAG-AGGLTL 354

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
           LDLS N F+G + P + Q     L EL L  N F+G +P  +  C  L  L L  N+ +G
Sbjct: 355 LDLSGNAFTGELPPAVGQ--LTALLELRLGGNAFSGAVPAEIGRCGALQVLDLEDNHFTG 412

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +PSSLG L +LR+  L  N   G+IP     +  LE L +  N L
Sbjct: 413 DVPSSLGGLPRLREAYLGGNTFSGQIPASFGNLSWLEALSIQRNRL 458

[108][TOP]
>UniRef100_C5WZB6 Putative uncharacterized protein Sb01g019670 n=1 Tax=Sorghum
           bicolor RepID=C5WZB6_SORBI
          Length = 985

 Score =  109 bits (273), Expect = 1e-22
 Identities = 70/174 (40%), Positives = 97/174 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LPP  GS S L+ L LS N  SG LP+ +   MR +K + +S    +G++P  L 
Sbjct: 327 SLVSTLPPELGSLSNLDFLDLSLNQLSGNLPV-SFAGMRKIKEIGISDCNLTGDIPRGLF 385

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
                L++    +N+ +G I P + +  K  L  LYL +N  TG+IPP L   + L  L 
Sbjct: 386 TSCPELISFQAQTNSLTGTIPPEVGKATK--LLILYLFSNNLTGEIPPELGELANLAELD 443

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N+LSG IPSSLG+L +L  L L+ N L G IP E+  +  L+ L L+ N L
Sbjct: 444 LSVNWLSGPIPSSLGNLKQLTRLTLFFNALNGAIPPEIGNMTELQILDLNNNQL 497

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 66/182 (36%), Positives = 91/182 (50%), Gaps = 20/182 (10%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELP--MDTLLK------------------MRGLKVLD 148
           +PP  G  S L  L L +NN  G +P  +  L K                  M  ++ L 
Sbjct: 142 IPPQLGDLSGLVELRLFNNNLVGAIPHQLSKLPKIVQLDLGSNYLTSAPFSPMPTVEFLS 201

Query: 149 LSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK 328
           LS N  +G  PE +   S ++  LDLS N FSGPI   L +   N L+ L L  N F+G+
Sbjct: 202 LSLNYLNGSFPEFVLR-SGNVAYLDLSQNVFSGPIPDALPERLPN-LRWLNLSANAFSGR 259

Query: 329 IPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE 508
           IP + +  + L  LHL  N L+G +P  LGS+S+LR L+L  N L G +P  L  +K L+
Sbjct: 260 IPASFARLTSLRDLHLGGNSLNGGVPDFLGSMSQLRVLELGNNPLGGPLPPVLGRLKMLQ 319

Query: 509 TL 514
            L
Sbjct: 320 RL 321

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 59/155 (38%), Positives = 76/155 (49%), Gaps = 23/155 (14%)
 Frame = +2

Query: 41   FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT--------- 193
            F S S L SL LS+N FSGELP      ++ L+ +DLS N FSGE P S T         
Sbjct: 579  FCSLSSLRSLDLSNNQFSGELPR-CWWNLQALEFMDLSSNIFSGEFPGSATYDLPLQSLH 637

Query: 194  --------------NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI 331
                               L TLD+  NNF G I P+        ++ L L++N FTG I
Sbjct: 638  IGNNNFFGTFPPIVQKCTKLRTLDIGDNNFFGDI-PSWIGTAIPLMRVLMLRSNNFTGII 696

Query: 332  PPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLR 436
            P  LS  S L  L ++ N   G+IP SLG+LS ++
Sbjct: 697  PSELSLLSNLHLLGMAHNSFIGSIPRSLGNLSSMK 731

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 67/221 (30%), Positives = 94/221 (42%), Gaps = 49/221 (22%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
            SL   +PP  G  + L  L L SNN +GE+P + L ++  L  LDLS N  SG +P SL 
Sbjct: 400  SLTGTIPPEVGKATKLLILYLFSNNLTGEIPPE-LGELANLAELDLSVNWLSGPIPSSLG 458

Query: 194  NLS-----------------------ASLLTLDLSSN----------------------- 235
            NL                          L  LDL++N                       
Sbjct: 459  NLKQLTRLTLFFNALNGAIPPEIGNMTELQILDLNNNQLEAARCHHVYGTARSCTWCVRL 518

Query: 236  ---NFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
               +F+G I      +P  +L  L +  N FTG +    S C+ L +L ++ N +SG I 
Sbjct: 519  DQNHFTGDISEAFGVHP--SLDHLDVSENHFTGSLSSDWSKCTHLATLFVNENRISGNID 576

Query: 407  SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            +S  SLS LR L L  N   GE+P+    ++ LE + L  N
Sbjct: 577  ASFCSLSSLRSLDLSNNQFSGELPRCWWNLQALEFMDLSSN 617

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 49/143 (34%), Positives = 77/143 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L LS+N FSG +P  +  ++  L+ L L  N  +G +P+ L ++S  L  L+L +N 
Sbjct: 246 LRWLNLSANAFSGRIPA-SFARLTSLRDLHLGGNSLNGGVPDFLGSMS-QLRVLELGNNP 303

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
             GP+ P L +     LQ L ++N      +PP L + S L  L LS N LSG +P S  
Sbjct: 304 LGGPLPPVLGR--LKMLQRLDVKNASLVSTLPPELGSLSNLDFLDLSLNQLSGNLPVSFA 361

Query: 419 SLSKLRDLKLWLNMLEGEIPQEL 487
            + K++++ +    L G+IP+ L
Sbjct: 362 GMRKIKEIGISDCNLTGDIPRGL 384

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 54/146 (36%), Positives = 77/146 (52%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           FG    L+ L +S N+F+G L  D   K   L  L ++ N  SG +  S  +LS SL +L
Sbjct: 531 FGVHPSLDHLDVSENHFTGSLSSDWS-KCTHLATLFVNENRISGNIDASFCSLS-SLRSL 588

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
           DLS+N FSG  LP    N +  L+ + L +N F+G+ P + +    L SLH+  N   GT
Sbjct: 589 DLSNNQFSGE-LPRCWWNLQ-ALEFMDLSSNIFSGEFPGSATYDLPLQSLHIGNNNFFGT 646

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIP 478
            P  +   +KLR L +  N   G+IP
Sbjct: 647 FPPIVQKCTKLRTLDIGDNNFFGDIP 672

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 64/203 (31%), Positives = 83/203 (40%), Gaps = 44/203 (21%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L SL L++NN +G +P  +  ++R L  LDL  N  SG +P  L +LS  L+ L L +NN
Sbjct: 104 LTSLDLNNNNLAGAIPA-SFSQLRSLATLDLGSNGLSGTIPPQLGDLSG-LVELRLFNNN 161

Query: 239 FSGPILPNLCQNPK-------------------------------------------NTL 289
             G I   L + PK                                             +
Sbjct: 162 LVGAIPHQLSKLPKIVQLDLGSNYLTSAPFSPMPTVEFLSLSLNYLNGSFPEFVLRSGNV 221

Query: 290 QELYLQNNGFTGKIPPTL-SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLE 466
             L L  N F+G IP  L      L  L+LS N  SG IP+S   L+ LRDL L  N L 
Sbjct: 222 AYLDLSQNVFSGPIPDALPERLPNLRWLNLSANAFSGRIPASFARLTSLRDLHLGGNSLN 281

Query: 467 GEIPQELMYVKTLETLILDFNDL 535
           G +P  L  +  L  L L  N L
Sbjct: 282 GGVPDFLGSMSQLRVLELGNNPL 304

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 36/84 (42%), Positives = 45/84 (53%)
 Frame = +2

Query: 284 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNML 463
           +L  L L NN   G IP + S    L +L L  N LSGTIP  LG LS L +L+L+ N L
Sbjct: 103 SLTSLDLNNNNLAGAIPASFSQLRSLATLDLGSNGLSGTIPPQLGDLSGLVELRLFNNNL 162

Query: 464 EGEIPQELMYVKTLETLILDFNDL 535
            G IP +L  +  +  L L  N L
Sbjct: 163 VGAIPHQLSKLPKIVQLDLGSNYL 186

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 43/110 (39%), Positives = 55/110 (50%)
 Frame = +2

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SL +LDL++NN +G I  +  Q    +L  L L +NG +G IPP L + S LV L L  N
Sbjct: 103 SLTSLDLNNNNLAGAIPASFSQ--LRSLATLDLGSNGLSGTIPPQLGDLSGLVELRLFNN 160

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L G IP  L  L K+  L L  N L          + T+E L L  N L
Sbjct: 161 NLVGAIPHQLSKLPKIVQLDLGSNYLTS---APFSPMPTVEFLSLSLNYL 207

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 46/153 (30%), Positives = 70/153 (45%)
 Frame = +2

Query: 74  LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI 253
           L  N+F+G++  +       L  LD+S N F+G L    +  +  L TL ++ N  SG I
Sbjct: 518 LDQNHFTGDIS-EAFGVHPSLDHLDVSENHFTGSLSSDWSKCT-HLATLFVNENRISGNI 575

Query: 254 LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 433
             + C    ++L+ L L NN F+G++P    N   L  + LS N  SG  P S      L
Sbjct: 576 DASFCS--LSSLRSLDLSNNQFSGELPRCWWNLQALEFMDLSSNIFSGEFPGSATYDLPL 633

Query: 434 RDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           + L +  N   G  P  +     L TL +  N+
Sbjct: 634 QSLHIGNNNFFGTFPPIVQKCTKLRTLDIGDNN 666

[109][TOP]
>UniRef100_B9FC38 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9FC38_ORYSJ
          Length = 1116

 Score =  109 bits (273), Expect = 1e-22
 Identities = 72/169 (42%), Positives = 96/169 (56%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  F S   L  L LS N+F+G +P  T   +  L+VL  S N   GELP  L N S +
Sbjct: 553  VPEGFSSLWSLRHLNLSVNSFTGSMPA-TYGYLPSLQVLSASHNRICGELPVELANCS-N 610

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  LDL SN  +GPI  +  +     L+EL L +N  + KIPP +SNCS LV+L L  N+
Sbjct: 611  LTVLDLRSNQLTGPIPGDFAR--LGELEELDLSHNQLSRKIPPEISNCSSLVTLKLDDNH 668

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L G IP+SL +LSKL+ L L  N L G IP  L  +  + +L +  N+L
Sbjct: 669  LGGEIPASLSNLSKLQTLDLSSNNLTGSIPASLAQIPGMLSLNVSQNEL 717

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 65/168 (38%), Positives = 88/168 (52%), Gaps = 1/168 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C  L+ L L  N FSGE+P   L  +R L+ + L  N FSG++P SL NLS  
Sbjct: 384 VPAEIGRCGALQVLDLEDNRFSGEVPA-ALGGLRRLREVYLGGNSFSGQIPASLGNLSW- 441

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L    N  +G +   L       L  L L +N   G+IPP++ N + L SL+LS N 
Sbjct: 442 LEALSTPGNRLTGDLPSELFV--LGNLTFLDLSDNKLAGEIPPSIGNLAALQSLNLSGNS 499

Query: 389 LSGTIPSSLGSLSKLRDLKL-WLNMLEGEIPQELMYVKTLETLILDFN 529
            SG IPS++G+L  LR L L     L G +P EL  +  L+ + L  N
Sbjct: 500 FSGRIPSNIGNLLNLRVLDLSGQKNLSGNLPAELFGLPQLQYVSLAGN 547

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 69/197 (35%), Positives = 95/197 (48%), Gaps = 22/197 (11%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES- 187
           L L   + P   S   LE L+L SN+ SG +P  +L ++  L+ + L +N  SG +P+S 
Sbjct: 88  LRLSGAISPALSSLVYLEKLSLRSNSLSGTIPA-SLSRISSLRAVYLQYNSLSGPIPQSF 146

Query: 188 ---LTNLSA------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 304
              LTNL                    SL  LDLSSN FSG I  N+  +   +LQ L L
Sbjct: 147 LANLTNLQTFDVSGNLLSGPVPVSFPPSLKYLDLSSNAFSGTIPANVSASA-TSLQFLNL 205

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
             N   G +P +L    +L  L L  N L GTIPS+L + S L  L L  N L G +P  
Sbjct: 206 SFNRLRGTVPASLGTLQDLHYLWLDGNLLEGTIPSALSNCSALLHLSLQGNALRGILPPA 265

Query: 485 LMYVKTLETLILDFNDL 535
           +  + +L+ L +  N L
Sbjct: 266 VAAIPSLQILSVSRNRL 282

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 62/168 (36%), Positives = 85/168 (50%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P P +      L  L LS N F+GE+P   + ++  L+ L L  N F+G +P  +    A
Sbjct: 335 PFPSWLAGAGGLTVLDLSGNAFTGEVP-PAVGQLTALQELRLGGNAFTGTVPAEIGRCGA 393

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  LDL  N FSG +   L       L+E+YL  N F+G+IP +L N S L +L    N
Sbjct: 394 -LQVLDLEDNRFSGEVPAAL--GGLRRLREVYLGGNSFSGQIPASLGNLSWLEALSTPGN 450

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L+G +PS L  L  L  L L  N L GEIP  +  +  L++L L  N
Sbjct: 451 RLTGDLPSELFVLGNLTFLDLSDNKLAGEIPPSIGNLAALQSLNLSGN 498

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/194 (31%), Positives = 90/194 (46%), Gaps = 25/194 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELP------------------------MDTLLKM-RG 133
           LPP   +   L+ L++S N  +G +P                        +D  + + + 
Sbjct: 262 LPPAVAAIPSLQILSVSRNRLTGAIPAAAFGGVGNSSLRIVQVGGNAFSQVDVPVSLGKD 321

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
           L+V+DL  N+ +G  P  L   +  L  LDLS N F+G + P + Q     LQEL L  N
Sbjct: 322 LQVVDLRANKLAGPFPSWLAG-AGGLTVLDLSGNAFTGEVPPAVGQ--LTALQELRLGGN 378

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            FTG +P  +  C  L  L L  N  SG +P++LG L +LR++ L  N   G+IP  L  
Sbjct: 379 AFTGTVPAEIGRCGALQVLDLEDNRFSGEVPAALGGLRRLREVYLGGNSFSGQIPASLGN 438

Query: 494 VKTLETLILDFNDL 535
           +  LE L    N L
Sbjct: 439 LSWLEALSTPGNRL 452

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ + L +N  +G  P   L    GL VLDLS N F+GE+P ++  L+A L  L L  N 
Sbjct: 322 LQVVDLRANKLAGPFP-SWLAGAGGLTVLDLSGNAFTGEVPPAVGQLTA-LQELRLGGNA 379

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           F+G +   + +     LQ L L++N F+G++P  L     L  ++L  N  SG IP+SLG
Sbjct: 380 FTGTVPAEIGRC--GALQVLDLEDNRFSGEVPAALGGLRRLREVYLGGNSFSGQIPASLG 437

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +LS L  L    N L G++P EL  +  L  L L  N L
Sbjct: 438 NLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKL 476

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/131 (41%), Positives = 76/131 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    +CS L  L L SN  +G +P D   ++  L+ LDLS N+ S ++P  ++N S S
Sbjct: 601 LPVELANCSNLTVLDLRSNQLTGPIPGD-FARLGELEELDLSHNQLSRKIPPEISNCS-S 658

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+TL L  N+  G I  +L    K  LQ L L +N  TG IP +L+    ++SL++S N 
Sbjct: 659 LVTLKLDDNHLGGEIPASLSNLSK--LQTLDLSSNNLTGSIPASLAQIPGMLSLNVSQNE 716

Query: 389 LSGTIPSSLGS 421
           LSG IP+ LGS
Sbjct: 717 LSGEIPAMLGS 727

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 58/159 (36%), Positives = 84/159 (52%), Gaps = 4/159 (2%)
 Frame = +2

Query: 14  SLELPLPP-FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           SL  P+P  F  + + L++  +S N  SG +P+        LK LDLS N FSG +P ++
Sbjct: 137 SLSGPIPQSFLANLTNLQTFDVSGNLLSGPVPVSF---PPSLKYLDLSSNAFSGTIPANV 193

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY---LQNNGFTGKIPPTLSNCSEL 361
           +  + SL  L+LS N   G +  +L      TLQ+L+   L  N   G IP  LSNCS L
Sbjct: 194 SASATSLQFLNLSFNRLRGTVPASL-----GTLQDLHYLWLDGNLLEGTIPSALSNCSAL 248

Query: 362 VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           + L L  N L G +P ++ ++  L+ L +  N L G IP
Sbjct: 249 LHLSLQGNALRGILPPAVAAIPSLQILSVSRNRLTGAIP 287

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 45/118 (38%), Positives = 60/118 (50%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L LSSN FSG +P +       L+ L+LSFN   G +P SL  L   L  L L  N 
Sbjct: 175 LKYLDLSSNAFSGTIPANVSASATSLQFLNLSFNRLRGTVPASLGTLQ-DLHYLWLDGNL 233

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
             G I P+   N  + L  L LQ N   G +PP ++    L  L +S N L+G IP++
Sbjct: 234 LEGTI-PSALSNC-SALLHLSLQGNALRGILPPAVAAIPSLQILSVSRNRLTGAIPAA 289

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 38/113 (33%), Positives = 58/113 (51%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L   +PP   +CS L +L L  N+  GE+P  +L  +  L+ LDLS N  +G +P SL  
Sbjct: 645 LSRKIPPEISNCSSLVTLKLDDNHLGGEIPA-SLSNLSKLQTLDLSSNNLTGSIPASLAQ 703

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS 355
           +   +L+L++S N  SG I P +  +   T   ++  N    G  PP  + CS
Sbjct: 704 I-PGMLSLNVSQNELSGEI-PAMLGSRFGT-PSVFASNPNLCG--PPLENECS 751

[110][TOP]
>UniRef100_B8B438 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8B438_ORYSI
          Length = 975

 Score =  109 bits (273), Expect = 1e-22
 Identities = 69/174 (39%), Positives = 105/174 (60%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L+  +P  FG   LL+ L L+++  +GE+P ++L     L  +DL  N  +G +PESL 
Sbjct: 161 NLQGSIPSAFGDLPLLQKLVLANSRLAGEIP-ESLGSSISLTYVDLGNNALTGRIPESLV 219

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N S+SL  L L  N  SG +  N+  +  ++L ++ LQ N F G IPP  +  S++  L 
Sbjct: 220 N-SSSLQVLRLMRNALSGQLPTNMFNS--SSLTDICLQQNSFGGTIPPVTAMSSQVKYLD 276

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N L GT+PSS+G+LS L  ++L  N+L G IP+ L +V TLE + L+ N+L
Sbjct: 277 LSDNNLIGTMPSSIGNLSSLIYVRLSRNILLGSIPESLGHVATLEVISLNSNNL 330

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 66/169 (39%), Positives = 87/169 (51%), Gaps = 2/169 (1%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFS--GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P  GS   L+ L L  N F   G   + +L     L  L L  N   G LP ++ NLS+ 
Sbjct: 408 PLLGSLPNLQKLDLGFNMFEADGWSFVSSLTNCSRLTRLMLDGNNIQGNLPSTIGNLSSD 467

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  NN SG I P +  N K  L +LY+  N  TG IPPT+ N   LV ++ + NY
Sbjct: 468 LQWLWLGGNNISGSIPPEI-GNLKG-LTKLYMDYNLLTGNIPPTIGNLHNLVDINFTQNY 525

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP ++G+L +L +L+L  N   G IP  +     L TL L +N L
Sbjct: 526 LSGVIPDAIGNLLQLTNLRLDRNNFSGSIPASIGQCTQLTTLNLAYNSL 574

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 59/167 (35%), Positives = 87/167 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   + + L  L LS+N+F G +P +  L +  L  L+LS N   G +P  L++ S  
Sbjct: 94  IPPCIANLTFLTMLQLSNNSFHGSIPPELGL-LNQLSYLNLSTNSLEGNIPSELSSCS-Q 151

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDLS+NN  G I       P   LQ+L L N+   G+IP +L +   L  + L  N 
Sbjct: 152 LKILDLSNNNLQGSIPSAFGDLP--LLQKLVLANSRLAGEIPESLGSSISLTYVDLGNNA 209

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           L+G IP SL + S L+ L+L  N L G++P  +    +L  + L  N
Sbjct: 210 LTGRIPESLVNSSSLQVLRLMRNALSGQLPTNMFNSSSLTDICLQQN 256

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 63/172 (36%), Positives = 94/172 (54%), Gaps = 3/172 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L  + LS N   G +P ++L  +  L+V+ L+ N  SG +P+SL N+S S
Sbjct: 286 MPSSIGNLSSLIYVRLSRNILLGSIP-ESLGHVATLEVISLNSNNLSGSVPQSLFNMS-S 343

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L +++N+  G I  N+     N +QELYL +  F G IP +L N S L + +L+   
Sbjct: 344 LTFLAMTNNSLIGKIPSNIGYTLPN-IQELYLSDVKFDGSIPASLLNASNLQTFNLANCG 402

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGE---IPQELMYVKTLETLILDFNDL 535
           L+G+IP  LGSL  L+ L L  NM E +       L     L  L+LD N++
Sbjct: 403 LTGSIP-LLGSLPNLQKLDLGFNMFEADGWSFVSSLTNCSRLTRLMLDGNNI 453

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 62/198 (31%), Positives = 96/198 (48%), Gaps = 29/198 (14%)
 Frame = +2

Query: 29   LPPFFGSCSL-LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            LP   G+ S  L+ L L  NN SG +P + +  ++GL  L + +N  +G +P ++ NL  
Sbjct: 457  LPSTIGNLSSDLQWLWLGGNNISGSIPPE-IGNLKGLTKLYMDYNLLTGNIPPTIGNLH- 514

Query: 206  SLLTLDLSSNNFSGPI---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            +L+ ++ + N  SG I   + NL Q     L  L L  N F+G IP ++  C++L +L+L
Sbjct: 515  NLVDINFTQNYLSGVIPDAIGNLLQ-----LTNLRLDRNNFSGSIPASIGQCTQLTTLNL 569

Query: 377  SFN-------------------------YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
            ++N                         YLSG IP  +G+L  L  L +  N L GE+P 
Sbjct: 570  AYNSLNGSIPSKIFQIYPLSVVLDLSHNYLSGGIPEEVGNLVNLNKLSISNNRLSGEVPS 629

Query: 482  ELMYVKTLETLILDFNDL 535
             L     LE+L +  N L
Sbjct: 630  TLGECVLLESLDMQSNFL 647

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 52/120 (43%), Positives = 66/120 (55%)
 Frame = +2

Query: 128 RGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ 307
           R +  LDLS    +G +P  + NL+  L  L LS+N+F G I P L     N L  L L 
Sbjct: 78  RRVIALDLSSEGITGSIPPCIANLTF-LTMLQLSNNSFHGSIPPEL--GLLNQLSYLNLS 134

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            N   G IP  LS+CS+L  L LS N L G+IPS+ G L  L+ L L  + L GEIP+ L
Sbjct: 135 TNSLEGNIPSELSSCSQLKILDLSNNNLQGSIPSAFGDLPLLQKLVLANSRLAGEIPESL 194

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 55/160 (34%), Positives = 82/160 (51%), Gaps = 4/160 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   L  +  + N  SG +P D +  +  L  L L  N FSG +P S+   +  
Sbjct: 506 IPPTIGNLHNLVDINFTQNYLSGVIP-DAIGNLLQLTNLRLDRNNFSGSIPASIGQCT-Q 563

Query: 209 LLTLDLSSNNFSGPILPNLCQ-NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           L TL+L+ N+ +G I   + Q  P + +  L L +N  +G IP  + N   L  L +S N
Sbjct: 564 LTTLNLAYNSLNGSIPSKIFQIYPLSVV--LDLSHNYLSGGIPEEVGNLVNLNKLSISNN 621

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ---ELMYV 496
            LSG +PS+LG    L  L +  N L G IPQ   +L+Y+
Sbjct: 622 RLSGEVPSTLGECVLLESLDMQSNFLVGSIPQSFAKLLYI 661

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 56/157 (35%), Positives = 79/157 (50%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           +L LSS   +G +P   +  +  L +L LS N F G +P  L  L+  L  L+LS+N+  
Sbjct: 82  ALDLSSEGITGSIP-PCIANLTFLTMLQLSNNSFHGSIPPELGLLN-QLSYLNLSTNSLE 139

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I   L  +  + L+ L L NN   G IP    +   L  L L+ + L+G IP SLGS 
Sbjct: 140 GNIPSEL--SSCSQLKILDLSNNNLQGSIPSAFGDLPLLQKLVLANSRLAGEIPESLGSS 197

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  + L  N L G IP+ L+   +L+ L L  N L
Sbjct: 198 ISLTYVDLGNNALTGRIPESLVNSSSLQVLRLMRNAL 234

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 44/104 (42%), Positives = 56/104 (53%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ LDLSS   +G I P  C      L  L L NN F G IPP L   ++L  L+LS N 
Sbjct: 80  VIALDLSSEGITGSIPP--CIANLTFLTMLQLSNNSFHGSIPPELGLLNQLSYLNLSTNS 137

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
           L G IPS L S S+L+ L L  N L+G IP     +  L+ L+L
Sbjct: 138 LEGNIPSELSSCSQLKILDLSNNNLQGSIPSAFGDLPLLQKLVL 181

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 38/89 (42%), Positives = 50/89 (56%)
 Frame = +2

Query: 269 QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL 448
           Q+P+  +  L L + G TG IPP ++N + L  L LS N   G+IP  LG L++L  L L
Sbjct: 75  QSPRRVIA-LDLSSEGITGSIPPCIANLTFLTMLQLSNNSFHGSIPPELGLLNQLSYLNL 133

Query: 449 WLNMLEGEIPQELMYVKTLETLILDFNDL 535
             N LEG IP EL     L+ L L  N+L
Sbjct: 134 STNSLEGNIPSELSSCSQLKILDLSNNNL 162

[111][TOP]
>UniRef100_A7Q7U7 Chromosome chr18 scaffold_61, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7Q7U7_VITVI
          Length = 1473

 Score =  109 bits (273), Expect = 1e-22
 Identities = 66/167 (39%), Positives = 99/167 (59%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ + L  L LS NN  G +P   L  ++ L+ LDLS N+  G +P+ LT+L+  
Sbjct: 842  IPKSIGNLNSLRGLNLSHNNLGGHIP-SPLGNLKSLESLDLSSNKLIGRIPQELTSLTF- 899

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L+LS NN +G I     +N  N+L ELYL +  F+G++P ++ N   L+SLHL  N 
Sbjct: 900  LEVLNLSQNNLTGFIPRGNHEN--NSLMELYLSSKNFSGELPASIGNLKNLISLHLHGNN 957

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
             SG +PSS+G+L+ L+ L L+ N LEG IP  +    +L  + L +N
Sbjct: 958  FSGQLPSSIGNLTNLQGLNLYDNQLEGVIPSFVNGFLSLSYVDLGYN 1004

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 79/201 (39%), Positives = 98/201 (48%), Gaps = 27/201 (13%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE---------- 163
            SL   +P  F +  LLESL LSSN   G +P + L  +  L+VL+LS N           
Sbjct: 474  SLAGHIPSSFKNLKLLESLDLSSNKLIGSIPQE-LTSLTFLEVLNLSENHLTGFIPRGNH 532

Query: 164  --------------FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY 301
                          FSGELP S+ NL  SL TLDLS   F G I P   +N K  +  L 
Sbjct: 533  ENNSLLELVLASTNFSGELPASIGNLK-SLKTLDLSICQFLGSI-PTSLENLKQ-ITSLN 589

Query: 302  LQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL---KLWLNMLEGE 472
            L  N F+GKIP   +N   L+SL LS N  SG  P S+G+L+ L DL    L  N+  G 
Sbjct: 590  LIGNHFSGKIPNIFNNLRNLISLGLSNNNFSGHFPPSIGNLTNLYDLSYVNLGYNLFNGT 649

Query: 473  IPQELMYVKTLETLILDFNDL 535
            IP  L  + +L  L L  N L
Sbjct: 650  IPSWLYTLSSLVVLDLSHNKL 670

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 65/169 (38%), Positives = 91/169 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+   LESL LSSN   G +P + L  +  L+VL+LS N  +G +P    + + S
Sbjct: 866  IPSPLGNLKSLESLDLSSNKLIGRIPQE-LTSLTFLEVLNLSQNNLTGFIPRG-NHENNS 923

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L+ L LSS NFSG  LP    N KN +  L+L  N F+G++P ++ N + L  L+L  N 
Sbjct: 924  LMELYLSSKNFSGE-LPASIGNLKNLIS-LHLHGNNFSGQLPSSIGNLTNLQGLNLYDNQ 981

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L G IPS +     L  + L  N+  G IP  L  + +L  L LD N L
Sbjct: 982  LEGVIPSFVNGFLSLSYVDLGYNLFNGIIPSWLYALPSLVVLYLDHNKL 1030

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 68/170 (40%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29   LPPFFGSCS-LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            LP   G+ S  L  L L  N F G +P  T LK   ++ LD + N+  G +P SL  +  
Sbjct: 745  LPHCLGNFSKYLSVLNLRRNRFHGNIPQ-TFLKGNAIRDLDFNDNQLDGLVPRSLI-ICR 802

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
             L  LDL +N  +      L    K  LQ L L++N F G+IP ++ N + L  L+LS N
Sbjct: 803  KLEVLDLGNNKINDTFPHWLGTLSK--LQVLVLRSNSFHGEIPKSIGNLNSLRGLNLSHN 860

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L G IPS LG+L  L  L L  N L G IPQEL  +  LE L L  N+L
Sbjct: 861  NLGGHIPSPLGNLKSLESLDLSSNKLIGRIPQELTSLTFLEVLNLSQNNL 910

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 59/183 (32%), Positives = 90/183 (49%), Gaps = 15/183 (8%)
 Frame = +2

Query: 32   PPFFGSCSLLESLALSSNNFSGELPMDTLLK-MRGLKVLDLSFNEFSGELPESLTNLSAS 208
            P + G+   L+ L L SN+F G +    +      L+++DL+ N+F G+LPE       +
Sbjct: 1179 PHWLGTLPELQVLVLRSNSFHGHIGRSKIKSPFMSLRIIDLAHNDFEGDLPEMYLRSLKA 1238

Query: 209  LLTLD--------LSSNNFSGPILPNLCQ------NPKNTLQELYLQNNGFTGKIPPTLS 346
            ++ +D        +    +   I+  + +         NT   + L +N F G+IP ++ 
Sbjct: 1239 IMNIDEGNMTRKYMGEEYYQDSIVVTIKRLEIEFVKILNTFTTIDLSSNKFQGEIPKSIG 1298

Query: 347  NCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDF 526
            N + L  L+LS N L+G IPSS G+L  L  L L  N L G IPQEL  +  LE L L  
Sbjct: 1299 NLNSLRGLNLSHNNLAGHIPSSFGNLKLLESLDLSSNKLIGRIPQELTSLTFLEVLNLSQ 1358

Query: 527  NDL 535
            N L
Sbjct: 1359 NHL 1361

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 62/174 (35%), Positives = 87/174 (50%), Gaps = 3/174 (1%)
 Frame = +2

Query: 23   LPLPP---FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
            LP PP   FF S        +S N  SGE+    + +   +++LDLS N  SG LP  L 
Sbjct: 700  LPTPPNSTFFFS--------VSHNKLSGEIS-SLICRASSMEILDLSDNNLSGRLPHCLG 750

Query: 194  NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            N S  L  L+L  N F G I     +   N +++L   +N   G +P +L  C +L  L 
Sbjct: 751  NFSKYLSVLNLRRNRFHGNIPQTFLKG--NAIRDLDFNDNQLDGLVPRSLIICRKLEVLD 808

Query: 374  LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N ++ T P  LG+LSKL+ L L  N   GEIP+ +  + +L  L L  N+L
Sbjct: 809  LGNNKINDTFPHWLGTLSKLQVLVLRSNSFHGEIPKSIGNLNSLRGLNLSHNNL 862

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 57/168 (33%), Positives = 94/168 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + L  L LS N+ +G +P  +   ++ L+ LDLS N+  G +P+ LT+L+  
Sbjct: 455 IPKSIGNLNSLRGLNLSHNSLAGHIP-SSFKNLKLLESLDLSSNKLIGSIPQELTSLTF- 512

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+LS N+ +G I     +N  N+L EL L +  F+G++P ++ N   L +L LS   
Sbjct: 513 LEVLNLSENHLTGFIPRGNHEN--NSLLELVLASTNFSGELPASIGNLKSLKTLDLSICQ 570

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             G+IP+SL +L ++  L L  N   G+IP     ++ L +L L  N+
Sbjct: 571 FLGSIPTSLENLKQITSLNLIGNHFSGKIPNIFNNLRNLISLGLSNNN 618

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 64/192 (33%), Positives = 88/192 (45%), Gaps = 24/192 (12%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
            +P  F +   L SL LS+NNFSG  P  +  L  +  L  ++L +N F+G +P  L  LS
Sbjct: 599  IPNIFNNLRNLISLGLSNNNFSGHFPPSIGNLTNLYDLSYVNLGYNLFNGTIPSWLYTLS 658

Query: 203  ASLLTLDLSSNNFSGPI---------------------LPNLCQNPKNTLQELYLQNNGF 319
             SL+ LDLS N  +G I                     +P     P N+     + +N  
Sbjct: 659  -SLVVLDLSHNKLTGHIDEFQFDSLENIYLNMNELHGPIPRPLPTPPNSTFFFSVSHNKL 717

Query: 320  TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK-LRDLKLWLNMLEGEIPQELMYV 496
            +G+I   +   S +  L LS N LSG +P  LG+ SK L  L L  N   G IPQ  +  
Sbjct: 718  SGEISSLICRASSMEILDLSDNNLSGRLPHCLGNFSKYLSVLNLRRNRFHGNIPQTFLKG 777

Query: 497  KTLETLILDFND 532
              +    LDFND
Sbjct: 778  NAIRD--LDFND 787

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 58/146 (39%), Positives = 79/146 (54%), Gaps = 3/146 (2%)
 Frame = +2

Query: 59  LESLALSSNNF-SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN 235
           L+ L L+ NNF  GELP  ++  ++ LK+L L    FSG +P S+ NL  +L++L L+SN
Sbjct: 119 LQRLNLAFNNFRGGELPA-SIGNLKSLKILVLHNCGFSGSIPSSIGNLK-NLISLGLASN 176

Query: 236 NFSGPILPNLCQNPKNTLQELYLQN--NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 409
           NFSG + P++       LQ+LY  +  N F G IP  L     LV L LS N L+G I  
Sbjct: 177 NFSGQLPPSI--GNLTNLQDLYFSDNFNMFNGTIPSWLYTMPSLVQLDLSHNKLTGHIGE 234

Query: 410 SLGSLSKLRDLKLWLNMLEGEIPQEL 487
                  L  + L +N L G IP  L
Sbjct: 235 F--QFDSLEYIDLSMNELHGSIPGPL 258

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 52/169 (30%), Positives = 80/169 (47%), Gaps = 1/169 (0%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLK-MRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P + G+   L+ L L SN+F G +    +      L+++DL++N+F G+LPE       +
Sbjct: 377 PHWLGTLPELQVLVLRSNSFHGHIGCSKIKSPFMSLRIIDLAYNDFEGDLPEMYLRSLKA 436

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            + +D                  +  +   Y+ +     +IP ++ N + L  L+LS N 
Sbjct: 437 TMNVD------------------EGNMTRKYMGDR----EIPKSIGNLNSLRGLNLSHNS 474

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G IPSS  +L  L  L L  N L G IPQEL  +  LE L L  N L
Sbjct: 475 LAGHIPSSFKNLKLLESLDLSSNKLIGSIPQELTSLTFLEVLNLSENHL 523

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 63/191 (32%), Positives = 87/191 (45%), Gaps = 24/191 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           +P   G+   L SL L+SNNFSG+LP  +  L  ++ L   D +FN F+G +P  L  + 
Sbjct: 158 IPSSIGNLKNLISLGLASNNFSGQLPPSIGNLTNLQDLYFSD-NFNMFNGTIPSWLYTM- 215

Query: 203 ASLLTLDLSSNNFSGPI---------------------LPNLCQNPKNTLQELYLQNNGF 319
            SL+ LDLS N  +G I                     +P     P N+     + +N  
Sbjct: 216 PSLVQLDLSHNKLTGHIGEFQFDSLEYIDLSMNELHGSIPGPLPTPPNSTFFFSVSHNKL 275

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK-LRDLKLWLNMLEGEIPQELMYV 496
           +G+I       S +  L LS N LSG +P  LG+ SK L  L L  N   G IPQ  +  
Sbjct: 276 SGEILSLFCKASSMRILDLSNNNLSGMLPLCLGNFSKYLSVLNLGRNRFHGIIPQTFLKG 335

Query: 497 KTLETLILDFN 529
             +    LDFN
Sbjct: 336 NAIRN--LDFN 344

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 52/134 (38%), Positives = 71/134 (52%), Gaps = 3/134 (2%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSAS-LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
           LDLS +   G +  + T      L  L+L+ NNF G  LP    N K+ L+ L L N GF
Sbjct: 96  LDLSCSWLFGTIHSNTTLFHLPHLQRLNLAFNNFRGGELPASIGNLKS-LKILVLHNCGF 154

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLW--LNMLEGEIPQELMY 493
           +G IP ++ N   L+SL L+ N  SG +P S+G+L+ L+DL      NM  G IP  L  
Sbjct: 155 SGSIPSSIGNLKNLISLGLASNNFSGQLPPSIGNLTNLQDLYFSDNFNMFNGTIPSWLYT 214

Query: 494 VKTLETLILDFNDL 535
           + +L  L L  N L
Sbjct: 215 MPSLVQLDLSHNKL 228

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 48/151 (31%), Positives = 72/151 (47%)
 Frame = +2

Query: 71   ALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGP 250
            ++S N  SGE+    + K   +++ DLS N  SG LP  L N S  L  L+L  N F G 
Sbjct: 1071 SVSHNKLSGEIS-SLICKASSMRIFDLSNNNLSGVLPHCLGNFSKDLFVLNLRRNQFHGI 1129

Query: 251  ILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK 430
            I     +   N ++ L   +N   G +P +L  C +L  L L  N ++ T P  LG+L +
Sbjct: 1130 IPQTFLKG--NAIRNLDFNDNQLEGPVPRSLIICRKLEVLDLGNNKINDTFPHWLGTLPE 1187

Query: 431  LRDLKLWLNMLEGEIPQELMYVKTLETLILD 523
            L+ L L  N   G I +  +    +   I+D
Sbjct: 1188 LQVLVLRSNSFHGHIGRSKIKSPFMSLRIID 1218

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 51/157 (32%), Positives = 72/157 (45%)
 Frame = +2

Query: 59   LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
            LE + L  N   G +P              +S N+ SGE+  SL   ++S+   DLS+NN
Sbjct: 1042 LELICLKMNKLHGPIPRPLPTLPNSTFFFSVSHNKLSGEI-SSLICKASSMRIFDLSNNN 1100

Query: 239  FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
             SG +LP+   N    L  L L+ N F G IP T    + + +L  + N L G +P SL 
Sbjct: 1101 LSG-VLPHCLGNFSKDLFVLNLRRNQFHGIIPQTFLKGNAIRNLDFNDNQLEGPVPRSLI 1159

Query: 419  SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
               KL  L L  N +    P  L  +  L+ L+L  N
Sbjct: 1160 ICRKLEVLDLGNNKINDTFPHWLGTLPELQVLVLRSN 1196

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 53/157 (33%), Positives = 72/157 (45%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           LE + LS N   G +P              +S N+ SGE+  SL   ++S+  LDLS+NN
Sbjct: 240 LEYIDLSMNELHGSIPGPLPTPPNSTFFFSVSHNKLSGEIL-SLFCKASSMRILDLSNNN 298

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            SG +LP    N    L  L L  N F G IP T    + + +L  + N L G +P SL 
Sbjct: 299 LSG-MLPLCLGNFSKYLSVLNLGRNRFHGIIPQTFLKGNAIRNLDFNGNQLEGLLPRSLI 357

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
              KL  L L  N +    P  L  +  L+ L+L  N
Sbjct: 358 ICRKLEVLDLGNNKINDTFPHWLGTLPELQVLVLRSN 394

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 60/172 (34%), Positives = 82/172 (47%), Gaps = 3/172 (1%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
            LP   G+   L SL L  NNFSG+LP  +  L  ++GL + D   N+  G +P S  N  
Sbjct: 938  LPASIGNLKNLISLHLHGNNFSGQLPSSIGNLTNLQGLNLYD---NQLEGVIP-SFVNGF 993

Query: 203  ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
             SL  +DL  N F+G I   L   P  +L  LYL +N  TG I    S+  EL+ L +  
Sbjct: 994  LSLSYVDLGYNLFNGIIPSWLYALP--SLVVLYLDHNKLTGHIGEFQSDSLELICLKM-- 1049

Query: 383  NYLSGTIPSSLGSL-SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            N L G IP  L +L +      +  N L GEI   +    ++    L  N+L
Sbjct: 1050 NKLHGPIPRPLPTLPNSTFFFSVSHNKLSGEISSLICKASSMRIFDLSNNNL 1101

 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 40/88 (45%), Positives = 58/88 (65%)
 Frame = +2

Query: 143  LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
            +DLS N+F GE+P+S+ NL+ SL  L+LS NN +G I P+   N K  L+ L L +N   
Sbjct: 1282 IDLSSNKFQGEIPKSIGNLN-SLRGLNLSHNNLAGHI-PSSFGNLK-LLESLDLSSNKLI 1338

Query: 323  GKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            G+IP  L++ + L  L+LS N+L+G IP
Sbjct: 1339 GRIPQELTSLTFLEVLNLSQNHLTGFIP 1366

[112][TOP]
>UniRef100_A7PJJ1 Chromosome chr12 scaffold_18, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PJJ1_VITVI
          Length = 885

 Score =  109 bits (273), Expect = 1e-22
 Identities = 67/163 (41%), Positives = 96/163 (58%), Gaps = 3/163 (1%)
 Frame = +2

Query: 50  CSL--LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           C+L  LE L L +N   GE+P   +  +R LK+L    N  +G +P ++ N+S SLL + 
Sbjct: 87  CNLPKLEELYLGNNQLIGEIPKK-MSHLRNLKILSFRMNNLTGSIPATIFNIS-SLLNIS 144

Query: 224 LSSNNFSGPILPNLCQ-NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
           LS N+ SG +  N+C  NPK  L+EL L +N  +G+IP  L  C +L  + LS+N  +G+
Sbjct: 145 LSYNSLSGSLPMNICNTNPK--LKELNLSSNHLSGQIPNGLGQCIKLQVISLSYNEFTGS 202

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           IP  +G L +LR L L  N L GEIP  L + + L+ L L FN
Sbjct: 203 IPRGIGELVELRRLSLQNNSLTGEIPSTLSHCRELQKLSLSFN 245

 Score =  107 bits (266), Expect = 7e-22
 Identities = 69/169 (40%), Positives = 95/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S L +++LS N+ SG LPM+       LK L+LS N  SG++P  L      
Sbjct: 130 IPATIFNISSLLNISLSYNSLSGSLPMNICNTNPKLKELNLSSNHLSGQIPNGLGQC-IK 188

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + LS N F+G I   + +  +  L+ L LQNN  TG+IP TLS+C EL  L LSFN 
Sbjct: 189 LQVISLSYNEFTGSIPRGIGELVE--LRRLSLQNNSLTGEIPSTLSHCRELQKLSLSFNQ 246

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +G IP ++GSLS L  L L  N L G IP+E+  ++ L  L L  + L
Sbjct: 247 FTGRIPEAIGSLSNLEGLYLGYNKLAGGIPKEMGNLRNLNILSLTSSGL 295

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 59/157 (37%), Positives = 90/157 (57%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L LSSN+ SG++P + L +   L+V+ LS+NEF+G +P  +  L   L  L L +N+
Sbjct: 165 LKELNLSSNHLSGQIP-NGLGQCIKLQVISLSYNEFTGSIPRGIGEL-VELRRLSLQNNS 222

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G I   L    +  LQ+L L  N FTG+IP  + + S L  L+L +N L+G IP  +G
Sbjct: 223 LTGEIPSTLSHCRE--LQKLSLSFNQFTGRIPEAIGSLSNLEGLYLGYNKLAGGIPKEMG 280

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           +L  L  L L  + L G IP E+  + +L+ + L  N
Sbjct: 281 NLRNLNILSLTSSGLSGPIPTEIFNISSLQEIHLSNN 317

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 65/192 (33%), Positives = 89/192 (46%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS S LE L L  N  +G +P + +  +R L +L L+ +  SG +P  + N+S S
Sbjct: 251 IPEAIGSLSNLEGLYLGYNKLAGGIPKE-MGNLRNLNILSLTSSGLSGPIPTEIFNIS-S 308

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNT-----------------------LQELYLQNNGF 319
           L  + LS+N+FSG  +P       N                        LQ LY   N  
Sbjct: 309 LQEIHLSNNSFSGSTIPTGISYLTNLIDLRLDDNNLTGLIPTSSGRLQKLQVLYFSQNQI 368

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
            G IP  L + + L  L LS N LSGTIP   G+L+ LR + L  N L  E+P  L  ++
Sbjct: 369 HGPIPSGLCHLANLGFLDLSSNKLSGTIPGCFGNLTLLRGIDLHSNGLASEVPSSLWTLR 428

Query: 500 TLETLILDFNDL 535
            L  L L  N L
Sbjct: 429 DLLVLNLSSNFL 440

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 55/159 (34%), Positives = 84/159 (52%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L L  NN +G +P  +  +++ L+VL  S N+  G +P  L +L A+L  LDLSSN 
Sbjct: 334 LIDLRLDDNNLTGLIPTSSG-RLQKLQVLYFSQNQIHGPIPSGLCHL-ANLGFLDLSSNK 391

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            SG I P  C      L+ + L +NG   ++P +L    +L+ L+LS N+L+  +P  +G
Sbjct: 392 LSGTI-PG-CFGNLTLLRGIDLHSNGLASEVPSSLWTLRDLLVLNLSSNFLNSQLPLEVG 449

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++  L  L L  N   G IP  +  ++ L  L L  N L
Sbjct: 450 NMKSLVVLDLSKNQFSGNIPSTISLLQNLVQLHLSHNKL 488

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 51/158 (32%), Positives = 78/158 (49%), Gaps = 25/158 (15%)
 Frame = +2

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN- 310
           + V++LS     G +   + NLS  L  L+L +N   G I   +C  PK  L+ELYL N 
Sbjct: 43  VSVINLSNMGLEGTIAPQVGNLSFLLQQLNLFNNKLVGSIPEAICNLPK--LEELYLGNN 100

Query: 311 -----------------------NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
                                  N  TG IP T+ N S L+++ LS+N LSG++P ++ +
Sbjct: 101 QLIGEIPKKMSHLRNLKILSFRMNNLTGSIPATIFNISSLLNISLSYNSLSGSLPMNICN 160

Query: 422 LS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            + KL++L L  N L G+IP  L     L+ + L +N+
Sbjct: 161 TNPKLKELNLSSNHLSGQIPNGLGQCIKLQVISLSYNE 198

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 55/133 (41%), Positives = 68/133 (51%), Gaps = 2/133 (1%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNL 199
           P+P      + L  L LSSN  SG +P     L  +RG+   DL  N  + E+P SL  L
Sbjct: 371 PIPSGLCHLANLGFLDLSSNKLSGTIPGCFGNLTLLRGI---DLHSNGLASEVPSSLWTL 427

Query: 200 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
              LL L+LSSN F    LP    N K+ L  L L  N F+G IP T+S    LV LHLS
Sbjct: 428 R-DLLVLNLSSN-FLNSQLPLEVGNMKS-LVVLDLSKNQFSGNIPSTISLLQNLVQLHLS 484

Query: 380 FNYLSGTIPSSLG 418
            N L G +P + G
Sbjct: 485 HNKLQGHMPPNFG 497

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 51/150 (34%), Positives = 70/150 (46%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L+ L  S N   G +P   L  +  L  LDLS N+ SG +P    NL+  
Sbjct: 348 IPTSSGRLQKLQVLYFSQNQIHGPIPSG-LCHLANLGFLDLSSNKLSGTIPGCFGNLTL- 405

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DL SN  +  +  +L       L  L L +N    ++P  + N   LV L LS N 
Sbjct: 406 LRGIDLHSNGLASEVPSSLWT--LRDLLVLNLSSNFLNSQLPLEVGNMKSLVVLDLSKNQ 463

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            SG IPS++  L  L  L L  N L+G +P
Sbjct: 464 FSGNIPSTISLLQNLVQLHLSHNKLQGHMP 493

 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 1/91 (1%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS-LHLSFNYLSGTIPSSLGSLSKLRDL 442
           C   +  +  + L N G  G I P + N S L+  L+L  N L G+IP ++ +L KL +L
Sbjct: 36  CNAAQQRVSVINLSNMGLEGTIAPQVGNLSFLLQQLNLFNNKLVGSIPEAICNLPKLEEL 95

Query: 443 KLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N L GEIP+++ +++ L+ L    N+L
Sbjct: 96  YLGNNQLIGEIPKKMSHLRNLKILSFRMNNL 126

[113][TOP]
>UniRef100_A5BWD3 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BWD3_VITVI
          Length = 986

 Score =  109 bits (273), Expect = 1e-22
 Identities = 70/170 (41%), Positives = 95/170 (55%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G   LL  L LS N   G +P DT+  M  LK L LS N   GE+P+SL+NL  +
Sbjct: 163 IPDTVGKMVLLSHLBLSLNQLQGSIP-DTVGNMVSLKKLSLSENHLQGEIPKSLSNL-CN 220

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+L  NN SG + P+      +TL+ L+L +N F+G +P  L   S L  LHL FN 
Sbjct: 221 LQELELDRNNLSGQLAPDFVACANDTLETLFLSDNQFSGSVP-ALIGFSSLRELHLDFNK 279

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ-ELMYVKTLETLILDFNDL 535
           L+GT+P S+G L+ L+ L + LN L+G I +  L  +  L  L L  N L
Sbjct: 280 LNGTLPESVGQLANLQSLDIALNSLQGTISEAHLFNLSWLSYLNLSSNSL 329

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 62/177 (35%), Positives = 85/177 (48%), Gaps = 7/177 (3%)
 Frame = +2

Query: 26  PLPPF------FGSCSL-LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE 184
           P+PP        G+ S+ L  L LS N  +  +    L     L  LDLSFN  +G +PE
Sbjct: 57  PIPPLTIPSLSHGNSSVPLVFLDLSGNYLTSSMYPWLLNFSTTLLHLDLSFNGLNGSIPE 116

Query: 185 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
                 +SL  LDL S+     I   +      +L  L L  N   G IP T+     L 
Sbjct: 117 YAFGNMSSLEYLDLHSSELDDEIPDTI--GDMGSLAYLDLSENQLWGSIPDTVGKMVLLS 174

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L LS N L G+IP ++G++  L+ L L  N L+GEIP+ L  +  L+ L LD N+L
Sbjct: 175 HLBLSLNQLQGSIPDTVGNMVSLKKLSLSENHLQGEIPKSLSNLCNLQELELDRNNL 231

[114][TOP]
>UniRef100_A3A4G5 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=A3A4G5_ORYSJ
          Length = 1132

 Score =  109 bits (273), Expect = 1e-22
 Identities = 64/168 (38%), Positives = 93/168 (55%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ S L    L  NN +G +P + + + R L+ L+LS N FSG +P  +  +S+ 
Sbjct: 554  IPDSIGNLSQLNEFYLDRNNLNGSIPAN-IGQWRQLEKLNLSHNSFSGSMPSEVFKISSL 612

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               LDLS N F+GPILP +       L  + + NN  TG IP TL  C  L  LH+  N 
Sbjct: 613  SQNLDLSHNLFTGPILPEI--GNLINLGSISIANNRLTGDIPSTLGKCVLLEYLHMEGNL 670

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            L+G+IP S  +L  +++L L  N L G++P+ L    +L+ L L FND
Sbjct: 671  LTGSIPQSFMNLKSIKELDLSRNRLSGKVPEFLTLFSSLQKLNLSFND 718

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 66/173 (38%), Positives = 95/173 (54%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P  FG+   L++L LS+N  +G++P   L        +DL  N+ +G +PE L N
Sbjct: 186 LEGRIPTGFGTLRELKTLDLSNNALTGDIP-PLLGSSPSFVYVDLGGNQLTGRIPEFLAN 244

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S+SL  L L  N+ +G I   L  +  +TL  +YL  N   G IPP  +  + +  L L
Sbjct: 245 -SSSLQVLRLMQNSLTGEIPAALFNS--STLTTIYLNRNNLAGSIPPVTAIAAPIQFLSL 301

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           + N L+G IP +LG+LS L  L L  N L G IP+ L  +  LE LIL +N+L
Sbjct: 302 TQNKLTGGIPPTLGNLSSLVRLSLAANNLVGSIPESLSKIPALERLILTYNNL 354

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 63/169 (37%), Positives = 87/169 (51%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  GS      + L  N  +G +P + L     L+VL L  N  +GE+P +L N S++
Sbjct: 214 IPPLLGSSPSFVYVDLGGNQLTGRIP-EFLANSSSLQVLRLMQNSLTGEIPAALFN-SST 271

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L T+ L+ NN +G I P         +Q L L  N  TG IPPTL N S LV L L+ N 
Sbjct: 272 LTTIYLNRNNLAGSIPPVTAIAAP--IQFLSLTQNKLTGGIPPTLGNLSSLVRLSLAANN 329

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G+IP SL  +  L  L L  N L G +P+ +  + +L  L +  N L
Sbjct: 330 LVGSIPESLSKIPALERLILTYNNLSGPVPESIFNMSSLRYLEMANNSL 378

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 69/193 (35%), Positives = 97/193 (50%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ S + SL LSSN F G++P + L ++  +  L+LS N   G +P+ L++ S +
Sbjct: 94  IPPCIGNLSSIASLDLSSNAFLGKIPSE-LGRLGQISYLNLSINSLEGRIPDELSSCS-N 151

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L +N+  G I P+L Q     LQ++ L NN   G+IP       EL +L LS N 
Sbjct: 152 LQVLGLWNNSLQGEIPPSLTQCTH--LQQVILYNNKLEGRIPTGFGTLRELKTLDLSNNA 209

Query: 389 LSGTIPSSLGS------------------------LSKLRDLKLWLNMLEGEIPQELMYV 496
           L+G IP  LGS                         S L+ L+L  N L GEIP  L   
Sbjct: 210 LTGDIPPLLGSSPSFVYVDLGGNQLTGRIPEFLANSSSLQVLRLMQNSLTGEIPAALFNS 269

Query: 497 KTLETLILDFNDL 535
            TL T+ L+ N+L
Sbjct: 270 STLTTIYLNRNNL 282

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 64/192 (33%), Positives = 92/192 (47%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
            +P   G+   L  L +  N FSG +P  T+  +  L VL  + N  SG +P+S+ NLS  
Sbjct: 506  IPAEIGNLKSLTILYMDDNMFSGSIPQ-TIGNLTNLLVLSFAKNNLSGRIPDSIGNLSQL 564

Query: 206  ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                   L  L+LS N+FSG  +P+      +  Q L L +N F
Sbjct: 565  NEFYLDRNNLNGSIPANIGQWRQLEKLNLSHNSFSGS-MPSEVFKISSLSQNLDLSHNLF 623

Query: 320  TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
            TG I P + N   L S+ ++ N L+G IPS+LG    L  L +  N+L G IPQ  M +K
Sbjct: 624  TGPILPEIGNLINLGSISIANNRLTGDIPSTLGKCVLLEYLHMEGNLLTGSIPQSFMNLK 683

Query: 500  TLETLILDFNDL 535
            +++ L L  N L
Sbjct: 684  SIKELDLSRNRL 695

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 64/167 (38%), Positives = 86/167 (51%), Gaps = 2/167 (1%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNF-SGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P FG    L  L L+ N+  +G+   + +L     LK L L  N   G LP S+ NL+  
Sbjct: 432 PSFGLLPNLRYLDLAYNHLEAGDWSFLSSLANCTQLKKLLLDGNGLKGSLPSSVGNLAPQ 491

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N  SG I P    N K+ L  LY+ +N F+G IP T+ N + L+ L  + N 
Sbjct: 492 LDWLWLKQNKLSGTI-PAEIGNLKS-LTILYMDDNMFSGSIPQTIGNLTNLLVLSFAKNN 549

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG IP S+G+LS+L +  L  N L G IP  +   + LE L L  N
Sbjct: 550 LSGRIPDSIGNLSQLNEFYLDRNNLNGSIPANIGQWRQLEKLNLSHN 596

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 56/150 (37%), Positives = 78/150 (52%)
 Frame = +2

Query: 86  NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNL 265
           N+ G    +T  ++R +  L++S     G +P  + NLS S+ +LDLSSN F G I   L
Sbjct: 65  NWQGVSCNNTQTQLR-VMALNVSSKGLGGSIPPCIGNLS-SIASLDLSSNAFLGKIPSEL 122

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
            +     +  L L  N   G+IP  LS+CS L  L L  N L G IP SL   + L+ + 
Sbjct: 123 GR--LGQISYLNLSINSLEGRIPDELSSCSNLQVLGLWNNSLQGEIPPSLTQCTHLQQVI 180

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+ N LEG IP     ++ L+TL L  N L
Sbjct: 181 LYNNKLEGRIPTGFGTLRELKTLDLSNNAL 210

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 61/220 (27%), Positives = 92/220 (41%), Gaps = 51/220 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P        LE L L+ NN SG +P +++  M  L+ L+++ N   G LP+ + N   +
Sbjct: 334 IPESLSKIPALERLILTYNNLSGPVP-ESIFNMSSLRYLEMANNSLIGRLPQDIGNRLPN 392

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP----------------- 337
           L +L LS+   +GPI  +L    K  L+ +YL   G TG +P                  
Sbjct: 393 LQSLILSTIQLNGPIPASLANMTK--LEMIYLVATGLTGVVPSFGLLPNLRYLDLAYNHL 450

Query: 338 ---------TLSNCSELVSL-------------------------HLSFNYLSGTIPSSL 415
                    +L+NC++L  L                          L  N LSGTIP+ +
Sbjct: 451 EAGDWSFLSSLANCTQLKKLLLDGNGLKGSLPSSVGNLAPQLDWLWLKQNKLSGTIPAEI 510

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G+L  L  L +  NM  G IPQ +  +  L  L    N+L
Sbjct: 511 GNLKSLTILYMDDNMFSGSIPQTIGNLTNLLVLSFAKNNL 550

[115][TOP]
>UniRef100_UPI0001984496 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001984496
          Length = 1618

 Score =  109 bits (272), Expect = 1e-22
 Identities = 68/171 (39%), Positives = 102/171 (59%), Gaps = 4/171 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLS----FNEFSGELPESLTN 196
           +P    +C+ L+ ++LS N F G +P   +  +  L+VL L      +  +GE+PE+L N
Sbjct: 451 IPTSLHNCAKLQLISLSYNEFIGSIPKG-IGNLSELEVLYLGQKHLTDSLTGEIPEALFN 509

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
           +S SL   DL SNN SG +  ++C N  + L+ + L  N   GKIP +LS+C EL +L L
Sbjct: 510 IS-SLRIFDLPSNNLSGTLPSSMCCNLPS-LEVISLSWNQLKGKIPSSLSHCQELRTLSL 567

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           SFN  +G+IP  +G+LSKL +L L +N L GE+PQ L  + +L  + L  N
Sbjct: 568 SFNQFTGSIPLGIGNLSKLEELYLGINNLTGELPQALYNISSLRAIDLQSN 618

 Score =  105 bits (262), Expect = 2e-21
 Identities = 67/169 (39%), Positives = 97/169 (57%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P     C  L +L+LS N F+G +P+  +  +  L+ L L  N  +GELP++L N+S S
Sbjct: 552  IPSSLSHCQELRTLSLSFNQFTGSIPLG-IGNLSKLEELYLGINNLTGELPQALYNIS-S 609

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  +DL SN FS  +  ++C      L+ + L  N   GKIP +LS+C EL  + LSFN 
Sbjct: 610  LRAIDLQSNIFSDFLHTDICHKLP-ALKVINLSRNQIKGKIPSSLSHCQELQIISLSFNQ 668

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              G IP ++GSLSKL +L L +N L G IP+ +  +  L+ L L  N L
Sbjct: 669  FVGGIPQAIGSLSKLEELYLGVNNLAGGIPRGMGNLLNLKMLSLVSNRL 717

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 61/173 (35%), Positives = 98/173 (56%), Gaps = 4/173 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S LE   L SN+ +G++P + +  +  LK+L L  N  +G +P  + N+S S
Sbjct: 354 IPQSLGNLSKLEESYLDSNHLTGDIP-EEMSNLLSLKILSLFVNNLTGSIPSGIFNIS-S 411

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L ++ LS+N+  G +  ++C    N L  LYL  N  +G+IP +L NC++L  + LS+N 
Sbjct: 412 LQSISLSANDLYGNLPMDMCDRIPN-LNGLYLSYNQLSGQIPTSLHNCAKLQLISLSYNE 470

Query: 389 LSGTIPSSLGSLSKLRDL----KLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             G+IP  +G+LS+L  L    K   + L GEIP+ L  + +L    L  N+L
Sbjct: 471 FIGSIPKGIGNLSELEVLYLGQKHLTDSLTGEIPEALFNISSLRIFDLPSNNL 523

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 71/197 (36%), Positives = 102/197 (51%), Gaps = 28/197 (14%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
            +P   GS S LE L L  NN +G +P  M  LL    LK+L L  N   G +PE + N+S
Sbjct: 673  IPQAIGSLSKLEELYLGVNNLAGGIPRGMGNLLN---LKMLSLVSNRLQGPIPEEIFNIS 729

Query: 203  ASLLTLDLSSNNFSGPILPNLCQN-PKNTLQELYLQNNGFTGKIPPTLSNCSE------- 358
             SL  +D ++N+ SG +   +C + PK  LQ+L L +N  + ++PP LS C +       
Sbjct: 730  -SLQMIDFTNNSLSGNLPIAICNHLPK--LQQLILSSNQLSAQLPPNLSLCGQLQVLSSL 786

Query: 359  ------------------LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
                              L  ++L  N L+GTIP S G+LS L+ L L  N ++G IP+E
Sbjct: 787  SKNKFTGSIPIEIGNLPMLEEIYLGRNSLTGTIPPSFGNLSALKVLDLQENNIQGNIPKE 846

Query: 485  LMYVKTLETLILDFNDL 535
            L  + +L+ L L  NDL
Sbjct: 847  LGCLLSLQNLSLISNDL 863

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 59/173 (34%), Positives = 90/173 (52%)
 Frame = +2

Query: 17   LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
            L+ P+P    + S L+ +  ++N+ SG LP+     +  L+ L LS N+ S +LP +L+ 
Sbjct: 717  LQGPIPEEIFNISSLQMIDFTNNSLSGNLPIAICNHLPKLQQLILSSNQLSAQLPPNLSL 776

Query: 197  LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
                 +   LS N F+G I   +   P   L+E+YL  N  TG IPP+  N S L  L L
Sbjct: 777  CGQLQVLSSLSKNKFTGSIPIEIGNLPM--LEEIYLGRNSLTGTIPPSFGNLSALKVLDL 834

Query: 377  SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              N + G IP  LG L  L++L L  N L G +P+ +  +  L+++ L  N L
Sbjct: 835  QENNIQGNIPKELGCLLSLQNLSLISNDLRGIVPEAIFNISKLQSISLADNHL 887

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 59/165 (35%), Positives = 94/165 (56%), Gaps = 1/165 (0%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
            SL   +PP FG+ S L+ L L  NN  G +P + L  +  L+ L L  N+  G +PE++ 
Sbjct: 814  SLTGTIPPSFGNLSALKVLDLQENNIQGNIPKE-LGCLLSLQNLSLISNDLRGIVPEAIF 872

Query: 194  NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            N+S  L ++ L+ N+ SG +  ++     N LQ L++  N F+G IP ++SN S+L+SL 
Sbjct: 873  NIS-KLQSISLADNHLSGNLPSSIGAWLPNLLQ-LHIGGNEFSGVIPRSISNISKLISLD 930

Query: 374  LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE-IPQELMYVKTL 505
            LS+N+ +  +P  LG+L  L+ L    N L  E    EL ++ +L
Sbjct: 931  LSYNFFTSYVPKDLGNLRSLQHLGFGSNYLTYEHSTSELSFLTSL 975

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 63/161 (39%), Positives = 88/161 (54%), Gaps = 3/161 (1%)
 Frame = +2

Query: 2    SLFLS---LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
            SL LS   L  P+P  FG+ + L+ L L SN  + ++   +L  + G+  L+LS N  +G
Sbjct: 1080 SLLLSSNELSGPVPSCFGNLTALQQLFLDSNALASQIT-SSLWSLGGILYLNLSSNFLNG 1138

Query: 173  ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
             LP  + N+  +++ LDLS N FSG I  ++ Q     L EL L  N   G IP    + 
Sbjct: 1139 NLPLEIGNMK-TIIKLDLSKNQFSGYIPSSVGQ--LQNLVELSLSKNNLQGPIPLKFGDV 1195

Query: 353  SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 475
              L SL LS+N LSGTIP SL +L  L+ L +  N  +GEI
Sbjct: 1196 VSLESLDLSWNNLSGTIPQSLEALIYLKHLNVSFNKRQGEI 1236

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 53/134 (39%), Positives = 77/134 (57%)
 Frame = +2

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
           L  L+LS     G +P  ++NLS  L +LDLS N F    LPN   N +  L++LY  NN
Sbjct: 292 LTALNLSNMGLEGTIPPQVSNLSF-LASLDLSDNYFHAS-LPNEIGNCRQ-LRQLYFFNN 348

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
             TG IP +L N S+L   +L  N+L+G IP  + +L  L+ L L++N L G IP  +  
Sbjct: 349 ELTGSIPQSLGNLSKLEESYLDSNHLTGDIPEEMSNLLSLKILSLFVNNLTGSIPSGIFN 408

Query: 494 VKTLETLILDFNDL 535
           + +L+++ L  NDL
Sbjct: 409 ISSLQSISLSANDL 422

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/169 (36%), Positives = 84/169 (49%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G    L+ L +S N   G +P D L     L  L LS NE SG +P    NL+A 
Sbjct: 1044 IPTTLGQLQKLQQLIISGNRIHGSIPND-LCHSENLGSLLLSSNELSGPVPSCFGNLTA- 1101

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L L SN  +  I  +L       +  L L +N   G +P  + N   ++ L LS N 
Sbjct: 1102 LQQLFLDSNALASQITSSLWS--LGGILYLNLSSNFLNGNLPLEIGNMKTIIKLDLSKNQ 1159

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             SG IPSS+G L  L +L L  N L+G IP +   V +LE+L L +N+L
Sbjct: 1160 FSGYIPSSVGQLQNLVELSLSKNNLQGPIPLKFGDVVSLESLDLSWNNL 1208

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 58/176 (32%), Positives = 82/176 (46%), Gaps = 1/176 (0%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           + LE  +PP   + S L SL LS N F   LP + +   R L+ L    NE +G +P+SL
Sbjct: 300 MGLEGTIPPQVSNLSFLASLDLSDNYFHASLPNE-IGNCRQLRQLYFFNNELTGSIPQSL 358

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            NLS                            L+E YL +N  TG IP  +SN   L  L
Sbjct: 359 GNLSK---------------------------LEESYLDSNHLTGDIPEEMSNLLSLKIL 391

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM-YVKTLETLILDFNDL 535
            L  N L+G+IPS + ++S L+ + L  N L G +P ++   +  L  L L +N L
Sbjct: 392 SLFVNNLTGSIPSGIFNISSLQSISLSANDLYGNLPMDMCDRIPNLNGLYLSYNQL 447

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 62/192 (32%), Positives = 93/192 (48%), Gaps = 26/192 (13%)
 Frame = +2

Query: 17   LELPLPPFFGSCSLLESLA-LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
            L   LPP    C  L+ L+ LS N F+G +P++ +  +  L+ + L  N  +G +P S  
Sbjct: 766  LSAQLPPNLSLCGQLQVLSSLSKNKFTGSIPIE-IGNLPMLEEIYLGRNSLTGTIPPSFG 824

Query: 194  NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            NLSA L  LDL  NN  G I   L      +LQ L L +N   G +P  + N S+L S+ 
Sbjct: 825  NLSA-LKVLDLQENNIQGNIPKEL--GCLLSLQNLSLISNDLRGIVPEAIFNISKLQSIS 881

Query: 374  LSFNYLSGTIPSSLG-------------------------SLSKLRDLKLWLNMLEGEIP 478
            L+ N+LSG +PSS+G                         ++SKL  L L  N     +P
Sbjct: 882  LADNHLSGNLPSSIGAWLPNLLQLHIGGNEFSGVIPRSISNISKLISLDLSYNFFTSYVP 941

Query: 479  QELMYVKTLETL 514
            ++L  +++L+ L
Sbjct: 942  KDLGNLRSLQHL 953

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 50/148 (33%), Positives = 68/148 (45%)
 Frame = +2

Query: 92  SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ 271
           SG+ P   + + R + + +LS       L   +T  S  +L  + SS           C 
Sbjct: 229 SGKTP--NVRERRAVSLTNLSDEYALLALKAHITYDSQGILATNWSSTTSYCNWFGVSCN 286

Query: 272 NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLW 451
                L  L L N G  G IPP +SN S L SL LS NY   ++P+ +G+  +LR L  +
Sbjct: 287 AHHGRLTALNLSNMGLEGTIPPQVSNLSFLASLDLSDNYFHASLPNEIGNCRQLRQLYFF 346

Query: 452 LNMLEGEIPQELMYVKTLETLILDFNDL 535
            N L G IPQ L  +  LE   LD N L
Sbjct: 347 NNELTGSIPQSLGNLSKLEESYLDSNHL 374

[116][TOP]
>UniRef100_C5XQ04 Putative uncharacterized protein Sb03g006100 n=1 Tax=Sorghum
           bicolor RepID=C5XQ04_SORBI
          Length = 1037

 Score =  109 bits (272), Expect = 1e-22
 Identities = 73/165 (44%), Positives = 100/165 (60%), Gaps = 1/165 (0%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           G+ S L  L L+SN FSG +P+ +L  +R L  LDL  N FSG +P +L++ + SL+ + 
Sbjct: 79  GNLSSLRILNLTSNGFSGNIPV-SLGHLRHLHTLDLRHNAFSGTIPTNLSSCT-SLMIMA 136

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           +  NN SG +   L  N K  L+ L L NN  TG IP +L+N S L  L LSFN+L GTI
Sbjct: 137 IGFNNISGNVPLELGHNLKQ-LKVLSLTNNNLTGPIPASLANLSSLSILDLSFNHLEGTI 195

Query: 404 PSSLGSLSKLRDLKL-WLNMLEGEIPQELMYVKTLETLILDFNDL 535
           P+SLG L +L  L L + N L GE+P  L  + +LE L + +N L
Sbjct: 196 PTSLGVLRELWYLDLSYNNNLSGELPMSLYNLSSLEKLHIQWNML 240

 Score =  103 bits (257), Expect = 8e-21
 Identities = 71/175 (40%), Positives = 97/175 (55%), Gaps = 1/175 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTL-LKMRGLKVLDLSFNEFSGELPESL 190
           +LE P+PP  G    + SL LS N+ +G +P +   L +  L  LD S+N  SG +P  +
Sbjct: 440 NLEGPIPPNIGKMKSIFSLDLSLNHLNGSIPREIFELPLLTLSYLDFSYNSLSGSIPYEV 499

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            NL  +L  L LS N  SG I  ++       LQEL L +N F G IP  L+    L +L
Sbjct: 500 GNL-VNLNRLVLSGNQLSGEIPESV--GKCTVLQELRLDSNLFNGSIPQHLNKA--LTTL 554

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +LS N LSG+IP ++GS+  L +L L  N L G+IP  L  + +L  L L FNDL
Sbjct: 555 NLSMNELSGSIPDAIGSIVGLEELCLAHNNLSGQIPTALQNLTSLLNLDLSFNDL 609

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 63/172 (36%), Positives = 92/172 (53%), Gaps = 5/172 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    SC+ L  +A+  NN SG +P++    ++ LKVL L+ N  +G +P SL NLS S
Sbjct: 122 IPTNLSSCTSLMIMAIGFNNISGNVPLELGHNLKQLKVLSLTNNNLTGPIPASLANLS-S 180

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYL----QNNGFTGKIPPTLSNCSELVSLHL 376
           L  LDLS N+  G I  +L       L+EL+      NN  +G++P +L N S L  LH+
Sbjct: 181 LSILDLSFNHLEGTIPTSL-----GVLRELWYLDLSYNNNLSGELPMSLYNLSSLEKLHI 235

Query: 377 SFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            +N LSG++P+ +GS    ++ L    N   G IP  L  +  L  L L  N
Sbjct: 236 QWNMLSGSMPTDIGSKFPSMQILDYVANQFTGPIPASLSNLTLLRQLHLGQN 287

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 66/192 (34%), Positives = 92/192 (47%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   G+   LE L + +   SGE+P D++ K+  L  L L     SG++P S+ NLS  
Sbjct: 373 IPSSIGNLVGLEILGIFNTYISGEIP-DSIGKLGNLTALGLFNINLSGQIPSSVGNLSKL 431

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 S+ +LDLS N+ +G I   + + P  TL  L    N  
Sbjct: 432 AILDAYQTNLEGPIPPNIGKMKSIFSLDLSLNHLNGSIPREIFELPLLTLSYLDFSYNSL 491

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           +G IP  + N   L  L LS N LSG IP S+G  + L++L+L  N+  G IPQ L   K
Sbjct: 492 SGSIPYEVGNLVNLNRLVLSGNQLSGEIPESVGKCTVLQELRLDSNLFNGSIPQHLN--K 549

Query: 500 TLETLILDFNDL 535
            L TL L  N+L
Sbjct: 550 ALTTLNLSMNEL 561

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 66/161 (40%), Positives = 87/161 (54%), Gaps = 1/161 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE-FSGELPESLTNLS 202
           P+P    + S L  L LS N+  G +P  +L  +R L  LDLS+N   SGELP SL NLS
Sbjct: 170 PIPASLANLSSLSILDLSFNHLEGTIPT-SLGVLRELWYLDLSYNNNLSGELPMSLYNLS 228

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
            SL  L +  N  SG  +P    +   ++Q L    N FTG IP +LSN + L  LHL  
Sbjct: 229 -SLEKLHIQWNMLSGS-MPTDIGSKFPSMQILDYVANQFTGPIPASLSNLTLLRQLHLGQ 286

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
           N LSG +P ++G L  L+ L L  NMLE    +   +V +L
Sbjct: 287 NLLSGYVPRTMGKLRALQHLHLVNNMLEANHAEGWEFVTSL 327

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 59/169 (34%), Positives = 79/169 (46%), Gaps = 6/169 (3%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG------ELPES 187
           P+P    + +LL  L L  N  SG +P  T+ K+R L+ L L  N          E   S
Sbjct: 268 PIPASLSNLTLLRQLHLGQNLLSGYVPR-TMGKLRALQHLHLVNNMLEANHAEGWEFVTS 326

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           L+N S  L  LD+S+N      LP+   N    LQ L L N G  G IP ++ N   L  
Sbjct: 327 LSNCS-QLQILDISNNTAFTGQLPSSIVNLSTNLQRLRLDNTGIWGGIPSSIGNLVGLEI 385

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETL 514
           L +   Y+SG IP S+G L  L  L L+   L G+IP  +  +  L  L
Sbjct: 386 LGIFNTYISGEIPDSIGKLGNLTALGLFNINLSGQIPSSVGNLSKLAIL 434

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 59/157 (37%), Positives = 87/157 (55%), Gaps = 1/157 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G+   L  L LS N  SGE+P +++ K   L+ L L  N F+G +P+   
Sbjct: 490 SLSGSIPYEVGNLVNLNRLVLSGNQLSGEIP-ESVGKCTVLQELRLDSNLFNGSIPQ--- 545

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           +L+ +L TL+LS N  SG I P+   +    L+EL L +N  +G+IP  L N + L++L 
Sbjct: 546 HLNKALTTLNLSMNELSGSI-PDAIGSIVG-LEELCLAHNNLSGQIPTALQNLTSLLNLD 603

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLK-LWLNMLEGEIPQ 481
           LSFN L G +P   G  + L ++  +  N L G IPQ
Sbjct: 604 LSFNDLRGEVPKD-GIFTMLDNISIIGNNKLCGGIPQ 639

[117][TOP]
>UniRef100_C5X3Q3 Putative uncharacterized protein Sb02g027710 n=1 Tax=Sorghum
           bicolor RepID=C5X3Q3_SORBI
          Length = 1098

 Score =  109 bits (272), Expect = 1e-22
 Identities = 69/168 (41%), Positives = 93/168 (55%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           PLPP  G CS L  L L+    SG LP +T+ +++ ++ + +     SG +PES+ N + 
Sbjct: 213 PLPPEIGGCSNLTMLGLAETGVSGSLP-ETIGQLKKIQTIAIYTTLLSGRIPESIGNCT- 270

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L +L L  N+ SGPI   L Q  K  LQ L L  N   G IPP L  C EL  + LS N
Sbjct: 271 ELTSLYLYQNSLSGPIPAQLGQLKK--LQTLLLWQNQLVGAIPPELGQCKELTLIDLSLN 328

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L+G+IP+SLG L  L+ L+L  N L G IP EL    +L  + +D N
Sbjct: 329 SLTGSIPASLGRLPNLQQLQLSTNQLTGTIPPELSNCTSLTDIEVDNN 376

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 70/201 (34%), Positives = 100/201 (49%), Gaps = 24/201 (11%)
 Frame = +2

Query: 5    LFLSLEL--PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGEL 178
            L L+ EL  P+PP  G+C+ L  L L+ N  SG +P + +  ++ L  LD+S N   G +
Sbjct: 444  LLLNNELSGPIPPEIGNCTNLYRLRLNGNRLSGTIPAE-IGNLKNLNFLDMSENHLVGPV 502

Query: 179  PESLTN---------------------LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE 295
            P +++                      L  SL  +D+S N  +GP+  ++   P+  L +
Sbjct: 503  PAAISGCASLEFLDLHSNALSGALPDTLPRSLQLIDVSDNQLAGPLSSSIGSMPE--LTK 560

Query: 296  LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLR-DLKLWLNMLEGE 472
            LY+ NN  TG IPP L +C +L  L L  N  SG IPS LG L  L   L L  N L GE
Sbjct: 561  LYMGNNRLTGGIPPELGSCEKLQLLDLGGNAFSGDIPSELGLLPSLEISLNLSSNRLSGE 620

Query: 473  IPQELMYVKTLETLILDFNDL 535
            IP +   +  L +L L  N+L
Sbjct: 621  IPSQFAGLDKLGSLDLSHNEL 641

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 64/181 (35%), Positives = 87/181 (48%), Gaps = 22/181 (12%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           LESLAL+SN+  G +P D +  +  L  L L  NE SG +P S+ NL    +     +  
Sbjct: 151 LESLALNSNSLRGAIP-DDIGNLTSLAYLTLYDNELSGPIPPSIGNLKKLQVLRAGGNQG 209

Query: 239 FSGPILPNL--CQN--------------------PKNTLQELYLQNNGFTGKIPPTLSNC 352
             GP+ P +  C N                        +Q + +     +G+IP ++ NC
Sbjct: 210 MKGPLPPEIGGCSNLTMLGLAETGVSGSLPETIGQLKKIQTIAIYTTLLSGRIPESIGNC 269

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           +EL SL+L  N LSG IP+ LG L KL+ L LW N L G IP EL   K L  + L  N 
Sbjct: 270 TELTSLYLYQNSLSGPIPAQLGQLKKLQTLLLWQNQLVGAIPPELGQCKELTLIDLSLNS 329

Query: 533 L 535
           L
Sbjct: 330 L 330

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 61/169 (36%), Positives = 87/169 (51%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+C+ L SL L  N+ SG +P   L +++ L+ L L  N+  G +P  L      
Sbjct: 262 IPESIGNCTELTSLYLYQNSLSGPIPAQ-LGQLKKLQTLLLWQNQLVGAIPPELGQCK-E 319

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS N+ +G I  +L + P   LQ+L L  N  TG IPP LSNC+ L  + +  N 
Sbjct: 320 LTLIDLSLNSLTGSIPASLGRLPN--LQQLQLSTNQLTGTIPPELSNCTSLTDIEVDNNL 377

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG I      LS L     W N L G +P  L    +L+ + L +N+L
Sbjct: 378 LSGEISIDFPRLSNLTLFYAWKNRLTGGVPVSLAEAPSLQAVDLSYNNL 426

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 62/169 (36%), Positives = 91/169 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   +C+ L  + + +N  SGE+ +D   ++  L +     N  +G +P SL   + S
Sbjct: 358 IPPELSNCTSLTDIEVDNNLLSGEISID-FPRLSNLTLFYAWKNRLTGGVPVSLAE-APS 415

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS NN +GPI P      +N L +L L NN  +G IPP + NC+ L  L L+ N 
Sbjct: 416 LQAVDLSYNNLTGPI-PKALFGLQN-LTKLLLLNNELSGPIPPEIGNCTNLYRLRLNGNR 473

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSGTIP+ +G+L  L  L +  N L G +P  +    +LE L L  N L
Sbjct: 474 LSGTIPAEIGNLKNLNFLDMSENHLVGPVPAAISGCASLEFLDLHSNAL 522

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 51/141 (36%), Positives = 75/141 (53%), Gaps = 1/141 (0%)
 Frame = +2

Query: 68  LALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG 247
           L+++S +  G LP +       LK L+LS    +G +P+ +      L TLDLS N  +G
Sbjct: 81  LSITSVDLQGPLPANLQPLAASLKTLELSGTNLTGAIPKEMGGYG-ELTTLDLSKNQLTG 139

Query: 248 PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS 427
            I   LC+  K  L+ L L +N   G IP  + N + L  L L  N LSG IP S+G+L 
Sbjct: 140 AIPDELCRLAK--LESLALNSNSLRGAIPDDIGNLTSLAYLTLYDNELSGPIPPSIGNLK 197

Query: 428 KLRDLKLWLNM-LEGEIPQEL 487
           KL+ L+   N  ++G +P E+
Sbjct: 198 KLQVLRAGGNQGMKGPLPPEI 218

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 45/129 (34%), Positives = 69/129 (53%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           PL    GS   L  L + +N  +G +P + L     L++LDL  N FSG++P  L  L +
Sbjct: 547 PLSSSIGSMPELTKLYMGNNRLTGGIPPE-LGSCEKLQLLDLGGNAFSGDIPSELGLLPS 605

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
             ++L+LSSN  SG I        K  L  L L +N  +G + P L+    LV+L++S+N
Sbjct: 606 LEISLNLSSNRLSGEIPSQFAGLDK--LGSLDLSHNELSGSLEP-LAALQNLVTLNISYN 662

Query: 386 YLSGTIPSS 412
             SG +P++
Sbjct: 663 AFSGELPNT 671

[118][TOP]
>UniRef100_A9TAP0 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9TAP0_PHYPA
          Length = 798

 Score =  109 bits (272), Expect = 1e-22
 Identities = 72/169 (42%), Positives = 100/169 (59%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+ P   + S L +L LS NNF G LP + + ++  L  L++S N  SG LP SL NLS 
Sbjct: 93  PIAPVLRNLSELRTLVLSRNNFFGPLPSE-VGQIGSLWKLNVSDNALSGSLPSSLGNLSR 151

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  LDLS N F+G I PNL +  + TL+ + L  NGFTG IP TL +C+ LV ++++ N
Sbjct: 152 -LRMLDLSKNAFTGEIPPNLFRYCE-TLRYVSLAENGFTGVIPDTLWSCTTLVGVNVALN 209

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            L GT+P  LG L  L  L +  N L G IP +L  +  +  + LDF++
Sbjct: 210 SLQGTVPPKLGGLVHLEFLDVHRNKLSGAIPLQLALLSNV--IYLDFSN 256

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 46/128 (35%), Positives = 71/128 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   +  LL  +  S+N   G +P + +  +  L+ + LS     G +P SL NL+ S
Sbjct: 263 IPPAIAALKLLNFVDFSNNPIGGSVPSE-IGGLTALERMGLSNMSLQGNIPASLVNLT-S 320

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LD+S+NN +G I P L Q     +Q+L+LQNN     IP +L +   L   ++S+N 
Sbjct: 321 LQNLDMSTNNLTGAIPPELGQIA--AMQDLFLQNNSLNSTIPASLVSLLNLTGFNVSYNR 378

Query: 389 LSGTIPSS 412
           LSG IP++
Sbjct: 379 LSGRIPTT 386

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 53/169 (31%), Positives = 85/169 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    SC+ L  + ++ N+  G +P   L  +  L+ LD+  N+ SG +P  L  LS +
Sbjct: 191 IPDTLWSCTTLVGVNVALNSLQGTVP-PKLGGLVHLEFLDVHRNKLSGAIPLQLALLS-N 248

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ LD S+N  +G I P +       L  +   NN   G +P  +   + L  + LS   
Sbjct: 249 VIYLDFSNNQLAGGIPPAIAA--LKLLNFVDFSNNPIGGSVPSEIGGLTALERMGLSNMS 306

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IP+SL +L+ L++L +  N L G IP EL  +  ++ L L  N L
Sbjct: 307 LQGNIPASLVNLTSLQNLDMSTNNLTGAIPPELGQIAAMQDLFLQNNSL 355

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 54/177 (30%), Positives = 77/177 (43%), Gaps = 22/177 (12%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL+  +PP  G    LE L +  N  SG +P+   L +  +  LD S N+ +G +P ++ 
Sbjct: 210 SLQGTVPPKLGGLVHLEFLDVHRNKLSGAIPLQLAL-LSNVIYLDFSNNQLAGGIPPAIA 268

Query: 194 NLSASLLTLDLSSNNFSGPI--------------LPNLCQNPK--------NTLQELYLQ 307
            L   L  +D S+N   G +              L N+              +LQ L + 
Sbjct: 269 ALKL-LNFVDFSNNPIGGSVPSEIGGLTALERMGLSNMSLQGNIPASLVNLTSLQNLDMS 327

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            N  TG IPP L   + +  L L  N L+ TIP+SL SL  L    +  N L G IP
Sbjct: 328 TNNLTGAIPPELGQIAAMQDLFLQNNSLNSTIPASLVSLLNLTGFNVSYNRLSGRIP 384

[119][TOP]
>UniRef100_A7VM27 Receptor-like kinase (Fragment) n=1 Tax=Marchantia polymorpha
           RepID=A7VM27_MARPO
          Length = 917

 Score =  109 bits (272), Expect = 1e-22
 Identities = 74/195 (37%), Positives = 100/195 (51%), Gaps = 26/195 (13%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLD-------------------- 148
           +PP    CS L+ L L  N FSG LP+D    +  L++LD                    
Sbjct: 94  IPPSLSKCSELKELNLGENEFSGRLPLDVFTSLSNLEILDVSSNLIVGELLVSTDLGQFR 153

Query: 149 ------LSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN 310
                 LS N  SG +PE+L NL+ +L  L+L SNNF+G +  +L     + L+ L LQN
Sbjct: 154 SLRNLILSGNNLSGSVPENLGNLT-NLEILELKSNNFTGHVPTSL--GGLSRLRTLNLQN 210

Query: 311 NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM 490
           N  TG+IP  L   S L +L L  N L+G IP++LG+ +KLR L L  N   G IP EL 
Sbjct: 211 NSLTGQIPRELGQLSNLSTLILGKNKLTGEIPTTLGNCAKLRSLWLNQNTFNGSIPVELY 270

Query: 491 YVKTLETLILDFNDL 535
           +++ L  L L  N L
Sbjct: 271 HLRNLVVLSLFDNKL 285

 Score =  107 bits (268), Expect = 4e-22
 Identities = 69/174 (39%), Positives = 93/174 (53%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G  S L +L L  N  +G +P  +L K   LK L+L  NEFSG LP  + 
Sbjct: 65  SLTGQIPRELGQLSNLSTLILGKNKLTGSIP-PSLSKCSELKELNLGENEFSGRLPLDVF 123

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
              ++L  LD+SSN   G +L +       +L+ L L  N  +G +P  L N + L  L 
Sbjct: 124 TSLSNLEILDVSSNLIVGELLVSTDLGQFRSLRNLILSGNNLSGSVPENLGNLTNLEILE 183

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N  +G +P+SLG LS+LR L L  N L G+IP+EL  +  L TLIL  N L
Sbjct: 184 LKSNNFTGHVPTSLGGLSRLRTLNLQNNSLTGQIPRELGQLSNLSTLILGKNKL 237

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 66/170 (38%), Positives = 90/170 (52%)
 Frame = +2

Query: 20  ELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL 199
           EL +    G    L +L LS NN SG +P + L  +  L++L+L  N F+G +P SL  L
Sbjct: 142 ELLVSTDLGQFRSLRNLILSGNNLSGSVP-ENLGNLTNLEILELKSNNFTGHVPTSLGGL 200

Query: 200 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           S  L TL+L +N+ +G I   L Q   + L  L L  N  TG+IP TL NC++L SL L+
Sbjct: 201 SR-LRTLNLQNNSLTGQIPRELGQ--LSNLSTLILGKNKLTGEIPTTLGNCAKLRSLWLN 257

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N  +G+IP  L  L  L  L L+ N L   I  E+  +  L  L   FN
Sbjct: 258 QNTFNGSIPVELYHLRNLVVLSLFDNKLNATISPEVRKLSNLVVLDFSFN 307

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 65/164 (39%), Positives = 90/164 (54%), Gaps = 3/164 (1%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           S L+ L LS NNF+G LP + +  +  L  L L+ N F G +P SL+  S  L  L+L +
Sbjct: 6   SSLQVLDLSGNNFTGALPRE-ISALVNLTTLLLNGNGFDGSIPPSLSKCS-ELKELNLQN 63

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           N+ +G I   L Q   + L  L L  N  TG IPP+LS CSEL  L+L  N  SG +P  
Sbjct: 64  NSLTGQIPRELGQ--LSNLSTLILGKNKLTGSIPPSLSKCSELKELNLGENEFSGRLPLD 121

Query: 413 L-GSLSKLRDLKLWLNMLEGE--IPQELMYVKTLETLILDFNDL 535
           +  SLS L  L +  N++ GE  +  +L   ++L  LIL  N+L
Sbjct: 122 VFTSLSNLEILDVSSNLIVGELLVSTDLGQFRSLRNLILSGNNL 165

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/136 (41%), Positives = 79/136 (58%), Gaps = 1/136 (0%)
 Frame = +2

Query: 125 MRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 304
           +  L+VLDLS N F+G LP  ++ L  +L TL L+ N F G I P+L +  +  L+EL L
Sbjct: 5   LSSLQVLDLSGNNFTGALPREISAL-VNLTTLLLNGNGFDGSIPPSLSKCSE--LKELNL 61

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
           QNN  TG+IP  L   S L +L L  N L+G+IP SL   S+L++L L  N   G +P +
Sbjct: 62  QNNSLTGQIPRELGQLSNLSTLILGKNKLTGSIPPSLSKCSELKELNLGENEFSGRLPLD 121

Query: 485 LM-YVKTLETLILDFN 529
           +   +  LE L +  N
Sbjct: 122 VFTSLSNLEILDVSSN 137

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 54/115 (46%), Positives = 62/115 (53%)
 Frame = +2

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           L  + +SL  LDLS NNF+G  LP       N L  L L  NGF G IPP+LS CSEL  
Sbjct: 1   LLEVLSSLQVLDLSGNNFTGA-LPREISALVN-LTTLLLNGNGFDGSIPPSLSKCSELKE 58

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L+L  N L+G IP  LG LS L  L L  N L G IP  L     L+ L L  N+
Sbjct: 59  LNLQNNSLTGQIPRELGQLSNLSTLILGKNKLTGSIPPSLSKCSELKELNLGENE 113

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 65/193 (33%), Positives = 90/193 (46%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + LE L L SNNF+G +P  +L  +  L+ L+L  N  +G++P  L  LS +
Sbjct: 169 VPENLGNLTNLEILELKSNNFTGHVPT-SLGGLSRLRTLNLQNNSLTGQIPRELGQLS-N 226

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP------------------ 334
           L TL L  N  +G I   L    K  L+ L+L  N F G IP                  
Sbjct: 227 LSTLILGKNKLTGEIPTTLGNCAK--LRSLWLNQNTFNGSIPVELYHLRNLVVLSLFDNK 284

Query: 335 ------PTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
                 P +   S LV L  SFN L G+IP  +  LS++R L L  N L   +P  +   
Sbjct: 285 LNATISPEVRKLSNLVVLDFSFNLLRGSIPKEICELSRVRILLLNNNGLTDSLPDCIGNF 344

Query: 497 KTLETLILDFNDL 535
            +L+ L L FN L
Sbjct: 345 SSLQILDLSFNFL 357

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 57/179 (31%), Positives = 85/179 (47%), Gaps = 10/179 (5%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P      S +  L L++N  +  LP D +     L++LDLSFN  SG+LP   + L A 
Sbjct: 313 IPKEICELSRVRILLLNNNGLTDSLP-DCIGNFSSLQILDLSFNFLSGDLPGDYSGLYAL 371

Query: 206 --------SLLTLDLSSNNFSGPILPN-LCQNPKNTLQELYLQNNGFTGKIPPTLSNCSE 358
                    L+  ++    +   I+   L    + +   + L +N FTG+IPP       
Sbjct: 372 KNVNRTLKQLVPEEMRMTTYDQQIMNQILTWKAEESPTLILLSSNQFTGEIPPGFGELRN 431

Query: 359 LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +  L LS N+ SG IP +LG+ + L  LKL  N L G IP+EL  +  L    +  NDL
Sbjct: 432 MQELDLSNNFFSGPIPPALGNATALFLLKLANNSLSGPIPEELTNLTFLSIFNVSNNDL 490

[120][TOP]
>UniRef100_Q69KD0 Putative uncharacterized protein n=2 Tax=Oryza sativa
           RepID=Q69KD0_ORYSJ
          Length = 605

 Score =  109 bits (272), Expect = 1e-22
 Identities = 75/173 (43%), Positives = 101/173 (58%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L+  +P  FG  + L +L L+SN  SG++P  +L     L  +DL  N  +G +P+SL +
Sbjct: 162 LQGSIPSAFGDLTELRTLILTSNRLSGDIPQ-SLGSNLSLTYVDLGRNALAGRIPQSLAS 220

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S SL  L L+SN  SG  LP    N  ++L  L LQ N F G IPP  +   ++  L L
Sbjct: 221 -STSLQFLILTSNTLSGE-LPKALLN-SSSLIFLDLQQNNFVGSIPPVTAISPKMYYLDL 277

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            FN+L+GTIPSSLG+LS L  L L  N L G IP  L +V TLETL ++ N+L
Sbjct: 278 RFNHLTGTIPSSLGNLSSLTYLCLIGNNLVGSIPDTLGHVPTLETLAVNVNNL 330

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 57/172 (33%), Positives = 92/172 (53%), Gaps = 3/172 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG---ELPESLTNL 199
           +P    + S L+ L L++N+F+G +P      ++ L++LD+++N           SLTN 
Sbjct: 383 IPSSLLNASHLQRLFLTNNSFTGHIPF--FGSLQNLEILDMAYNMLEAGDWSFVSSLTNC 440

Query: 200 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           S  L  L L  NN  G  LP+   N  ++L+ L+L+NN  +G IPP + N   L +L++ 
Sbjct: 441 S-KLTQLLLDGNNLQGN-LPSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLKSLNTLYMD 498

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            NYL+G IP ++G L  +  L +  N L G IP  + Y+ ++  L    N L
Sbjct: 499 DNYLTGNIPPTIGYLHNMNKLYMDYNYLTGNIPPTIGYLHSMVFLSFSHNRL 550

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 60/163 (36%), Positives = 81/163 (49%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +CS L  L L  NN  G LP         L+ L L  N  SG +P  + NL  SL TL +
Sbjct: 439 NCSKLTQLLLDGNNLQGNLPSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLK-SLNTLYM 497

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
             N  +G I P +     + + +LY+  N  TG IPPT+     +V L  S N LSG IP
Sbjct: 498 DDNYLTGNIPPTI--GYLHNMNKLYMDYNYLTGNIPPTIGYLHSMVFLSFSHNRLSGQIP 555

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            ++G+L +L +L+L  N L G IP  + +   L  L L  N L
Sbjct: 556 GTIGNLVQLNELRLDENNLSGSIPASIRHCTQLTKLNLAHNSL 598

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 63/172 (36%), Positives = 90/172 (52%), Gaps = 3/172 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L  L L  NN  G +P DTL  +  L+ L ++ N  SG +P S+ N++ S
Sbjct: 286 IPSSLGNLSSLTYLCLIGNNLVGSIP-DTLGHVPTLETLAVNVNNLSGPVPPSIFNVT-S 343

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L +++N+ +G +  N+     N +Q+L L NN F+G IP +L N S L  L L+ N 
Sbjct: 344 LTYLGMANNSLTGRLPSNIGYTLPN-IQQLILPNNKFSGSIPSSLLNASHLQRLFLTNNS 402

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEG---EIPQELMYVKTLETLILDFNDL 535
            +G IP   GSL  L  L +  NMLE         L     L  L+LD N+L
Sbjct: 403 FTGHIP-FFGSLQNLEILDMAYNMLEAGDWSFVSSLTNCSKLTQLLLDGNNL 453

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 60/157 (38%), Positives = 79/157 (50%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           +L LSS   +G +    +  +  L  L LS N F G +P  L  L+  L  L++S N+  
Sbjct: 82  ALDLSSEGITGSIS-PCIANLTYLTKLQLSNNSFYGSIPSELGFLT-QLSILNISMNSLE 139

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I   L    K  LQ++ L NN   G IP    + +EL +L L+ N LSG IP SLGS 
Sbjct: 140 GNIPSELTSCFK--LQKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRLSGDIPQSLGSN 197

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  + L  N L G IPQ L    +L+ LIL  N L
Sbjct: 198 LSLTYVDLGRNALAGRIPQSLASSTSLQFLILTSNTL 234

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 46/115 (40%), Positives = 57/115 (49%)
 Frame = +2

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           T     +  LDLSS   +G I P  C      L +L L NN F G IP  L   ++L  L
Sbjct: 74  TQYPRRVTALDLSSEGITGSISP--CIANLTYLTKLQLSNNSFYGSIPSELGFLTQLSIL 131

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++S N L G IPS L S  KL+ + L  N L+G IP     +  L TLIL  N L
Sbjct: 132 NISMNSLEGNIPSELTSCFKLQKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRL 186

[121][TOP]
>UniRef100_Q9ARF3 Putative uncharacterized protein n=1 Tax=Capsella rubella
           RepID=Q9ARF3_9BRAS
          Length = 1166

 Score =  108 bits (271), Expect = 2e-22
 Identities = 68/170 (40%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP  F +C  L++L + +N  SG+     + K+  +  L ++FN  SG +P SLTN + +
Sbjct: 318 LPSQFTACVWLQNLNIGNNYLSGDFLSTVVSKITRITYLYVAFNNISGSVPISLTNCT-N 376

Query: 209 LLTLDLSSNNFSGPILPNLC-QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           L  LDLSSN F+G +   LC Q     L++L + NN  +G +P  L  C  L ++ LSFN
Sbjct: 377 LRVLDLSSNGFTGNVPSGLCSQQSSPVLEKLLIANNYLSGTVPVELGKCKSLKTIDLSFN 436

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK--TLETLILDFN 529
            L+G IP  +  L  L DL +W N L G IP E + VK   LET+IL+ N
Sbjct: 437 ELTGPIPKDVWMLPNLSDLVMWANNLTGSIP-EGVCVKGGKLETIILNNN 485

 Score =  104 bits (260), Expect = 4e-21
 Identities = 63/163 (38%), Positives = 100/163 (61%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           S  +LE L +++N  SG +P++ L K + LK +DLSFNE +G +P+ +  L  +L  L +
Sbjct: 400 SSPVLEKLLIANNYLSGTVPVE-LGKCKSLKTIDLSFNELTGPIPKDVWMLP-NLSDLVM 457

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            +NN +G I   +C      L+ + L NN  TG IP ++S C+ ++ + LS N L+G IP
Sbjct: 458 WANNLTGSIPEGVCVKG-GKLETIILNNNLLTGSIPQSISRCTNMIWISLSSNRLTGKIP 516

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           + +G+LSKL  L+L  N L G +P++L   K+L  L L+ N+L
Sbjct: 517 TGIGNLSKLAILQLGNNSLSGNVPRQLGNCKSLIWLDLNSNNL 559

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 71/217 (32%), Positives = 96/217 (44%), Gaps = 52/217 (23%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSG-----ELP----MDTLL-----------------KMRGLKV 142
           FG C  L   +LS NN SG      LP    ++TL                    + LK 
Sbjct: 222 FGMCGNLSFFSLSQNNISGVKFPISLPNCRFLETLNISRNNLAGKIPGGEYWGSFQNLKQ 281

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI---------LPNL---------- 265
           L L+ N FSGE+P  L+ L  +L TLDLS N  SG +         L NL          
Sbjct: 282 LSLAHNRFSGEIPPELSLLCKTLETLDLSGNALSGELPSQFTACVWLQNLNIGNNYLSGD 341

Query: 266 ----CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK- 430
                 +    +  LY+  N  +G +P +L+NC+ L  L LS N  +G +PS L S    
Sbjct: 342 FLSTVVSKITRITYLYVAFNNISGSVPISLTNCTNLRVLDLSSNGFTGNVPSGLCSQQSS 401

Query: 431 --LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L  L +  N L G +P EL   K+L+T+ L FN+L
Sbjct: 402 PVLEKLLIANNYLSGTVPVELGKCKSLKTIDLSFNEL 438

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 44/142 (30%), Positives = 72/142 (50%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F  L  P+P        L  L + +NN +G +P    +K   L+ + L+ N  +G +P+S
Sbjct: 435 FNELTGPIPKDVWMLPNLSDLVMWANNLTGSIPEGVCVKGGKLETIILNNNLLTGSIPQS 494

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           ++  + +++ + LSSN  +G I   +    K  L  L L NN  +G +P  L NC  L+ 
Sbjct: 495 ISRCT-NMIWISLSSNRLTGKIPTGIGNLSK--LAILQLGNNSLSGNVPRQLGNCKSLIW 551

Query: 368 LHLSFNYLSGTIPSSLGSLSKL 433
           L L+ N L+G +P  L S + L
Sbjct: 552 LDLNSNNLTGDLPGELASQAGL 573

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 56/167 (33%), Positives = 74/167 (44%), Gaps = 4/167 (2%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKM-RGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           S   L ++  S N  S ++P   + +    LK LDL+ N FSG+  +    +  +L    
Sbjct: 173 SLKSLTTVDFSYNILSEKIPESFISEFPASLKYLDLTHNNFSGDFSDLSFGMCGNLSFFS 232

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           LS NN SG                          K P +L NC  L +L++S N L+G I
Sbjct: 233 LSQNNISGV-------------------------KFPISLPNCRFLETLNISRNNLAGKI 267

Query: 404 PSS--LGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFNDL 535
           P     GS   L+ L L  N   GEIP EL +  KTLETL L  N L
Sbjct: 268 PGGEYWGSFQNLKQLSLAHNRFSGEIPPELSLLCKTLETLDLSGNAL 314

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 63/199 (31%), Positives = 80/199 (40%), Gaps = 44/199 (22%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN----------- 160
            SL   +P   G+C  L  L L+SNN +G+LP + L    GL V+  S +           
Sbjct: 534  SLSGNVPRQLGNCKSLIWLDLNSNNLTGDLPGE-LASQAGL-VMPGSVSGKQFAFVRNEG 591

Query: 161  -----------EFSGELPESLTNL----------------------SASLLTLDLSSNNF 241
                       EF G   E L                         + S++  D+S N  
Sbjct: 592  GTDCRGAGGLVEFEGIRAERLERFPMVHSCPATRIYSGMTMYTFSANGSMIYFDISYNAV 651

Query: 242  SGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 421
            SG I P         LQ L L +N  TG IP +L     +  L LS N L G +P SLGS
Sbjct: 652  SGLIPPGY--GNMGYLQVLNLGHNRITGNIPDSLGGLKAIGVLDLSHNDLQGYLPGSLGS 709

Query: 422  LSKLRDLKLWLNMLEGEIP 478
            LS L DL +  N L G IP
Sbjct: 710  LSFLSDLDVSNNNLTGPIP 728

[122][TOP]
>UniRef100_Q01KJ6 H0404F02.1 protein n=1 Tax=Oryza sativa RepID=Q01KJ6_ORYSA
          Length = 1157

 Score =  108 bits (271), Expect = 2e-22
 Identities = 71/169 (42%), Positives = 96/169 (56%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  F S   L  L LS N+F+G +P  T   +  L+VL  S N   G+LP  L N S +
Sbjct: 553  VPEGFSSLWSLRHLNLSVNSFTGSMPA-TYGYLPSLQVLSASHNRICGKLPVELANCS-N 610

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  LDL SN  +GPI  +  +     L+EL L +N  + KIPP +SNCS LV+L L  N+
Sbjct: 611  LTVLDLRSNQLTGPIPGDFAR--LGELEELDLSHNQLSRKIPPEISNCSSLVTLKLDDNH 668

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L G IP+SL +LSKL+ L L  N L G IP  L  +  + +L +  N+L
Sbjct: 669  LGGEIPASLSNLSKLQTLDLSSNNLTGSIPASLAQIPGMLSLNVSHNEL 717

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 70/194 (36%), Positives = 98/194 (50%), Gaps = 25/194 (12%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF----------------- 157
            +PP  G+ + L+SL LS N+FSG +P + +  +  L+VLDLS                  
Sbjct: 480  IPPSIGNLAALQSLNLSGNSFSGRIPSN-IGNLLNLRVLDLSGQKNLSGNLPAELFGLPQ 538

Query: 158  --------NEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
                    N FSG++PE  ++L  SL  L+LS N+F+G +       P  +LQ L   +N
Sbjct: 539  LQYVSLAGNSFSGDVPEGFSSL-WSLRHLNLSVNSFTGSMPATYGYLP--SLQVLSASHN 595

Query: 314  GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
               GK+P  L+NCS L  L L  N L+G IP     L +L +L L  N L  +IP E+  
Sbjct: 596  RICGKLPVELANCSNLTVLDLRSNQLTGPIPGDFARLGELEELDLSHNQLSRKIPPEISN 655

Query: 494  VKTLETLILDFNDL 535
              +L TL LD N L
Sbjct: 656  CSSLVTLKLDDNHL 669

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 65/168 (38%), Positives = 88/168 (52%), Gaps = 1/168 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C  L+ L L  N FSGE+P   L  +R L+ + L  N FSG++P SL NLS  
Sbjct: 384 VPAEIGRCGALQVLDLEDNRFSGEVPA-ALGGLRRLREVYLGGNSFSGQIPASLGNLSW- 441

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L    N  +G +   L       L  L L +N   G+IPP++ N + L SL+LS N 
Sbjct: 442 LEALSTPGNRLTGDLPSELFV--LGNLTFLDLSDNKLAGEIPPSIGNLAALQSLNLSGNS 499

Query: 389 LSGTIPSSLGSLSKLRDLKL-WLNMLEGEIPQELMYVKTLETLILDFN 529
            SG IPS++G+L  LR L L     L G +P EL  +  L+ + L  N
Sbjct: 500 FSGRIPSNIGNLLNLRVLDLSGQKNLSGNLPAELFGLPQLQYVSLAGN 547

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 69/197 (35%), Positives = 95/197 (48%), Gaps = 22/197 (11%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES- 187
           L L   + P   S   LE L+L SN+ SG +P  +L ++  L+ + L +N  SG +P+S 
Sbjct: 88  LRLSGAISPALSSLVYLEKLSLRSNSLSGTIPA-SLSRISSLRAVYLQYNSLSGPIPQSF 146

Query: 188 ---LTNLSA------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 304
              LTNL                    SL  LDLSSN FSG I  N+  +   +LQ L L
Sbjct: 147 LANLTNLQTFDVSGNLLSGPVPVSFPPSLKYLDLSSNAFSGTIPANVSASA-TSLQFLNL 205

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
             N   G +P +L    +L  L L  N L GTIPS+L + S L  L L  N L G +P  
Sbjct: 206 SFNRLRGTVPASLGTLQDLHYLWLDGNLLEGTIPSALSNCSALLHLSLQGNALRGILPPA 265

Query: 485 LMYVKTLETLILDFNDL 535
           +  + +L+ L +  N L
Sbjct: 266 VAAIPSLQILSVSRNRL 282

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 62/168 (36%), Positives = 85/168 (50%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P P +      L  L LS N F+GE+P   + ++  L+ L L  N F+G +P  +    A
Sbjct: 335 PFPSWLAGAGGLTVLDLSGNAFTGEVP-PVVGQLTALQELRLGGNAFTGTVPAEIGRCGA 393

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  LDL  N FSG +   L       L+E+YL  N F+G+IP +L N S L +L    N
Sbjct: 394 -LQVLDLEDNRFSGEVPAAL--GGLRRLREVYLGGNSFSGQIPASLGNLSWLEALSTPGN 450

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L+G +PS L  L  L  L L  N L GEIP  +  +  L++L L  N
Sbjct: 451 RLTGDLPSELFVLGNLTFLDLSDNKLAGEIPPSIGNLAALQSLNLSGN 498

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 62/194 (31%), Positives = 90/194 (46%), Gaps = 25/194 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELP------------------------MDTLLKM-RG 133
           LPP   +   L+ L++S N  +G +P                        +D  + + + 
Sbjct: 262 LPPAVAAIPSLQILSVSRNRLTGAIPAAAFGGVGNSSLRIVQVGGNAFSQVDVPVSLGKD 321

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
           L+V+DL  N+ +G  P  L   +  L  LDLS N F+G + P + Q     LQEL L  N
Sbjct: 322 LQVVDLRANKLAGPFPSWLAG-AGGLTVLDLSGNAFTGEVPPVVGQ--LTALQELRLGGN 378

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            FTG +P  +  C  L  L L  N  SG +P++LG L +LR++ L  N   G+IP  L  
Sbjct: 379 AFTGTVPAEIGRCGALQVLDLEDNRFSGEVPAALGGLRRLREVYLGGNSFSGQIPASLGN 438

Query: 494 VKTLETLILDFNDL 535
           +  LE L    N L
Sbjct: 439 LSWLEALSTPGNRL 452

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 60/159 (37%), Positives = 84/159 (52%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ + L +N  +G  P   L    GL VLDLS N F+GE+P  +  L+A L  L L  N 
Sbjct: 322 LQVVDLRANKLAGPFP-SWLAGAGGLTVLDLSGNAFTGEVPPVVGQLTA-LQELRLGGNA 379

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           F+G +   + +     LQ L L++N F+G++P  L     L  ++L  N  SG IP+SLG
Sbjct: 380 FTGTVPAEIGRC--GALQVLDLEDNRFSGEVPAALGGLRRLREVYLGGNSFSGQIPASLG 437

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +LS L  L    N L G++P EL  +  L  L L  N L
Sbjct: 438 NLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKL 476

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 54/131 (41%), Positives = 76/131 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    +CS L  L L SN  +G +P D   ++  L+ LDLS N+ S ++P  ++N S S
Sbjct: 601 LPVELANCSNLTVLDLRSNQLTGPIPGD-FARLGELEELDLSHNQLSRKIPPEISNCS-S 658

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+TL L  N+  G I  +L    K  LQ L L +N  TG IP +L+    ++SL++S N 
Sbjct: 659 LVTLKLDDNHLGGEIPASLSNLSK--LQTLDLSSNNLTGSIPASLAQIPGMLSLNVSHNE 716

Query: 389 LSGTIPSSLGS 421
           LSG IP+ LGS
Sbjct: 717 LSGEIPAMLGS 727

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 58/159 (36%), Positives = 84/159 (52%), Gaps = 4/159 (2%)
 Frame = +2

Query: 14  SLELPLPP-FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           SL  P+P  F  + + L++  +S N  SG +P+        LK LDLS N FSG +P ++
Sbjct: 137 SLSGPIPQSFLANLTNLQTFDVSGNLLSGPVPVSF---PPSLKYLDLSSNAFSGTIPANV 193

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY---LQNNGFTGKIPPTLSNCSEL 361
           +  + SL  L+LS N   G +  +L      TLQ+L+   L  N   G IP  LSNCS L
Sbjct: 194 SASATSLQFLNLSFNRLRGTVPASL-----GTLQDLHYLWLDGNLLEGTIPSALSNCSAL 248

Query: 362 VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           + L L  N L G +P ++ ++  L+ L +  N L G IP
Sbjct: 249 LHLSLQGNALRGILPPAVAAIPSLQILSVSRNRLTGAIP 287

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 45/118 (38%), Positives = 60/118 (50%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L LSSN FSG +P +       L+ L+LSFN   G +P SL  L   L  L L  N 
Sbjct: 175 LKYLDLSSNAFSGTIPANVSASATSLQFLNLSFNRLRGTVPASLGTLQ-DLHYLWLDGNL 233

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
             G I P+   N  + L  L LQ N   G +PP ++    L  L +S N L+G IP++
Sbjct: 234 LEGTI-PSALSNC-SALLHLSLQGNALRGILPPAVAAIPSLQILSVSRNRLTGAIPAA 289

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 38/113 (33%), Positives = 58/113 (51%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L   +PP   +CS L +L L  N+  GE+P  +L  +  L+ LDLS N  +G +P SL  
Sbjct: 645 LSRKIPPEISNCSSLVTLKLDDNHLGGEIPA-SLSNLSKLQTLDLSSNNLTGSIPASLAQ 703

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS 355
           +   +L+L++S N  SG I P +  +   T   ++  N    G  PP  + CS
Sbjct: 704 I-PGMLSLNVSHNELSGEI-PAMLGSRFGT-PSVFASNPNLCG--PPLENECS 751

[123][TOP]
>UniRef100_B9GRD1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GRD1_POPTR
          Length = 1019

 Score =  108 bits (271), Expect = 2e-22
 Identities = 73/197 (37%), Positives = 106/197 (53%), Gaps = 23/197 (11%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES-- 187
           +LE  LP   G+ + L+ L LS NN SGE+P + ++ ++ L++L+L  N+ SG +P    
Sbjct: 279 NLEGKLPAAIGNITSLQLLDLSDNNLSGEIPAE-IVNLKNLQLLNLMSNQLSGSIPAGVG 337

Query: 188 -LTNLS--------------------ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 304
            LT LS                    + L  LD+SSN+ SG I  +LC      L +L L
Sbjct: 338 GLTQLSVLELWSNSLSGPLPRDLGKNSPLQWLDVSSNSLSGEIPASLCNG--GNLTKLIL 395

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
            NN F+G IP +LS C  LV + +  N+LSG IP  LG L KL+ L+L  N L G+IP +
Sbjct: 396 FNNSFSGPIPDSLSTCFSLVRVRMQNNFLSGAIPVGLGKLGKLQRLELANNSLTGQIPID 455

Query: 485 LMYVKTLETLILDFNDL 535
           L +  +L  + +  N L
Sbjct: 456 LAFSSSLSFIDISRNRL 472

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 63/159 (39%), Positives = 89/159 (55%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ + +S N F G  P+  L +  GL +L+ S N FSG +PE L N + SL TLDL  + 
Sbjct: 126 LKDIDVSQNLFIGSFPVG-LGRAAGLTLLNASSNNFSGIIPEDLGN-ATSLETLDLRGSF 183

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
           F G I P   +N +  L+ L L  N  TG++P  L   S L  + + +N   G IP+  G
Sbjct: 184 FEGSI-PKSFRNLRK-LKFLGLSGNSLTGQLPAELGLLSSLEKIIIGYNEFEGGIPAEFG 241

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +L+ L+ L L +  L GEIP EL  +K LET+ L  N+L
Sbjct: 242 NLTNLKYLDLAIGNLSGEIPAELGRLKALETVFLYQNNL 280

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 61/168 (36%), Positives = 88/168 (52%)
 Frame = +2

Query: 32  PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
           P   G  + L  L  SSNNFSG +P D L     L+ LDL  + F G +P+S  NL   L
Sbjct: 141 PVGLGRAAGLTLLNASSNNFSGIIPED-LGNATSLETLDLRGSFFEGSIPKSFRNLR-KL 198

Query: 212 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             L LS N+ +G +   L     ++L+++ +  N F G IP    N + L  L L+   L
Sbjct: 199 KFLGLSGNSLTGQLPAEL--GLLSSLEKIIIGYNEFEGGIPAEFGNLTNLKYLDLAIGNL 256

Query: 392 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           SG IP+ LG L  L  + L+ N LEG++P  +  + +L+ L L  N+L
Sbjct: 257 SGEIPAELGRLKALETVFLYQNNLEGKLPAAIGNITSLQLLDLSDNNL 304

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 59/169 (34%), Positives = 88/169 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  F +   L+ L LS N+ +G+LP +  L +  L+ + + +NEF G +P    NL+ +
Sbjct: 188 IPKSFRNLRKLKFLGLSGNSLTGQLPAELGL-LSSLEKIIIGYNEFEGGIPAEFGNLT-N 245

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDL+  N SG I   L +     L+ ++L  N   GK+P  + N + L  L LS N 
Sbjct: 246 LKYLDLAIGNLSGEIPAELGR--LKALETVFLYQNNLEGKLPAAIGNITSLQLLDLSDNN 303

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP+ + +L  L+ L L  N L G IP  +  +  L  L L  N L
Sbjct: 304 LSGEIPAEIVNLKNLQLLNLMSNQLSGSIPAGVGGLTQLSVLELWSNSL 352

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 59/170 (34%), Positives = 90/170 (52%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    +C  L  + + +N  SG +P+  L K+  L+ L+L+ N  +G++P  L   S+
Sbjct: 403 PIPDSLSTCFSLVRVRMQNNFLSGAIPVG-LGKLGKLQRLELANNSLTGQIPIDLA-FSS 460

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SL  +D+S N      LP+   + +N LQ     NN   G+IP    +   L +L LS N
Sbjct: 461 SLSFIDISRNRLRSS-LPSTVLSIQN-LQTFMASNNNLEGEIPDQFQDRPSLSALDLSSN 518

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           + SG+IP+S+ S  KL +L L  N L GEIP+ +  +  L  L L  N L
Sbjct: 519 HFSGSIPASIASCEKLVNLNLKNNRLTGEIPKAVAMMPALAVLDLSNNSL 568

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 55/173 (31%), Positives = 84/173 (48%), Gaps = 23/173 (13%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMD-----------------------TLLKMRGLK 139
           +P   G    L+ L L++N+ +G++P+D                       T+L ++ L+
Sbjct: 428 IPVGLGKLGKLQRLELANNSLTGQIPIDLAFSSSLSFIDISRNRLRSSLPSTVLSIQNLQ 487

Query: 140 VLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
               S N   GE+P+   +   SL  LDLSSN+FSG I  ++    K  L  L L+NN  
Sbjct: 488 TFMASNNNLEGEIPDQFQD-RPSLSALDLSSNHFSGSIPASIASCEK--LVNLNLKNNRL 544

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           TG+IP  ++    L  L LS N L+G +P + GS   L  L +  N L+G +P
Sbjct: 545 TGEIPKAVAMMPALAVLDLSNNSLTGGLPENFGSSPALEMLNVSYNKLQGPVP 597

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 45/132 (34%), Positives = 65/132 (49%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L   LP    S   L++   S+NN  GE+P D       L  LDLS N FSG +P S+ +
Sbjct: 472 LRSSLPSTVLSIQNLQTFMASNNNLEGEIP-DQFQDRPSLSALDLSSNHFSGSIPASIAS 530

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
               L+ L+L +N  +G I   +   P   L  L L NN  TG +P    +   L  L++
Sbjct: 531 CE-KLVNLNLKNNRLTGEIPKAVAMMP--ALAVLDLSNNSLTGGLPENFGSSPALEMLNV 587

Query: 377 SFNYLSGTIPSS 412
           S+N L G +P++
Sbjct: 588 SYNKLQGPVPAN 599

[124][TOP]
>UniRef100_A7NUG0 Chromosome chr18 scaffold_1, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7NUG0_VITVI
          Length = 874

 Score =  108 bits (271), Expect = 2e-22
 Identities = 70/169 (41%), Positives = 98/169 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  + SCS L    +++N+ SG +P   +  +  + ++D++ N  SGELP  ++  S S
Sbjct: 303 IPVTYASCSTLTRFRVNNNSLSGTVPAG-IWGLPNVNIIDITMNALSGELPVEISKAS-S 360

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+++DLS+N FS  I P      KN L  L+LQNN F+G IP  L +C  L  L+++ N 
Sbjct: 361 LVSIDLSNNQFSREI-PATIGELKN-LGSLHLQNNMFSGSIPKELGSCDSLSDLNIAHNL 418

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IPSSLGSL  L  L L  N L GEIP  L  ++ L  L L  N L
Sbjct: 419 LSGKIPSSLGSLPTLNSLNLSENQLSGEIPASLSSLR-LSLLDLSHNRL 466

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 57/157 (36%), Positives = 93/157 (59%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L SL L  N+FSG++P +   + R L  L L  N+ SG +P+ L +  A    +D+S N+
Sbjct: 217 LVSLQLFENSFSGQIP-EEFGEFRRLVNLSLFSNKLSGPIPQKLGSW-ADFDYIDVSENS 274

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +GPI P++C+N K  ++EL +  N FTG+IP T ++CS L    ++ N LSGT+P+ + 
Sbjct: 275 LTGPIPPDMCKNGK--MKELLMLQNKFTGEIPVTYASCSTLTRFRVNNNSLSGTVPAGIW 332

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L  +  + + +N L GE+P E+    +L ++ L  N
Sbjct: 333 GLPNVNIIDITMNALSGELPVEISKASSLVSIDLSNN 369

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 58/169 (34%), Positives = 85/169 (50%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           S+   LPP  G+ + L +L LS N  SGE+P + + K+  L  L+L  NE +G++P    
Sbjct: 131 SINGTLPPEIGNLNKLINLELSDNYLSGEIPAE-IGKLSKLWQLELYANELTGKIPVGFR 189

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL+ +L   D S NN  G +         N L  L L  N F+G+IP        LV+L 
Sbjct: 190 NLT-NLENFDASDNNLEGDLSE---LRFLNQLVSLQLFENSFSGQIPEEFGEFRRLVNLS 245

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
           L  N LSG IP  LGS +    + +  N L G IP ++     ++ L++
Sbjct: 246 LFSNKLSGPIPQKLGSWADFDYIDVSENSLTGPIPPDMCKNGKMKELLM 294

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 50/159 (31%), Positives = 75/159 (47%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           +  + LS+   SG +P++++ ++  L+ L L FN   G +   L                
Sbjct: 72  VREIELSNQRLSGVVPLESICQLESLEKLSLGFNFLQGTISGDL---------------- 115

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
                  N C    N L   YL N    G +PP + N ++L++L LS NYLSG IP+ +G
Sbjct: 116 -------NKCLYDLNWL---YLSNCSINGTLPPEIGNLNKLINLELSDNYLSGEIPAEIG 165

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSKL  L+L+ N L G+IP     +  LE      N+L
Sbjct: 166 KLSKLWQLELYANELTGKIPVGFRNLTNLENFDASDNNL 204

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 59/169 (34%), Positives = 80/169 (47%), Gaps = 2/169 (1%)
 Frame = +2

Query: 35  PFFGSCSL--LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P    C L  LE L+L  N   G +  D    +  L  L LS    +G LP  + NL+  
Sbjct: 87  PLESICQLESLEKLSLGFNFLQGTISGDLNKCLYDLNWLYLSNCSINGTLPPEIGNLN-K 145

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L+LS N  SG I   + +  K  L +L L  N  TGKIP    N + L +   S N 
Sbjct: 146 LINLELSDNYLSGEIPAEIGKLSK--LWQLELYANELTGKIPVGFRNLTNLENFDASDNN 203

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G + S L  L++L  L+L+ N   G+IP+E    + L  L L  N L
Sbjct: 204 LEGDL-SELRFLNQLVSLQLFENSFSGQIPEEFGEFRRLVNLSLFSNKL 251

[125][TOP]
>UniRef100_A2ZFH5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2ZFH5_ORYSI
          Length = 1070

 Score =  108 bits (271), Expect = 2e-22
 Identities = 68/168 (40%), Positives = 97/168 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + L SL L +N FSGE+P  T+  +  L  L+L+ N F+G +P  L N+ + 
Sbjct: 474 VPLAIGNLTKLSSLELQANAFSGEIP-STVANLTKLSALNLARNNFTGAIPRRLFNILSL 532

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              LDLS NN  G I P    N  N L+E + Q+N  +G+IPP+L  C  L +++L  N+
Sbjct: 533 SKILDLSHNNLEGSI-PQEIGNLIN-LEEFHAQSNILSGEIPPSLGECQLLQNVYLQNNF 590

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L+GTI S+LG L  L  L L  N L G+IP+ L  +  L  L L FN+
Sbjct: 591 LNGTISSALGQLKGLESLDLSNNKLSGQIPRFLGNISMLSYLNLSFNN 638

 Score =  101 bits (252), Expect = 3e-20
 Identities = 63/158 (39%), Positives = 90/158 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G    LE++ L++N   G LP+ +L     L VL+L+ N+  GE+P ++     +
Sbjct: 128 IPPEIGRLGRLETVNLAANALQGTLPL-SLGNCTNLMVLNLTSNQLQGEIPSTIGARMVN 186

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDL  N FSG I  +L + P  +++ L+L +N  +G+IP  LSN S L+ L L  N 
Sbjct: 187 LYMLDLRQNGFSGEIPLSLAELP--SMEFLFLYSNKLSGEIPTALSNLSGLMHLDLDTNM 244

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           LSG IPSSLG LS L  L L  N L G IP  +  + +
Sbjct: 245 LSGAIPSSLGKLSSLIWLNLANNNLSGTIPSSIWNISS 282

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 55/159 (34%), Positives = 87/159 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S L  L L +N  SG +P  +L K+  L  L+L+ N  SG +P S+ N+S+S
Sbjct: 225 IPTALSNLSGLMHLDLDTNMLSGAIP-SSLGKLSSLIWLNLANNNLSGTIPSSIWNISSS 283

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L++  NN  G ++P         L+ + + NN F G++P +L N S +  L L FN+
Sbjct: 284 LWGLNIQQNNLVG-VVPTDAFTALPELRTISMDNNRFHGRLPTSLVNVSHVSMLQLGFNF 342

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            SGT+PS LG L  L    L+  +LE + P++  ++  L
Sbjct: 343 FSGTVPSELGMLKNLEQFLLFATLLEAKEPRDWEFITAL 381

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 63/169 (37%), Positives = 94/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           + PF  + S L  L L+ N  +GE+P + + ++  L+ ++L+ N   G LP SL N + +
Sbjct: 104 ISPFLANLSFLRELDLAGNQLAGEIPPE-IGRLGRLETVNLAANALQGTLPLSLGNCT-N 161

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L+L+SN   G I   +     N L  L L+ NGF+G+IP +L+    +  L L  N 
Sbjct: 162 LMVLNLTSNQLQGEIPSTIGARMVN-LYMLDLRQNGFSGEIPLSLAELPSMEFLFLYSNK 220

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP++L +LS L  L L  NML G IP  L  + +L  L L  N+L
Sbjct: 221 LSGEIPTALSNLSGLMHLDLDTNMLSGAIPSSLGKLSSLIWLNLANNNL 269

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 62/169 (36%), Positives = 85/169 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP   G    L  L++  N  SG +P+  +  +  L  L+L  N FSGE+P ++ NL+  
Sbjct: 450 LPSSLGRLQNLNLLSVPKNKISGSVPL-AIGNLTKLSSLELQANAFSGEIPSTVANLT-K 507

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+L+ NNF+G I P    N  +  + L L +N   G IP  + N   L   H   N 
Sbjct: 508 LSALNLARNNFTGAI-PRRLFNILSLSKILDLSHNNLEGSIPQEIGNLINLEEFHAQSNI 566

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP SLG    L+++ L  N L G I   L  +K LE+L L  N L
Sbjct: 567 LSGEIPPSLGECQLLQNVYLQNNFLNGTISSALGQLKGLESLDLSNNKL 615

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 69/174 (39%), Positives = 94/174 (54%), Gaps = 2/174 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L+  LP   G+C+ L  L L+SN   GE+P     +M  L +LDL  N FSGE+P SL 
Sbjct: 147 ALQGTLPLSLGNCTNLMVLNLTSNQLQGEIPSTIGARMVNLYMLDLRQNGFSGEIPLSLA 206

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            L  S+  L L SN  SG I P    N  + L  L L  N  +G IP +L   S L+ L+
Sbjct: 207 EL-PSMEFLFLYSNKLSGEI-PTALSN-LSGLMHLDLDTNMLSGAIPSSLGKLSSLIWLN 263

Query: 374 LSFNYLSGTIPSSLGSL-SKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDFN 529
           L+ N LSGTIPSS+ ++ S L  L +  N L G +P +    +  L T+ +D N
Sbjct: 264 LANNNLSGTIPSSIWNISSSLWGLNIQQNNLVGVVPTDAFTALPELRTISMDNN 317

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 60/152 (39%), Positives = 78/152 (51%), Gaps = 2/152 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + + L +L L+ NNF+G +P      +   K+LDLS N   G +P+ + NL  +
Sbjct: 498 IPSTVANLTKLSALNLARNNFTGAIPRRLFNILSLSKILDLSHNNLEGSIPQEIGNL-IN 556

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           L      SN  SG I P+L  CQ     LQ +YLQNN   G I   L     L SL LS 
Sbjct: 557 LEEFHAQSNILSGEIPPSLGECQ----LLQNVYLQNNFLNGTISSALGQLKGLESLDLSN 612

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           N LSG IP  LG++S L  L L  N   GE+P
Sbjct: 613 NKLSGQIPRFLGNISMLSYLNLSFNNFSGEVP 644

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 62/178 (34%), Positives = 86/178 (48%), Gaps = 10/178 (5%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMD-----TLLKMRGLKVLDLSFNEFSGELPESLT 193
           +P   G    LE   L +     + P D      L     LK+L+L  + F G LP+SL+
Sbjct: 347 VPSELGMLKNLEQFLLFATLLEAKEPRDWEFITALTNCSRLKILELGASRFGGVLPDSLS 406

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNT-----LQELYLQNNGFTGKIPPTLSNCSE 358
           NLS SL TL L  N  SG I       PK+      LQ L L +N F G +P +L     
Sbjct: 407 NLSTSLQTLSLQYNTISGHI-------PKDIGNLIGLQSLTLDDNSFIGTLPSSLGRLQN 459

Query: 359 LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L  L +  N +SG++P ++G+L+KL  L+L  N   GEIP  +  +  L  L L  N+
Sbjct: 460 LNLLSVPKNKISGSVPLAIGNLTKLSSLELQANAFSGEIPSTVANLTKLSALNLARNN 517

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 59/155 (38%), Positives = 85/155 (54%), Gaps = 1/155 (0%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           +E L L SN  SGE+P   L  + GL  LDL  N  SG +P SL  LS SL+ L+L++NN
Sbjct: 211 MEFLFLYSNKLSGEIPT-ALSNLSGLMHLDLDTNMLSGAIPSSLGKLS-SLIWLNLANNN 268

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP-TLSNCSELVSLHLSFNYLSGTIPSSL 415
            SG I P+   N  ++L  L +Q N   G +P    +   EL ++ +  N   G +P+SL
Sbjct: 269 LSGTI-PSSIWNISSSLWGLNIQQNNLVGVVPTDAFTALPELRTISMDNNRFHGRLPTSL 327

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
            ++S +  L+L  N   G +P EL  +K LE  +L
Sbjct: 328 VNVSHVSMLQLGFNFFSGTVPSELGMLKNLEQFLL 362

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 59/186 (31%), Positives = 85/186 (45%), Gaps = 29/186 (15%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL---TNLSASLL----- 214
           L ++++ +N F G LP  +L+ +  + +L L FN FSG +P  L    NL   LL     
Sbjct: 309 LRTISMDNNRFHGRLPT-SLVNVSHVSMLQLGFNFFSGTVPSELGMLKNLEQFLLFATLL 367

Query: 215 ---------------------TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI 331
                                 L+L ++ F G +LP+   N   +LQ L LQ N  +G I
Sbjct: 368 EAKEPRDWEFITALTNCSRLKILELGASRFGG-VLPDSLSNLSTSLQTLSLQYNTISGHI 426

Query: 332 PPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLET 511
           P  + N   L SL L  N   GT+PSSLG L  L  L +  N + G +P  +  +  L +
Sbjct: 427 PKDIGNLIGLQSLTLDDNSFIGTLPSSLGRLQNLNLLSVPKNKISGSVPLAIGNLTKLSS 486

Query: 512 LILDFN 529
           L L  N
Sbjct: 487 LELQAN 492

[126][TOP]
>UniRef100_UPI000198449F PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI000198449F
          Length = 1519

 Score =  108 bits (270), Expect = 2e-22
 Identities = 67/169 (39%), Positives = 93/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C  LE ++LS N F G +P   +  +  L+VL L  N   GE+P++L NLS S
Sbjct: 237 IPTSLGKCGRLEEISLSFNEFMGSIPRG-IGSLSVLEVLYLGSNNLEGEIPQTLFNLS-S 294

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L   +L SNN  G +  ++C +    LQ + L  N   G+IPP+LSNC EL  L LS N 
Sbjct: 295 LRNFELGSNNLGGILPADMCYSLPR-LQVINLSQNQLKGEIPPSLSNCGELQVLGLSINE 353

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             G IPS +G+LS +  + L  N L G IP     +  L+TL L+ N +
Sbjct: 354 FIGRIPSGIGNLSGIEKIYLGGNNLMGTIPSSFGNLSALKTLYLEKNKI 402

 Score =  107 bits (266), Expect = 7e-22
 Identities = 66/170 (38%), Positives = 95/170 (55%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S LE L L  N  +GE+P + +  +  LK+L    N  +  +P ++ N+S S
Sbjct: 140 IPQAIGNLSKLEQLYLGGNQLTGEIPRE-ISHLLSLKILSFRSNNLTASIPSAIFNIS-S 197

Query: 209 LLTLDLSSNNFSGPILPNLCQN-PKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           L  + L+ N+ SG +  ++C + PK  L+ LYL  N  +GKIP +L  C  L  + LSFN
Sbjct: 198 LQYIGLTYNSLSGTLPMDMCYSLPK--LRGLYLSGNQLSGKIPTSLGKCGRLEEISLSFN 255

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              G+IP  +GSLS L  L L  N LEGEIPQ L  + +L    L  N+L
Sbjct: 256 EFMGSIPRGIGSLSVLEVLYLGSNNLEGEIPQTLFNLSSLRNFELGSNNL 305

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 59/167 (35%), Positives = 88/167 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+   L+ L   +N  SG LP         L+ ++ S  +F G +P  + NL+ +
Sbjct: 503 VPKDLGNLRSLQHLGFGNNQLSGTLPNSLGNLSLSLQSINASACQFKGVIPAGIGNLT-N 561

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L L  N+ +G I   L Q  K  LQ LY+  N   G +P  + + + LV L LS N 
Sbjct: 562 LIELGLGDNDLTGMIPTTLGQLKK--LQRLYIAGNRIHGSVPNGIGHLANLVYLFLSSNQ 619

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG +PSSL SL++L  + L  N L G++P E+  +KT+  L L  N
Sbjct: 620 LSGLVPSSLWSLNRLLVVNLSSNFLTGDLPVEVGSMKTITKLDLSQN 666

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 62/152 (40%), Positives = 82/152 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G  + L  L LSSN  SG +P  +L  +  L V++LS N  +G+LP  + ++  +
Sbjct: 600  VPNGIGHLANLVYLFLSSNQLSGLVP-SSLWSLNRLLVVNLSSNFLTGDLPVEVGSMK-T 657

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            +  LDLS N FSG I   + Q     L EL L  N   G IP    N   L SL LS+N 
Sbjct: 658  ITKLDLSQNQFSGHIPSTMGQ--LGGLVELSLSKNRLQGPIPREFGNLLSLESLDLSWNN 715

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
            LSG IP SL +L  L+ L +  N LEGEIP +
Sbjct: 716  LSGAIPRSLEALVSLKYLNVSFNKLEGEIPDK 747

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 60/169 (35%), Positives = 87/169 (51%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G    L+ L ++ N   G +P + +  +  L  L LS N+ SG +P SL +L+  
Sbjct: 576  IPTTLGQLKKLQRLYIAGNRIHGSVP-NGIGHLANLVYLFLSSNQLSGLVPSSLWSLNR- 633

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            LL ++LSSN  +G +   +      T+ +L L  N F+G IP T+     LV L LS N 
Sbjct: 634  LLVVNLSSNFLTGDLPVEV--GSMKTITKLDLSQNQFSGHIPSTMGQLGGLVELSLSKNR 691

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L G IP   G+L  L  L L  N L G IP+ L  + +L+ L + FN L
Sbjct: 692  LQGPIPREFGNLLSLESLDLSWNNLSGAIPRSLEALVSLKYLNVSFNKL 740

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 65/197 (32%), Positives = 96/197 (48%), Gaps = 23/197 (11%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +LE  +P    + S L +  L SNN  G LP D    +  L+V++LS N+  GE+P SL+
Sbjct: 280 NLEGEIPQTLFNLSSLRNFELGSNNLGGILPADMCYSLPRLQVINLSQNQLKGEIPPSLS 339

Query: 194 NLSASLLTLDLSSNNFSGPI---LPNLCQNPK-------------------NTLQELYLQ 307
           N    L  L LS N F G I   + NL    K                   + L+ LYL+
Sbjct: 340 NCG-ELQVLGLSINEFIGRIPSGIGNLSGIEKIYLGGNNLMGTIPSSFGNLSALKTLYLE 398

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            N   G IP  L + SEL  L L+ N L+G++P ++ ++S L+ + L  N L G +P  +
Sbjct: 399 KNKIQGNIPKELGHLSELQYLSLASNILTGSVPEAIFNISNLQFIVLADNHLSGNLPSSI 458

Query: 488 -MYVKTLETLILDFNDL 535
              +  LE L++  N L
Sbjct: 459 GTSLPQLEELLIGGNYL 475

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 61/170 (35%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFG-SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           LP   G S   LE L +  N  SG +P  ++  +  L  LDLS+N  +G +P+ L NL  
Sbjct: 454 LPSSIGTSLPQLEELLIGGNYLSGIIPA-SISNITKLTRLDLSYNLLTGFVPKDLGNLR- 511

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SL  L   +N  SG  LPN   N   +LQ +      F G IP  + N + L+ L L  N
Sbjct: 512 SLQHLGFGNNQLSGT-LPNSLGNLSLSLQSINASACQFKGVIPAGIGNLTNLIELGLGDN 570

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G IP++LG L KL+ L +  N + G +P  + ++  L  L L  N L
Sbjct: 571 DLTGMIPTTLGQLKKLQRLYIAGNRIHGSVPNGIGHLANLVYLFLSSNQL 620

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 43/109 (39%), Positives = 64/109 (58%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ LDLS+ +  G I P +     + L  L L NN F   IP  ++ C EL  L+L  N 
Sbjct: 78  VIALDLSNMDLEGTIAPQV--GNLSFLVTLDLSNNSFHASIPNEIAKCRELRQLYLFNNR 135

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IP ++G+LSKL  L L  N L GEIP+E+ ++ +L+ L    N+L
Sbjct: 136 LTGSIPQAIGNLSKLEQLYLGGNQLTGEIPREISHLLSLKILSFRSNNL 184

[127][TOP]
>UniRef100_A7PVL7 Chromosome chr9 scaffold_33, whole genome shotgun sequence n=2
           Tax=Vitis vinifera RepID=A7PVL7_VITVI
          Length = 1073

 Score =  108 bits (270), Expect = 2e-22
 Identities = 68/168 (40%), Positives = 95/168 (56%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+PP FG+CSLL  L LS N F GE+P + L  +  L+ L    N  +G +PESL  +  
Sbjct: 75  PIPPEFGNCSLLMDLDLSVNGFVGEIPQN-LNSLGKLEYLSFCNNSLTGAVPESLFRIP- 132

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L L+SN  SG I  N+       +  L+L +N  +G IP ++ NCSEL  L+L+ N
Sbjct: 133 NLEMLYLNSNKLSGSIPLNV--GNATQIIALWLYDNALSGDIPSSIGNCSELEELYLNHN 190

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
              G +P S+ +L  L  L +  N LEG+IP    Y K L+TL+L  N
Sbjct: 191 QFLGVLPESINNLENLVYLDVSNNNLEGKIPLGSGYCKKLDTLVLSMN 238

 Score =  105 bits (262), Expect = 2e-21
 Identities = 71/191 (37%), Positives = 97/191 (50%), Gaps = 22/191 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+CS LE L L+ N F G LP +++  +  L  LD+S N   G++P   +     
Sbjct: 172 IPSSIGNCSELEELYLNHNQFLGVLP-ESINNLENLVYLDVSNNNLEGKIPLG-SGYCKK 229

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPK--------------------NTLQELYLQNNGFT 322
           L TL LS N F G I P L  C +                      + L  LYL  N  +
Sbjct: 230 LDTLVLSMNGFGGEIPPGLGNCTSLSQFAALNNRLSGSIPSSFGLLHKLLLLYLSENHLS 289

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           GKIPP +  C  L SLHL  N L G IPS LG L++L+DL+L+ N L GEIP  +  + +
Sbjct: 290 GKIPPEIGQCKSLRSLHLYMNQLEGEIPSELGMLNELQDLRLFNNRLTGEIPISIWKIPS 349

Query: 503 LETLILDFNDL 535
           LE +++  N L
Sbjct: 350 LENVLVYNNTL 360

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 64/169 (37%), Positives = 92/169 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G  S L  L +++N F+GE+P       + L VL++  N   G +P ++ + S +
Sbjct: 388 IPQRLGINSSLVQLDVTNNKFTGEIPKSICFGKQ-LSVLNMGLNLLQGSIPSAVGSCS-T 445

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  NN +G +LPN  +NP   L  L L  NG  G IP +L NC+ + S++LS N 
Sbjct: 446 LRRLILRKNNLTG-VLPNFAKNPNLLL--LDLSENGINGTIPLSLGNCTNVTSINLSMNR 502

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP  LG+L+ L+ L L  N L G +P +L   K L    + FN L
Sbjct: 503 LSGLIPQELGNLNVLQALNLSHNDLGGPLPSQLSNCKNLFKFDVGFNSL 551

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 68/173 (39%), Positives = 90/173 (52%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L+  +P   GSCS L  L L  NN +G LP     K   L +LDLS N  +G +P SL N
Sbjct: 432 LQGSIPSAVGSCSTLRRLILRKNNLTGVLP--NFAKNPNLLLLDLSENGINGTIPLSLGN 489

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            + ++ +++LS N  SG ++P    N  N LQ L L +N   G +P  LSNC  L    +
Sbjct: 490 CT-NVTSINLSMNRLSG-LIPQELGN-LNVLQALNLSHNDLGGPLPSQLSNCKNLFKFDV 546

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            FN L+G+ PSSL SL  L  L L  N   G IP  L  ++ L  + L  N L
Sbjct: 547 GFNSLNGSFPSSLRSLENLSVLILRENRFTGGIPSFLSELQYLSEIQLGGNFL 599

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 62/170 (36%), Positives = 91/170 (53%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+C+ + S+ LS N  SG +P + L  +  L+ L+LS N+  G LP  L+N   +
Sbjct: 483 IPLSLGNCTNVTSINLSMNRLSGLIPQE-LGNLNVLQALNLSHNDLGGPLPSQLSNCK-N 540

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L   D+  N+ +G   P+  ++ +N L  L L+ N FTG IP  LS    L  + L  N+
Sbjct: 541 LFKFDVGFNSLNGSF-PSSLRSLEN-LSVLILRENRFTGGIPSFLSELQYLSEIQLGGNF 598

Query: 389 LSGTIPSSLGSLSKL-RDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IPSS+G L  L   L +  N L G +P EL  +  LE L +  N+L
Sbjct: 599 LGGNIPSSIGMLQNLIYSLNISHNRLTGSLPLELGKLIMLERLDISHNNL 648

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 59/169 (34%), Positives = 93/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           L P       L S+  S N+FSG +P +       L  LDLS N F GE+P++L +L   
Sbjct: 52  LGPEIADLRHLTSVDFSYNSFSGPIPPE-FGNCSLLMDLDLSVNGFVGEIPQNLNSLG-K 109

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L   +N+ +G +  +L + P   L+ LYL +N  +G IP  + N +++++L L  N 
Sbjct: 110 LEYLSFCNNSLTGAVPESLFRIPN--LEMLYLNSNKLSGSIPLNVGNATQIIALWLYDNA 167

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IPSS+G+ S+L +L L  N   G +P+ +  ++ L  L +  N+L
Sbjct: 168 LSGDIPSSIGNCSELEELYLNHNQFLGVLPESINNLENLVYLDVSNNNL 216

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 59/169 (34%), Positives = 87/169 (51%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G C  L SL L  N   GE+P + L  +  L+ L L  N  +GE+P S+  +  S
Sbjct: 292 IPPEIGQCKSLRSLHLYMNQLEGEIPSE-LGMLNELQDLRLFNNRLTGEIPISIWKIP-S 349

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + + +N  SG +   + +     L+ + L NN F+G IP  L   S LV L ++ N 
Sbjct: 350 LENVLVYNNTLSGELPVEITE--LKHLKNISLFNNRFSGVIPQRLGINSSLVQLDVTNNK 407

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +G IP S+    +L  L + LN+L+G IP  +    TL  LIL  N+L
Sbjct: 408 FTGEIPKSICFGKQLSVLNMGLNLLQGSIPSAVGSCSTLRRLILRKNNL 456

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/109 (36%), Positives = 55/109 (50%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +++L++S    SG + P +       L  +    N F+G IPP   NCS L+ L LS N 
Sbjct: 38  VVSLNVSGLGISGHLGPEIAD--LRHLTSVDFSYNSFSGPIPPEFGNCSLLMDLDLSVNG 95

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             G IP +L SL KL  L    N L G +P+ L  +  LE L L+ N L
Sbjct: 96  FVGEIPQNLNSLGKLEYLSFCNNSLTGAVPESLFRIPNLEMLYLNSNKL 144

[128][TOP]
>UniRef100_UPI0001983C4C PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983C4C
          Length = 1017

 Score =  108 bits (270), Expect = 2e-22
 Identities = 74/170 (43%), Positives = 96/170 (56%), Gaps = 5/170 (2%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFS-GELP----MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           FG    L  L L+SN    GE      +++L+K R LKVLDLS ++F G LP S+ NLS 
Sbjct: 325 FGGMPNLWGLFLASNPLGKGEADDLSFLNSLMKCRALKVLDLSGSQFGGVLPNSIANLST 384

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L+ L L +N  SG I P +  N  N L +L L NN FTG IP  + N   L  + LS N
Sbjct: 385 QLMKLKLDNNQLSGTIPPGI-GNLVN-LTDLILANNDFTGSIPVLIGNLQMLGRIDLSRN 442

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG IPSSLG++++L  L L  N L G+IP     +  L+ L L +N L
Sbjct: 443 QLSGHIPSSLGNITRLYSLHLQNNHLSGKIPSSFGNLLYLQELDLSYNSL 492

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 60/169 (35%), Positives = 91/169 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           L P  G+ + L  L L  NNF G++P + L ++  L+ L+L+ N FSGE+P +L+  S +
Sbjct: 104 LSPSIGNLTFLTGLNLELNNFHGQIPQE-LGRLSRLRALNLTNNSFSGEIPANLSRCS-N 161

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+   L  NN  G I   L   PK    +L+  N   TG +P +L N + + SL  + N+
Sbjct: 162 LVYFRLGFNNLIGRIPSWLGSYPKVVRMQLHYNN--LTGPVPDSLGNLTSIKSLSFAVNH 219

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G+IP +LG L  L  + L +N   G IP  +  + +LE   L +N L
Sbjct: 220 LEGSIPQALGQLQTLEFMGLGMNGFSGIIPSSVYNMSSLEVFSLPYNKL 268

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 63/186 (33%), Positives = 97/186 (52%), Gaps = 18/186 (9%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   L  L L++N+F+G +P+  +  ++ L  +DLS N+ SG +P SL N++  
Sbjct: 400 IPPGIGNLVNLTDLILANNDFTGSIPV-LIGNLQMLGRIDLSRNQLSGHIPSSLGNITR- 457

Query: 209 LLTLDLSSNNFSGPILPNLCQN------------------PKNTLQELYLQNNGFTGKIP 334
           L +L L +N+ SG I P+   N                  P+  +  + L  N  +G+IP
Sbjct: 458 LYSLHLQNNHLSGKI-PSSFGNLLYLQELDLSYNSLNGTIPEKVMDLVSLTENKLSGEIP 516

Query: 335 PTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETL 514
             L +C  L  LH+  N+  G+IP S  SL  L DL L  N L G+IP+ L  + +L  L
Sbjct: 517 DGLGSCLTLEHLHMEGNFFKGSIPPSFISLRGLLDLDLSRNNLSGQIPEFLQQL-SLSNL 575

Query: 515 ILDFND 532
            L FN+
Sbjct: 576 NLSFNN 581

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 58/159 (36%), Positives = 89/159 (55%), Gaps = 2/159 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           + +L L+S +  G L   ++  +  L  L+L  N F G++P+ L  LS  L  L+L++N+
Sbjct: 90  VNTLNLNSLHLVGSLS-PSIGNLTFLTGLNLELNNFHGQIPQELGRLSR-LRALNLTNNS 147

Query: 239 FSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           FSG I  NL  C N    L    L  N   G+IP  L +  ++V + L +N L+G +P S
Sbjct: 148 FSGEIPANLSRCSN----LVYFRLGFNNLIGRIPSWLGSYPKVVRMQLHYNNLTGPVPDS 203

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LG+L+ ++ L   +N LEG IPQ L  ++TLE + L  N
Sbjct: 204 LGNLTSIKSLSFAVNHLEGSIPQALGQLQTLEFMGLGMN 242

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 65/198 (32%), Positives = 96/198 (48%), Gaps = 29/198 (14%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S LE  +L  N   G LP D    +  L+VL++  N+F+G LP SL+N S +
Sbjct: 248 IPSSVYNMSSLEVFSLPYNKLYGSLPWDLAFTLPNLQVLNIGNNDFTGSLPSSLSNAS-N 306

Query: 209 LLTLDLSSNNFSGPI------LPN-----LCQNPK-----------------NTLQELYL 304
           LL  D++ +NF+G +      +PN     L  NP                    L+ L L
Sbjct: 307 LLEFDITMSNFTGKVSIDFGGMPNLWGLFLASNPLGKGEADDLSFLNSLMKCRALKVLDL 366

Query: 305 QNNGFTGKIPPTLSNCS-ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
             + F G +P +++N S +L+ L L  N LSGTIP  +G+L  L DL L  N   G IP 
Sbjct: 367 SGSQFGGVLPNSIANLSTQLMKLKLDNNQLSGTIPPGIGNLVNLTDLILANNDFTGSIPV 426

Query: 482 ELMYVKTLETLILDFNDL 535
            +  ++ L  + L  N L
Sbjct: 427 LIGNLQMLGRIDLSRNQL 444

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 52/134 (38%), Positives = 72/134 (53%)
 Frame = +2

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
           +  L+L+     G L  S+ NL+  L  L+L  NNF G I   L +  +  L+ L L NN
Sbjct: 90  VNTLNLNSLHLVGSLSPSIGNLTF-LTGLNLELNNFHGQIPQELGRLSR--LRALNLTNN 146

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            F+G+IP  LS CS LV   L FN L G IPS LGS  K+  ++L  N L G +P  L  
Sbjct: 147 SFSGEIPANLSRCSNLVYFRLGFNNLIGRIPSWLGSYPKVVRMQLHYNNLTGPVPDSLGN 206

Query: 494 VKTLETLILDFNDL 535
           + ++++L    N L
Sbjct: 207 LTSIKSLSFAVNHL 220

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 32/90 (35%), Positives = 42/90 (46%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
           C +    +  L L +    G + P++ N + L  L+L  N   G IP  LG LS+LR L 
Sbjct: 83  CGHRHQRVNTLNLNSLHLVGSLSPSIGNLTFLTGLNLELNNFHGQIPQELGRLSRLRALN 142

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N   GEIP  L     L    L FN+L
Sbjct: 143 LTNNSFSGEIPANLSRCSNLVYFRLGFNNL 172

[129][TOP]
>UniRef100_Q8L3Y5 Receptor-like kinase RHG1 n=1 Tax=Glycine max RepID=Q8L3Y5_SOYBN
          Length = 855

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/170 (41%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C LL+SL LS+N  +G +P  +L     L  L+LSFN FSG LP SLT+ S S
Sbjct: 180 IPLSLGFCPLLQSLDLSNNLLTGAIPY-SLANSTKLYWLNLSFNSFSGPLPASLTH-SFS 237

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKN---TLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L  L L +NN SG +  +   N KN    LQ L L +N FTG +P +L +  EL  + LS
Sbjct: 238 LTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLS 297

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N  SG IP+ +G+LS+L+ L +  N L G +P  L  + +L  L  + N
Sbjct: 298 HNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNLSSLTLLNAENN 347

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L++L L  N F+G++P  +L  +R L  + LS N+FSG +P  +  LS  L TLD+S+N 
Sbjct: 267 LQNLILDHNFFTGDVPA-SLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNA 324

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G +   L      TL  L  +NN    +IP +L     L  L LS N  SG IPSS+ 
Sbjct: 325 LNGNLPATLSNLSSLTL--LNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIA 382

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++S LR L L LN   GEIP      ++L    + +N L
Sbjct: 383 NISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSL 421

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 23/152 (15%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   GS   L  ++LS N FSG +P +     R LK LD+S N  +G LP +L+NLS+ 
Sbjct: 281 VPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNALNGNLPATLSNLSSL 339

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 +L  L LS N FSG I  ++     ++L++L L  N F
Sbjct: 340 TLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIANI--SSLRQLDLSLNNF 397

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           +G+IP +  +   L   ++S+N LSG++P  L
Sbjct: 398 SGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLL 429

[130][TOP]
>UniRef100_Q69KC4 Os06g0586150 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q69KC4_ORYSJ
          Length = 1128

 Score =  108 bits (270), Expect = 2e-22
 Identities = 69/173 (39%), Positives = 101/173 (58%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L+  +P  FG+   L++L L+ N  +G++P   L     L+ +DL  N  +G +PESL N
Sbjct: 185 LQGSIPSTFGNLPKLKTLVLARNRLTGDIP-PFLGSSVSLRYVDLGNNALTGSIPESLAN 243

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S+SL  L L SN+ SG +  +L     ++L  + LQ N F G IP   +  S +  L+L
Sbjct: 244 -SSSLQVLRLMSNSLSGQLPKSLLNT--SSLIAICLQQNSFVGSIPAVTAKSSPIKYLNL 300

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             NY+SG IPSSL +LS L  L+L  N L G IP+ L +++TLE L L+ N+L
Sbjct: 301 RNNYISGAIPSSLANLSSLLSLRLNENNLVGNIPESLGHIQTLEMLALNVNNL 353

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 71/171 (41%), Positives = 91/171 (53%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFS-GELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           L PFFGS   L  L +S N    G+   M +L     L  L L  N   G LP S+ NLS
Sbjct: 429 LIPFFGSLPNLNELDVSYNMLEPGDWGFMTSLSNCSRLTKLMLDGNNLQGNLPSSIGNLS 488

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           ++L  L L +N F GPI P+   N K+ L  L++  N FTG IPPT+ N + LV L  + 
Sbjct: 489 SNLEALWLKNNKFFGPI-PSEIGNLKS-LNRLFMDYNVFTGNIPPTIGNMNSLVVLSFAQ 546

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N LSG IP   G+LS+L DLKL  N   G+IP  +     L+ L +  N L
Sbjct: 547 NKLSGHIPDIFGNLSQLTDLKLDGNNFSGKIPASISQCTQLQILNIAHNSL 597

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 64/169 (37%), Positives = 95/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PPF GS   L  + L +N  +G +P ++L     L+VL L  N  SG+LP+SL N S S
Sbjct: 213 IPPFLGSSVSLRYVDLGNNALTGSIP-ESLANSSSLQVLRLMSNSLSGQLPKSLLNTS-S 270

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ + L  N+F G I     ++  + ++ L L+NN  +G IP +L+N S L+SL L+ N 
Sbjct: 271 LIAICLQQNSFVGSIPAVTAKS--SPIKYLNLRNNYISGAIPSSLANLSSLLSLRLNENN 328

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IP SLG +  L  L L +N L G +P  +  + +L  L +  N L
Sbjct: 329 LVGNIPESLGHIQTLEMLALNVNNLSGLVPPSIFNMSSLIFLAMANNSL 377

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 57/168 (33%), Positives = 92/168 (54%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  FG+ S L  L L  NNFSG++P  ++ +   L++L+++ N   G +P  +  +S+ 
Sbjct: 553  IPDIFGNLSQLTDLKLDGNNFSGKIPA-SISQCTQLQILNIAHNSLDGNIPSKIFEISSL 611

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               +DLS N  SG I PN   N  + L  L + NN  +GKIP +L  C  L  L +  N+
Sbjct: 612  SEEMDLSHNYLSGEI-PNEVGNLIH-LNRLVISNNMLSGKIPSSLGQCVVLEYLEIQNNF 669

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
              G+IP S  +L  ++ + +  N L G IP+ L  + +L +L L +N+
Sbjct: 670  FVGSIPQSFVNLVSIKRMDISQNNLSGNIPEFLTSLSSLHSLNLSYNN 717

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 67/173 (38%), Positives = 93/173 (53%), Gaps = 1/173 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LP    + S L ++ L  N+F G +P  T  K   +K L+L  N  SG +P SL 
Sbjct: 256 SLSGQLPKSLLNTSSLIAICLQQNSFVGSIPAVTA-KSSPIKYLNLRNNYISGAIPSSLA 314

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NLS SLL+L L+ NN  G I  +L      TL+ L L  N  +G +PP++ N S L+ L 
Sbjct: 315 NLS-SLLSLRLNENNLVGNIPESL--GHIQTLEMLALNVNNLSGLVPPSIFNMSSLIFLA 371

Query: 374 LSFNYLSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           ++ N L+G +PS +G +L K++ L L  N   G IP  L+    LE L L  N
Sbjct: 372 MANNSLTGRLPSDIGYTLPKIQGLILSTNKFVGPIPASLLNAYHLEMLYLGKN 424

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 68/195 (34%), Positives = 91/195 (46%), Gaps = 28/195 (14%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    LE LAL+ NN SG +P  ++  M  L  L ++ N  +G LP  +      
Sbjct: 333 IPESLGHIQTLEMLALNVNNLSGLVP-PSIFNMSSLIFLAMANNSLTGRLPSDIGYTLPK 391

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP------------------ 334
           +  L LS+N F GPI  +L       L+ LYL  N FTG IP                  
Sbjct: 392 IQGLILSTNKFVGPIPASLLN--AYHLEMLYLGKNSFTGLIPFFGSLPNLNELDVSYNML 449

Query: 335 --------PTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWL--NMLEGEIPQE 484
                    +LSNCS L  L L  N L G +PSS+G+LS   +  LWL  N   G IP E
Sbjct: 450 EPGDWGFMTSLSNCSRLTKLMLDGNNLQGNLPSSIGNLSSNLE-ALWLKNNKFFGPIPSE 508

Query: 485 LMYVKTLETLILDFN 529
           +  +K+L  L +D+N
Sbjct: 509 IGNLKSLNRLFMDYN 523

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 62/193 (32%), Positives = 93/193 (48%), Gaps = 23/193 (11%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+P   G+   L  L +  N F+G +P  T+  M  L VL  + N+ SG +P+   NLS 
Sbjct: 504  PIPSEIGNLKSLNRLFMDYNVFTGNIP-PTIGNMNSLVVLSFAQNKLSGHIPDIFGNLS- 561

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPK--------NTL---------------QELYLQNNG 316
             L  L L  NNFSG I  ++ Q  +        N+L               +E+ L +N 
Sbjct: 562  QLTDLKLDGNNFSGKIPASISQCTQLQILNIAHNSLDGNIPSKIFEISSLSEEMDLSHNY 621

Query: 317  FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
             +G+IP  + N   L  L +S N LSG IPSSLG    L  L++  N   G IPQ  + +
Sbjct: 622  LSGEIPNEVGNLIHLNRLVISNNMLSGKIPSSLGQCVVLEYLEIQNNFFVGSIPQSFVNL 681

Query: 497  KTLETLILDFNDL 535
             +++ + +  N+L
Sbjct: 682  VSIKRMDISQNNL 694

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 60/159 (37%), Positives = 82/159 (51%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L +L LS+N+F G +P   L  +  L  L+LS N   G +P  L++ S  L  L L +N+
Sbjct: 103 LTTLQLSNNSFHGSIP-SRLGLLSELNNLNLSMNSLEGNIPSELSSCS-QLEILGLWNNS 160

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
             G I  +L +     LQE+ L  N   G IP T  N  +L +L L+ N L+G IP  LG
Sbjct: 161 IQGEIPASLSKCIH--LQEINLSRNKLQGSIPSTFGNLPKLKTLVLARNRLTGDIPPFLG 218

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           S   LR + L  N L G IP+ L    +L+ L L  N L
Sbjct: 219 SSVSLRYVDLGNNALTGSIPESLANSSSLQVLRLMSNSL 257

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 53/138 (38%), Positives = 75/138 (54%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           ++ L+S   +G +    +  +  L  L LS N F G +P  L  LS  L  L+LS N+  
Sbjct: 81  AIDLASEGITGTISR-CIANLTSLTTLQLSNNSFHGSIPSRLGLLS-ELNNLNLSMNSLE 138

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I   L  +  + L+ L L NN   G+IP +LS C  L  ++LS N L G+IPS+ G+L
Sbjct: 139 GNIPSEL--SSCSQLEILGLWNNSIQGEIPASLSKCIHLQEINLSRNKLQGSIPSTFGNL 196

Query: 425 SKLRDLKLWLNMLEGEIP 478
            KL+ L L  N L G+IP
Sbjct: 197 PKLKTLVLARNRLTGDIP 214

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 45/109 (41%), Positives = 59/109 (54%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ +DL+S   +G I  + C     +L  L L NN F G IP  L   SEL +L+LS N 
Sbjct: 79  VIAIDLASEGITGTI--SRCIANLTSLTTLQLSNNSFHGSIPSRLGLLSELNNLNLSMNS 136

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IPS L S S+L  L LW N ++GEIP  L     L+ + L  N L
Sbjct: 137 LEGNIPSELSSCSQLEILGLWNNSIQGEIPASLSKCIHLQEINLSRNKL 185

[131][TOP]
>UniRef100_C9VZY4 RHG1 n=1 Tax=Glycine max RepID=C9VZY4_SOYBN
          Length = 854

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/170 (41%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C LL+SL LS+N  +G +P  +L     L  L+LSFN FSG LP SLT+ S S
Sbjct: 180 IPLSLGFCPLLQSLDLSNNLLTGAIPY-SLANSTKLYWLNLSFNSFSGPLPASLTH-SFS 237

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKN---TLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L  L L +NN SG +  +   N KN    LQ L L +N FTG +P +L +  EL  + LS
Sbjct: 238 LTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLS 297

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N  SG IP+ +G+LS+L+ L +  N L G +P  L  + +L  L  + N
Sbjct: 298 HNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNLSSLTLLNAENN 347

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L++L L  N F+G++P  +L  +R L  + LS N+FSG +P  +  LS  L TLD+S+N 
Sbjct: 267 LQNLILDHNFFTGDVPA-SLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNA 324

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G +   L      TL  L  +NN    +IP +L     L  L LS N  SG IPSS+ 
Sbjct: 325 LNGNLPATLSNLSSLTL--LNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIA 382

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++S LR L L LN   GEIP      ++L    + +N L
Sbjct: 383 NISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSL 421

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 23/152 (15%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   GS   L  ++LS N FSG +P +     R LK LD+S N  +G LP +L+NLS+ 
Sbjct: 281 VPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNALNGNLPATLSNLSSL 339

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 +L  L LS N FSG I  ++     ++L++L L  N F
Sbjct: 340 TLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIANI--SSLRQLDLSLNNF 397

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           +G+IP +  +   L   ++S+N LSG++P  L
Sbjct: 398 SGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLL 429

[132][TOP]
>UniRef100_C9VZY3 RHG1 n=1 Tax=Glycine max RepID=C9VZY3_SOYBN
          Length = 854

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/170 (41%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C LL+SL LS+N  +G +P  +L     L  L+LSFN FSG LP SLT+ S S
Sbjct: 180 IPLSLGFCPLLQSLDLSNNLLTGAIPY-SLANSTKLYWLNLSFNSFSGPLPASLTH-SFS 237

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKN---TLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L  L L +NN SG +  +   N KN    LQ L L +N FTG +P +L +  EL  + LS
Sbjct: 238 LTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLS 297

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N  SG IP+ +G+LS+L+ L +  N L G +P  L  + +L  L  + N
Sbjct: 298 HNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNLSSLTLLNAENN 347

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L++L L  N F+G++P  +L  +R L  + LS N+FSG +P  +  LS  L TLD+S+N 
Sbjct: 267 LQNLILDHNFFTGDVPA-SLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNA 324

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G +   L      TL  L  +NN    +IP +L     L  L LS N  SG IPSS+ 
Sbjct: 325 LNGNLPATLSNLSSLTL--LNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIA 382

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++S LR L L LN   GEIP      ++L    + +N L
Sbjct: 383 NISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSL 421

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 23/152 (15%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   GS   L  ++LS N FSG +P +     R LK LD+S N  +G LP +L+NLS+ 
Sbjct: 281 VPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNALNGNLPATLSNLSSL 339

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 +L  L LS N FSG I  ++     ++L++L L  N F
Sbjct: 340 TLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIANI--SSLRQLDLSLNNF 397

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           +G+IP +  +   L   ++S+N LSG++P  L
Sbjct: 398 SGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLL 429

[133][TOP]
>UniRef100_C9VZY1 Receptor-like protein kinase RHG1 n=1 Tax=Glycine max
           RepID=C9VZY1_SOYBN
          Length = 854

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/170 (41%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C LL+SL LS+N  +G +P  +L     L  L+LSFN FSG LP SLT+ S S
Sbjct: 180 IPLSLGFCPLLQSLDLSNNLLTGAIPY-SLANSTKLYWLNLSFNSFSGPLPASLTH-SFS 237

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKN---TLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L  L L +NN SG +  +   N KN    LQ L L +N FTG +P +L +  EL  + LS
Sbjct: 238 LTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLS 297

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N  SG IP+ +G+LS+L+ L +  N L G +P  L  + +L  L  + N
Sbjct: 298 HNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNLSSLTLLNAENN 347

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L++L L  N F+G++P  +L  +R L  + LS N+FSG +P  +  LS  L TLD+S+N 
Sbjct: 267 LQNLILDHNFFTGDVPA-SLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNA 324

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G +   L      TL  L  +NN    +IP +L     L  L LS N  SG IPSS+ 
Sbjct: 325 LNGNLPATLSNLSSLTL--LNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIA 382

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++S LR L L LN   GEIP      ++L    + +N L
Sbjct: 383 NISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSL 421

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 23/152 (15%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   GS   L  ++LS N FSG +P +     R LK LD+S N  +G LP +L+NLS+ 
Sbjct: 281 VPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNALNGNLPATLSNLSSL 339

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 +L  L LS N FSG I  ++     ++L++L L  N F
Sbjct: 340 TLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIANI--SSLRQLDLSLNNF 397

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           +G+IP +  +   L   ++S+N LSG++P  L
Sbjct: 398 SGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLL 429

[134][TOP]
>UniRef100_C9VZY0 Receptor-like protein kinase RHG1 n=1 Tax=Glycine max
           RepID=C9VZY0_SOYBN
          Length = 854

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/170 (41%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C LL+SL LS+N  +G +P  +L     L  L+LSFN FSG LP SLT+ S S
Sbjct: 180 IPLSLGFCPLLQSLDLSNNLLTGAIPY-SLANSTKLYWLNLSFNSFSGPLPASLTH-SFS 237

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKN---TLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L  L L +NN SG +  +   N KN    LQ L L +N FTG +P +L +  EL  + LS
Sbjct: 238 LTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLS 297

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N  SG IP+ +G+LS+L+ L +  N L G +P  L  + +L  L  + N
Sbjct: 298 HNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNLSSLTLLNAENN 347

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L++L L  N F+G++P  +L  +R L  + LS N+FSG +P  +  LS  L TLD+S+N 
Sbjct: 267 LQNLILDHNFFTGDVPA-SLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNA 324

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G +   L      TL  L  +NN    +IP +L     L  L LS N  SG IPSS+ 
Sbjct: 325 LNGNLPATLSNLSSLTL--LNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIA 382

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++S LR L L LN   GEIP      ++L    + +N L
Sbjct: 383 NISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSL 421

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 23/152 (15%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   GS   L  ++LS N FSG +P +     R LK LD+S N  +G LP +L+NLS+ 
Sbjct: 281 VPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNALNGNLPATLSNLSSL 339

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 +L  L LS N FSG I  ++     ++L++L L  N F
Sbjct: 340 TLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIANI--SSLRQLDLSLNNF 397

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           +G+IP +  +   L   ++S+N LSG++P  L
Sbjct: 398 SGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLL 429

[135][TOP]
>UniRef100_C5YG40 Putative uncharacterized protein Sb06g028760 n=1 Tax=Sorghum
           bicolor RepID=C5YG40_SORBI
          Length = 1188

 Score =  108 bits (270), Expect = 2e-22
 Identities = 65/172 (37%), Positives = 96/172 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L   +P   G C+ L SL LS N F+G +P + L K+R L+ L L  N+ +G +P SL 
Sbjct: 321 ALSSEIPRSLGRCTSLLSLVLSKNQFTGTIPTE-LGKLRSLRKLMLHANKLTGTVPASLM 379

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           +L  +L  L  S N+ SGP+  N+       LQ L +  N  +G IP +++NC+ L +  
Sbjct: 380 DL-VNLTYLSFSDNSLSGPLPANI--GSLQNLQVLNIDTNSLSGPIPASITNCTSLYNAS 436

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           ++FN  SG +P+ LG L  L  L L  N L G+IP++L     L TL L +N
Sbjct: 437 MAFNEFSGPLPAGLGQLQNLNFLSLGDNKLSGDIPEDLFDCSNLRTLDLAWN 488

 Score =  101 bits (252), Expect = 3e-20
 Identities = 65/167 (38%), Positives = 95/167 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    +CS +   ++ +N+ +G +P D +  +  L  L LS N   GELP S   L+  
Sbjct: 182 IPSRLCNCSAMTQFSVFNNDLTGAVP-DCIGDLVNLNELILSLNNLDGELPPSFAKLT-Q 239

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TLDLSSN  SGPI P+   N  ++L  +++  N F+G IPP L  C  L +L++  N 
Sbjct: 240 LETLDLSSNQLSGPI-PSWIGN-FSSLNIVHMFENQFSGAIPPELGRCKNLTTLNMYSNR 297

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           L+G IPS LG L+ L+ L L+ N L  EIP+ L    +L +L+L  N
Sbjct: 298 LTGAIPSELGELTNLKVLLLYSNALSSEIPRSLGRCTSLLSLVLSKN 344

 Score =  100 bits (249), Expect = 7e-20
 Identities = 61/172 (35%), Positives = 102/172 (59%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL  P+P    +C+ L + +++ N FSG LP   L +++ L  L L  N+ SG++PE L 
Sbjct: 417 SLSGPIPASITNCTSLYNASMAFNEFSGPLPAG-LGQLQNLNFLSLGDNKLSGDIPEDLF 475

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           + S +L TLDL+ N+F+G + P + +  +  L  L LQ N  +G+IP  + N ++L++L 
Sbjct: 476 DCS-NLRTLDLAWNSFTGSLSPRVGRLSELIL--LQLQFNALSGEIPEEIGNLTKLITLP 532

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           L  N  +G +P S+ ++S L+ L+L  N LEG +P E+  ++ L  L +  N
Sbjct: 533 LEGNRFAGRVPKSISNMSSLQGLRLQHNSLEGTLPDEIFGLRQLTILSVASN 584

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 68/176 (38%), Positives = 92/176 (52%), Gaps = 2/176 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL  PLP   GS   L+ L + +N+ SG +P  ++     L    ++FNEFSG LP  L 
Sbjct: 393 SLSGPLPANIGSLQNLQVLNIDTNSLSGPIPA-SITNCTSLYNASMAFNEFSGPLPAGLG 451

Query: 194 NLSASLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
            L  +L  L L  N  SG I  +L  C N    L+ L L  N FTG + P +   SEL+ 
Sbjct: 452 QLQ-NLNFLSLGDNKLSGDIPEDLFDCSN----LRTLDLAWNSFTGSLSPRVGRLSELIL 506

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L L FN LSG IP  +G+L+KL  L L  N   G +P+ +  + +L+ L L  N L
Sbjct: 507 LQLQFNALSGEIPEEIGNLTKLITLPLEGNRFAGRVPKSISNMSSLQGLRLQHNSL 562

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 65/174 (37%), Positives = 92/174 (52%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L+  LPP F   + LE+L LSSN  SG +P   +     L ++ +  N+FSG +P  L 
Sbjct: 225 NLDGELPPSFAKLTQLETLDLSSNQLSGPIP-SWIGNFSSLNIVHMFENQFSGAIPPELG 283

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
               +L TL++ SN  +G I   L +     L+ L L +N  + +IP +L  C+ L+SL 
Sbjct: 284 RCK-NLTTLNMYSNRLTGAIPSELGE--LTNLKVLLLYSNALSSEIPRSLGRCTSLLSLV 340

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N  +GTIP+ LG L  LR L L  N L G +P  LM +  L  L    N L
Sbjct: 341 LSKNQFTGTIPTELGKLRSLRKLMLHANKLTGTVPASLMDLVNLTYLSFSDNSL 394

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 69/191 (36%), Positives = 91/191 (47%), Gaps = 22/191 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           L PF G+ + L  L L+SN F G +P   L ++  LK L L  N F+G +P  L  L  S
Sbjct: 110 LTPFLGNITTLRMLDLTSNRFGGAIPPQ-LGRLDELKGLGLGDNSFTGAIPPELGELG-S 167

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNT----------------------LQELYLQNNGFT 322
           L  LDLS+N   G I   LC     T                      L EL L  N   
Sbjct: 168 LQVLDLSNNTLGGGIPSRLCNCSAMTQFSVFNNDLTGAVPDCIGDLVNLNELILSLNNLD 227

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G++PP+ +  ++L +L LS N LSG IPS +G+ S L  + ++ N   G IP EL   K 
Sbjct: 228 GELPPSFAKLTQLETLDLSSNQLSGPIPSWIGNFSSLNIVHMFENQFSGAIPPELGRCKN 287

Query: 503 LETLILDFNDL 535
           L TL +  N L
Sbjct: 288 LTTLNMYSNRL 298

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 62/168 (36%), Positives = 90/168 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G C  L +L + SN  +G +P + L ++  LKVL L  N  S E+P SL   + S
Sbjct: 278 IPPELGRCKNLTTLNMYSNRLTGAIPSE-LGELTNLKVLLLYSNALSSEIPRSLGRCT-S 335

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           LL+L LS N F+G I   L      +L++L L  N  TG +P +L +   L  L  S N 
Sbjct: 336 LLSLVLSKNQFTGTIPTEL--GKLRSLRKLMLHANKLTGTVPASLMDLVNLTYLSFSDNS 393

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           LSG +P+++GSL  L+ L +  N L G IP  +    +L    + FN+
Sbjct: 394 LSGPLPANIGSLQNLQVLNIDTNSLSGPIPASITNCTSLYNASMAFNE 441

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 65/176 (36%), Positives = 90/176 (51%), Gaps = 2/176 (1%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
            SLE  LP        L  L+++SN F G +P D +  +R L  LD+S N  +G +P ++ 
Sbjct: 561  SLEGTLPDEIFGLRQLTILSVASNRFVGPIP-DAVSNLRSLSFLDMSNNALNGTVPAAVG 619

Query: 194  NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE-LYLQNNGFTGKIPPTLSNCSELVSL 370
            NL   LL LDLS N  +G I P       +TLQ  L L NN FTG IP  +   + + S+
Sbjct: 620  NLG-QLLMLDLSHNRLAGAI-PGAVIAKLSTLQMYLNLSNNMFTGPIPAEIGGLAMVQSI 677

Query: 371  HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM-YVKTLETLILDFNDL 535
             LS N LSG  P++L     L  L L  N L   +P +L   +  L +L +  N+L
Sbjct: 678  DLSNNRLSGGFPATLARCKNLYSLDLSANNLTVALPADLFPQLDVLTSLNISGNEL 733

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 65/191 (34%), Positives = 95/191 (49%), Gaps = 24/191 (12%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P     CS L +L L+ N+F+G L    + ++  L +L L FN  SGE+PE + NL+  
Sbjct: 470  IPEDLFDCSNLRTLDLAWNSFTGSLS-PRVGRLSELILLQLQFNALSGEIPEEIGNLT-K 527

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNG------------------------ 316
            L+TL L  N F+G + P    N  ++LQ L LQ+N                         
Sbjct: 528  LITLPLEGNRFAGRV-PKSISN-MSSLQGLRLQHNSLEGTLPDEIFGLRQLTILSVASNR 585

Query: 317  FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
            F G IP  +SN   L  L +S N L+GT+P+++G+L +L  L L  N L G IP  +  +
Sbjct: 586  FVGPIPDAVSNLRSLSFLDMSNNALNGTVPAAVGNLGQLLMLDLSHNRLAGAIPGAV--I 643

Query: 497  KTLETLILDFN 529
              L TL +  N
Sbjct: 644  AKLSTLQMYLN 654

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 46/137 (33%), Positives = 73/137 (53%)
 Frame = +2

Query: 68   LALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG 247
            L LS+N F+G +P + +  +  ++ +DLS N  SG  P +L     +L +LDLS+NN + 
Sbjct: 653  LNLSNNMFTGPIPAE-IGGLAMVQSIDLSNNRLSGGFPATLARCK-NLYSLDLSANNLTV 710

Query: 248  PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS 427
             +  +L     + L  L +  N   G IP  +     + +L  S N  +G IP++L +L+
Sbjct: 711  ALPADLFPQ-LDVLTSLNISGNELDGDIPSNIGALKNIQTLDASRNAFTGAIPAALANLT 769

Query: 428  KLRDLKLWLNMLEGEIP 478
             LR L L  N LEG +P
Sbjct: 770  SLRSLNLSSNQLEGPVP 786

[136][TOP]
>UniRef100_C0SW30 RHG1 n=1 Tax=Glycine max RepID=C0SW30_SOYBN
          Length = 854

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/170 (41%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C LL+SL LS+N  +G +P  +L     L  L+LSFN FSG LP SLT+ S S
Sbjct: 180 IPLSLGFCPLLQSLDLSNNLLTGAIPY-SLANSTKLYWLNLSFNSFSGPLPASLTH-SFS 237

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKN---TLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L  L L +NN SG +  +   N KN    LQ L L +N FTG +P +L +  EL  + LS
Sbjct: 238 LTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLS 297

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N  SG IP+ +G+LS+L+ L +  N L G +P  L  + +L  L  + N
Sbjct: 298 HNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNLSSLTLLNAENN 347

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L++L L  N F+G++P  +L  +R L  + LS N+FSG +P  +  LS  L TLD+S+N 
Sbjct: 267 LQNLILDHNFFTGDVPA-SLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNA 324

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G +   L      TL  L  +NN    +IP +L     L  L LS N  SG IPSS+ 
Sbjct: 325 LNGNLPATLSNLSSLTL--LNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIA 382

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++S LR L L LN   GEIP      ++L    + +N L
Sbjct: 383 NISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSL 421

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 23/152 (15%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   GS   L  ++LS N FSG +P +     R LK LD+S N  +G LP +L+NLS+ 
Sbjct: 281 VPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNALNGNLPATLSNLSSL 339

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 +L  L LS N FSG I  ++     ++L++L L  N F
Sbjct: 340 TLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIANI--SSLRQLDLSLNNF 397

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           +G+IP +  +   L   ++S+N LSG++P  L
Sbjct: 398 SGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLL 429

[137][TOP]
>UniRef100_C0SW26 Receptor-like kinase n=1 Tax=Glycine max RepID=C0SW26_SOYBN
          Length = 854

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/170 (41%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C LL+SL LS+N  +G +P  +L     L  L+LSFN FSG LP SLT+ S S
Sbjct: 180 IPLSLGFCPLLQSLDLSNNLLTGAIPY-SLANSTKLYWLNLSFNSFSGPLPASLTH-SFS 237

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKN---TLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L  L L +NN SG +  +   N KN    LQ L L +N FTG +P +L +  EL  + LS
Sbjct: 238 LTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLS 297

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N  SG IP+ +G+LS+L+ L +  N L G +P  L  + +L  L  + N
Sbjct: 298 HNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNLSSLTLLNAENN 347

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L++L L  N F+G++P  +L  +R L  + LS N+FSG +P  +  LS  L TLD+S+N 
Sbjct: 267 LQNLILDHNFFTGDVPA-SLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNA 324

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G +   L      TL  L  +NN    +IP +L     L  L LS N  SG IPSS+ 
Sbjct: 325 LNGNLPATLSNLSSLTL--LNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIA 382

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++S LR L L LN   GEIP      ++L    + +N L
Sbjct: 383 NISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSL 421

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 23/152 (15%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   GS   L  ++LS N FSG +P +     R LK LD+S N  +G LP +L+NLS+ 
Sbjct: 281 VPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNALNGNLPATLSNLSSL 339

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 +L  L LS N FSG I  ++     ++L++L L  N F
Sbjct: 340 TLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIANI--SSLRQLDLSLNNF 397

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           +G+IP +  +   L   ++S+N LSG++P  L
Sbjct: 398 SGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLL 429

[138][TOP]
>UniRef100_C0SW25 Receptor-like kinase n=1 Tax=Glycine max RepID=C0SW25_SOYBN
          Length = 854

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/170 (41%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C LL+SL LS+N  +G +P  +L     L  L+LSFN FSG LP SLT+ S S
Sbjct: 180 IPLSLGFCPLLQSLDLSNNLLTGAIPY-SLANSTKLYWLNLSFNSFSGPLPASLTH-SFS 237

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKN---TLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           L  L L +NN SG +  +   N KN    LQ L L +N FTG +P +L +  EL  + LS
Sbjct: 238 LTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLS 297

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N  SG IP+ +G+LS+L+ L +  N L G +P  L  + +L  L  + N
Sbjct: 298 HNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNLSSLTLLNAENN 347

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/159 (37%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L++L L  N F+G++P  +L  +R L  + LS N+FSG +P  +  LS  L TLD+S+N 
Sbjct: 267 LQNLILDHNFFTGDVPA-SLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNA 324

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G +   L      TL  L  +NN    +IP +L     L  L LS N  SG IPSS+ 
Sbjct: 325 LNGNLPATLSNLSSLTL--LNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIA 382

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++S LR L L LN   GEIP      ++L    + +N L
Sbjct: 383 NISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSL 421

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 23/152 (15%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           +P   GS   L  ++LS N FSG +P +     R LK LD+S N  +G LP +L+NLS+ 
Sbjct: 281 VPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR-LKTLDISNNALNGNLPATLSNLSSL 339

Query: 206 ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                 +L  L LS N FSG I  ++     ++L++L L  N F
Sbjct: 340 TLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFSGHIPSSIANI--SSLRQLDLSLNNF 397

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           +G+IP +  +   L   ++S+N LSG++P  L
Sbjct: 398 SGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLL 429

[139][TOP]
>UniRef100_C0PTA1 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=C0PTA1_PICSI
          Length = 946

 Score =  108 bits (270), Expect = 2e-22
 Identities = 73/174 (41%), Positives = 96/174 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP  G C  L  + LS N+ SG +P  TL  +  +  ++LSFN  SG +P  L 
Sbjct: 286 SLSGHIPPTLGKCISLSYIYLSGNSLSGHMPR-TLGNLTQISHINLSFNNLSGVIPVDLG 344

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           +L   L  L LS NN SG I  +L    K  LQ L L +N     IPP+L NCS L  L 
Sbjct: 345 SLQ-KLEWLGLSDNNLSGAIPVDLGSLQK--LQILDLSDNALDNIIPPSLGNCSSLQDLS 401

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N LSG+IP  LG+LS L+ L L  N L G IP  L  ++ ++TL +  N++
Sbjct: 402 LSSNRLSGSIPHHLGNLSSLQTLFLSSNRLSGSIPHHLGNLRNIQTLEISNNNI 455

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 74/197 (37%), Positives = 97/197 (49%), Gaps = 24/197 (12%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF-SGELPESLT 193
           LE  L    GS S L++L LS+NN +G +P +   +++ L+ LDL+FNE   G +P+SL 
Sbjct: 117 LEGILSSSLGSLSFLKTLDLSANNLTGGIPPE-FGRLKALRTLDLTFNEMLGGSVPKSLL 175

Query: 194 NLS-----------------------ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 304
           N +                         L  LDLSSN +    +P    N   +L  L L
Sbjct: 176 NCTHLKWIGLANINLTGTIPTEFGRLVELEHLDLSSNYYLSGSIPTSLGNC-TSLSHLDL 234

Query: 305 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
            NN  +G IPPTL NC  L  LHLS N LSG IP +LG+ + L  L L  N L G IP  
Sbjct: 235 SNNSLSGHIPPTLGNCISLSHLHLSENSLSGHIPPTLGNCTSLSHLDLSGNSLSGHIPPT 294

Query: 485 LMYVKTLETLILDFNDL 535
           L    +L  + L  N L
Sbjct: 295 LGKCISLSYIYLSGNSL 311

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 72/176 (40%), Positives = 96/176 (54%), Gaps = 1/176 (0%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNF-SGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           ++L   +P  FG    LE L LSSN + SG +P  +L     L  LDLS N  SG +P +
Sbjct: 188 INLTGTIPTEFGRLVELEHLDLSSNYYLSGSIPT-SLGNCTSLSHLDLSNNSLSGHIPPT 246

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           L N   SL  L LS N+ SG I P L      +L  L L  N  +G IPPTL  C  L  
Sbjct: 247 LGNC-ISLSHLHLSENSLSGHIPPTL--GNCTSLSHLDLSGNSLSGHIPPTLGKCISLSY 303

Query: 368 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++LS N LSG +P +LG+L+++  + L  N L G IP +L  ++ LE L L  N+L
Sbjct: 304 IYLSGNSLSGHMPRTLGNLTQISHINLSFNNLSGVIPVDLGSLQKLEWLGLSDNNL 359

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 66/170 (38%), Positives = 96/170 (56%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF-SGELPESLTNLSA 205
           +P    +C+ L+ + L++ N +G +P +   ++  L+ LDLS N + SG +P SL N + 
Sbjct: 170 VPKSLLNCTHLKWIGLANINLTGTIPTE-FGRLVELEHLDLSSNYYLSGSIPTSLGNCT- 227

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SL  LDLS+N+ SG I P L      +L  L+L  N  +G IPPTL NC+ L  L LS N
Sbjct: 228 SLSHLDLSNNSLSGHIPPTL--GNCISLSHLHLSENSLSGHIPPTLGNCTSLSHLDLSGN 285

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG IP +LG    L  + L  N L G +P+ L  +  +  + L FN+L
Sbjct: 286 SLSGHIPPTLGKCISLSYIYLSGNSLSGHMPRTLGNLTQISHINLSFNNL 335

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 71/217 (32%), Positives = 101/217 (46%), Gaps = 48/217 (22%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P     C+ L+ + LSSNNF+GELP ++L  +  L VL + +N   G +P+ +TNL+  
Sbjct: 626  VPASLAYCTNLKLIDLSSNNFTGELP-ESLSFLNQLSVLSVGYNNLHGGIPKGITNLTM- 683

Query: 209  LLTLDLSSNNFSGPI--------------------------LPNLCQNPKNTLQE----- 295
            L  LDLS+N  SG I                          L  +   P N++ E     
Sbjct: 684  LHVLDLSNNKLSGKIPSDLQKLQGFAINVSATHIYMLYEGRLGKIVLLPSNSIIEEMTID 743

Query: 296  -----------------LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
                              YL NN  TG+IP ++     L  L+LS N L G IP+SLG++
Sbjct: 744  IKRHMYSLPYMSPTNTIFYLSNNNLTGEIPASIGCLRSLRLLNLSGNQLEGVIPASLGNI 803

Query: 425  SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            S L +L L  N L+GEIP+ L  +  L  L +  N L
Sbjct: 804  STLEELDLSKNHLKGEIPEGLSKLHELAVLDVSSNHL 840

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/158 (37%), Positives = 88/158 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G+ + +  + LS NN SG +P+D L  ++ L+ L LS N  SG +P  L 
Sbjct: 310 SLSGHMPRTLGNLTQISHINLSFNNLSGVIPVD-LGSLQKLEWLGLSDNNLSGAIPVDLG 368

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           +L   L  LDLS N     I P+L     ++LQ+L L +N  +G IP  L N S L +L 
Sbjct: 369 SLQ-KLQILDLSDNALDNIIPPSL--GNCSSLQDLSLSSNRLSGSIPHHLGNLSSLQTLF 425

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           LS N LSG+IP  LG+L  ++ L++  N + G +P  +
Sbjct: 426 LSSNRLSGSIPHHLGNLRNIQTLEISNNNISGLLPSSI 463

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 58/139 (41%), Positives = 80/139 (57%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F +L   +P   GS   LE L LS NN SG +P+D L  ++ L++LDLS N     +P S
Sbjct: 332 FNNLSGVIPVDLGSLQKLEWLGLSDNNLSGAIPVD-LGSLQKLQILDLSDNALDNIIPPS 390

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           L N S SL  L LSSN  SG I  +L     ++LQ L+L +N  +G IP  L N   + +
Sbjct: 391 LGNCS-SLQDLSLSSNRLSGSIPHHL--GNLSSLQTLFLSSNRLSGSIPHHLGNLRNIQT 447

Query: 368 LHLSFNYLSGTIPSSLGSL 424
           L +S N +SG +PSS+ +L
Sbjct: 448 LEISNNNISGLLPSSIFNL 466

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 60/174 (34%), Positives = 96/174 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L+  +PP  G+CS L+ L+LSSN  SG +P   L  +  L+ L LS N  SG +P  L 
Sbjct: 382 ALDNIIPPSLGNCSSLQDLSLSSNRLSGSIPHH-LGNLSSLQTLFLSSNRLSGSIPHHLG 440

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL  ++ TL++S+NN SG +  ++   P +     +   +G +G I  + +N S + SL 
Sbjct: 441 NLR-NIQTLEISNNNISGLLPSSIFNLPLSYFDFSFNTLSGISGSI--SKANMSHVESLD 497

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            + N  + +IP  + +L+KL  L    N L   IP  +  + +LE L+LD N+L
Sbjct: 498 FTTNMFT-SIPEGIKNLTKLTYLSFTDNYLIRTIPNFIGNLHSLEYLLLDSNNL 550

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 60/177 (33%), Positives = 87/177 (49%), Gaps = 24/177 (13%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
            +P F G+   LE L L SNN +G +P  +  L K+ GL + +   N  SG +P +++ L 
Sbjct: 530  IPNFIGNLHSLEYLLLDSNNLTGYIPHSISQLKKLFGLNIYN---NNISGSIPNNISGL- 585

Query: 203  ASLLTLDLSSNNFSGPILP----------------NLCQNPK------NTLQELYLQNNG 316
             SL  L LS NN  GPI                  NLC            L+ + L +N 
Sbjct: 586  VSLGHLILSRNNLVGPIPKGIGNCTFLTFFSAHSNNLCGTVPASLAYCTNLKLIDLSSNN 645

Query: 317  FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            FTG++P +LS  ++L  L + +N L G IP  + +L+ L  L L  N L G+IP +L
Sbjct: 646  FTGELPESLSFLNQLSVLSVGYNNLHGGIPKGITNLTMLHVLDLSNNKLSGKIPSDL 702

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 39/111 (35%), Positives = 55/111 (49%)
 Frame = +2

Query: 74   LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI 253
            LS+NN +GE+P  ++  +R L++L+LS N+  G +P SL N+S                 
Sbjct: 763  LSNNNLTGEIPA-SIGCLRSLRLLNLSGNQLEGVIPASLGNIS----------------- 804

Query: 254  LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
                      TL+EL L  N   G+IP  LS   EL  L +S N+L G IP
Sbjct: 805  ----------TLEELDLSKNHLKGEIPEGLSKLHELAVLDVSSNHLCGPIP 845

[140][TOP]
>UniRef100_B9HK56 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HK56_POPTR
          Length = 1033

 Score =  108 bits (270), Expect = 2e-22
 Identities = 77/169 (45%), Positives = 94/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+CSLLE L LS N+F+ ++P D    ++ L+ L LSFN  SGE+PESLT L  S
Sbjct: 109 IPSQLGNCSLLEHLDLSINSFTRKIP-DGFKYLQNLQYLSLSFNSLSGEIPESLTKLE-S 166

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N+  G I P    N KN L  L L  N F+G  P  L N S L  L +  ++
Sbjct: 167 LAELLLDHNSLEGRI-PTGFSNCKN-LDTLDLSFNSFSGGFPSDLGNFSSLAILAIINSH 224

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IPSS G L KL  L L  N L G IP EL   ++L TL L  N L
Sbjct: 225 LRGAIPSSFGHLKKLSYLDLSQNQLSGRIPPELGDCESLTTLNLYTNQL 273

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 67/171 (39%), Positives = 91/171 (53%), Gaps = 1/171 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+PP  G+CS L  + LS N  +G +P + L  +  L V+DLS N+  G LP  L+    
Sbjct: 443 PIPPSIGNCSGLTFIRLSMNKLTGSIPSE-LGNLINLLVVDLSSNQLEGSLPSQLSRCY- 500

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L   D+  N+ +G I P+  +N   +L  L L  N FTG IPP L     L  L L  N
Sbjct: 501 KLGQFDVGFNSLNGTI-PSSLRN-WTSLSTLVLSENHFTGGIPPFLPELGMLTELQLGGN 558

Query: 386 YLSGTIPSSLGSLSKLR-DLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L G IPSS+GS+  L+  L L  N   G++P EL  +K LE L +  N+L
Sbjct: 559 ILGGVIPSSIGSVRSLKYALNLSSNGFVGKLPSELGNLKMLERLDISNNNL 609

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 71/220 (32%), Positives = 109/220 (49%), Gaps = 45/220 (20%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           LS E+P+  +    + L+S+ + +N+ SGELP++ + ++R L+ + L+ N+F G +P++L
Sbjct: 297 LSGEIPISIW--KIASLKSIYVYNNSLSGELPLE-MTELRQLQNISLAQNQFYGVIPQTL 353

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNP---------------------------KNTL 289
             +++SLL LD   N F+G I PNLC                              + TL
Sbjct: 354 -GINSSLLWLDFFGNKFTGEIPPNLCYGQQLRILVMGSNQLQGSIPSDVGGCPTLWRLTL 412

Query: 290 QE----------------LYLQ--NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 415
           +E                LY+    N  TG IPP++ NCS L  + LS N L+G+IPS L
Sbjct: 413 EENNLSGTLPQFAENPILLYMDISKNNITGPIPPSIGNCSGLTFIRLSMNKLTGSIPSEL 472

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G+L  L  + L  N LEG +P +L     L    + FN L
Sbjct: 473 GNLINLLVVDLSSNQLEGSLPSQLSRCYKLGQFDVGFNSL 512

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 65/169 (38%), Positives = 90/169 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           L P  G    L+++ L ++NFSG++P   L     L+ LDLS N F+ ++P+    L  +
Sbjct: 85  LGPEIGLLKHLKTIDLHTSNFSGDIP-SQLGNCSLLEHLDLSINSFTRKIPDGFKYLQ-N 142

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS N+ SG I  +L +    +L EL L +N   G+IP   SNC  L +L LSFN 
Sbjct: 143 LQYLSLSFNSLSGEIPESLTK--LESLAELLLDHNSLEGRIPTGFSNCKNLDTLDLSFNS 200

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            SG  PS LG+ S L  L +  + L G IP    ++K L  L L  N L
Sbjct: 201 FSGGFPSDLGNFSSLAILAIINSHLRGAIPSSFGHLKKLSYLDLSQNQL 249

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 59/167 (35%), Positives = 78/167 (46%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP       L  L + SN   G +P D +     L  L L  N  SG LP+   N    
Sbjct: 373 IPPNLCYGQQLRILVMGSNQLQGSIPSD-VGGCPTLWRLTLEENNLSGTLPQFAEN--PI 429

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           LL +D+S NN +GPI P++     + L  + L  N  TG IP  L N   L+ + LS N 
Sbjct: 430 LLYMDISKNNITGPIPPSI--GNCSGLTFIRLSMNKLTGSIPSELGNLINLLVVDLSSNQ 487

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           L G++PS L    KL    +  N L G IP  L    +L TL+L  N
Sbjct: 488 LEGSLPSQLSRCYKLGQFDVGFNSLNGTIPSSLRNWTSLSTLVLSEN 534

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 63/173 (36%), Positives = 83/173 (47%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L+  +P   G C  L  L L  NN SG LP     +   L  +D+S N  +G +P S+ N
Sbjct: 393 LQGSIPSDVGGCPTLWRLTLEENNLSGTLPQ--FAENPILLYMDISKNNITGPIPPSIGN 450

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S  L  + LS N  +G I P+   N  N L  + L +N   G +P  LS C +L    +
Sbjct: 451 CSG-LTFIRLSMNKLTGSI-PSELGNLINLLV-VDLSSNQLEGSLPSQLSRCYKLGQFDV 507

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            FN L+GTIPSSL + + L  L L  N   G IP  L  +  L  L L  N L
Sbjct: 508 GFNSLNGTIPSSLRNWTSLSTLVLSENHFTGGIPPFLPELGMLTELQLGGNIL 560

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 56/129 (43%), Positives = 66/129 (51%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           L+LS    SG+L   +  L   L T+DL ++NFSG I   L     + L+ L L  N FT
Sbjct: 74  LNLSGYATSGQLGPEI-GLLKHLKTIDLHTSNFSGDIPSQL--GNCSLLEHLDLSINSFT 130

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
            KIP        L  L LSFN LSG IP SL  L  L +L L  N LEG IP      K 
Sbjct: 131 RKIPDGFKYLQNLQYLSLSFNSLSGEIPESLTKLESLAELLLDHNSLEGRIPTGFSNCKN 190

Query: 503 LETLILDFN 529
           L+TL L FN
Sbjct: 191 LDTLDLSFN 199

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 41/110 (37%), Positives = 58/110 (52%)
 Frame = +2

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           S+++L+LS    SG + P +       L+ + L  + F+G IP  L NCS L  L LS N
Sbjct: 70  SVVSLNLSGYATSGQLGPEI--GLLKHLKTIDLHTSNFSGDIPSQLGNCSLLEHLDLSIN 127

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             +  IP     L  L+ L L  N L GEIP+ L  +++L  L+LD N L
Sbjct: 128 SFTRKIPDGFKYLQNLQYLSLSFNSLSGEIPESLTKLESLAELLLDHNSL 177

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 42/108 (38%), Positives = 56/108 (51%), Gaps = 3/108 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLK-VLDLSFNEFSGELPESLTNLSA 205
           +PPF     +L  L L  N   G +P  ++  +R LK  L+LS N F G+LP  L NL  
Sbjct: 540 IPPFLPELGMLTELQLGGNILGGVIP-SSIGSVRSLKYALNLSSNGFVGKLPSELGNLKM 598

Query: 206 SLLTLDLSSNNFSGP--ILPNLCQNPKNTLQELYLQNNGFTGKIPPTL 343
            L  LD+S+NN +G   IL  +    K     + + NN FTG IP TL
Sbjct: 599 -LERLDISNNNLTGTLAILDYILSWDK-----VNVSNNHFTGAIPETL 640

[141][TOP]
>UniRef100_A7PJZ5 Chromosome chr12 scaffold_18, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PJZ5_VITVI
          Length = 1059

 Score =  108 bits (270), Expect = 2e-22
 Identities = 67/169 (39%), Positives = 93/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C  LE ++LS N F G +P   +  +  L+VL L  N   GE+P++L NLS S
Sbjct: 215 IPTSLGKCGRLEEISLSFNEFMGSIPRG-IGSLSVLEVLYLGSNNLEGEIPQTLFNLS-S 272

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L   +L SNN  G +  ++C +    LQ + L  N   G+IPP+LSNC EL  L LS N 
Sbjct: 273 LRNFELGSNNLGGILPADMCYSLPR-LQVINLSQNQLKGEIPPSLSNCGELQVLGLSINE 331

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             G IPS +G+LS +  + L  N L G IP     +  L+TL L+ N +
Sbjct: 332 FIGRIPSGIGNLSGIEKIYLGGNNLMGTIPSSFGNLSALKTLYLEKNKI 380

 Score =  104 bits (260), Expect = 4e-21
 Identities = 65/165 (39%), Positives = 93/165 (56%), Gaps = 1/165 (0%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           G+ S LE L L  N  +GE+P + +  +  LK+L    N  +  +P ++ N+S SL  + 
Sbjct: 123 GNLSKLEQLYLGGNQLTGEIPRE-ISHLLSLKILSFRSNNLTASIPSAIFNIS-SLQYIG 180

Query: 224 LSSNNFSGPILPNLCQN-PKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
           L+ N+ SG +  ++C + PK  L+ LYL  N  +GKIP +L  C  L  + LSFN   G+
Sbjct: 181 LTYNSLSGTLPMDMCYSLPK--LRGLYLSGNQLSGKIPTSLGKCGRLEEISLSFNEFMGS 238

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           IP  +GSLS L  L L  N LEGEIPQ L  + +L    L  N+L
Sbjct: 239 IPRGIGSLSVLEVLYLGSNNLEGEIPQTLFNLSSLRNFELGSNNL 283

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 65/197 (32%), Positives = 96/197 (48%), Gaps = 23/197 (11%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +LE  +P    + S L +  L SNN  G LP D    +  L+V++LS N+  GE+P SL+
Sbjct: 258 NLEGEIPQTLFNLSSLRNFELGSNNLGGILPADMCYSLPRLQVINLSQNQLKGEIPPSLS 317

Query: 194 NLSASLLTLDLSSNNFSGPI---LPNLCQNPK-------------------NTLQELYLQ 307
           N    L  L LS N F G I   + NL    K                   + L+ LYL+
Sbjct: 318 NCG-ELQVLGLSINEFIGRIPSGIGNLSGIEKIYLGGNNLMGTIPSSFGNLSALKTLYLE 376

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            N   G IP  L + SEL  L L+ N L+G++P ++ ++S L+ + L  N L G +P  +
Sbjct: 377 KNKIQGNIPKELGHLSELQYLSLASNILTGSVPEAIFNISNLQFIVLADNHLSGNLPSSI 436

Query: 488 -MYVKTLETLILDFNDL 535
              +  LE L++  N L
Sbjct: 437 GTSLPQLEELLIGGNYL 453

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 54/152 (35%), Positives = 80/152 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+   L+ L   +N  SG LP         L+ ++ S  +F G +P  + NL+ +
Sbjct: 481 VPKDLGNLRSLQHLGFGNNQLSGTLPNSLGNLSLSLQSINASACQFKGVIPAGIGNLT-N 539

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L L  N+ +G I   L Q  K  LQ LY+  N   G +P  + + + LV L LS N 
Sbjct: 540 LIELGLGDNDLTGMIPTTLGQLKK--LQRLYIAGNRIHGSVPNGIGHLANLVYLFLSSNQ 597

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 484
           LSG +PSSL SL++L  + L  N L G++P E
Sbjct: 598 LSGLVPSSLWSLNRLLVVNLSSNFLTGDLPHE 629

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 61/170 (35%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFG-SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           LP   G S   LE L +  N  SG +P  ++  +  L  LDLS+N  +G +P+ L NL  
Sbjct: 432 LPSSIGTSLPQLEELLIGGNYLSGIIPA-SISNITKLTRLDLSYNLLTGFVPKDLGNLR- 489

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SL  L   +N  SG  LPN   N   +LQ +      F G IP  + N + L+ L L  N
Sbjct: 490 SLQHLGFGNNQLSGT-LPNSLGNLSLSLQSINASACQFKGVIPAGIGNLTNLIELGLGDN 548

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G IP++LG L KL+ L +  N + G +P  + ++  L  L L  N L
Sbjct: 549 DLTGMIPTTLGQLKKLQRLYIAGNRIHGSVPNGIGHLANLVYLFLSSNQL 598

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 47/132 (35%), Positives = 72/132 (54%), Gaps = 1/132 (0%)
 Frame = +2

Query: 143 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 322
           LDLS  +  G +   + NLS  L+TLDLS+N+F   I   +     + L++LYL  N  T
Sbjct: 81  LDLSNMDLEGTIAPQVGNLSF-LVTLDLSNNSFHASIPNEIAIGNLSKLEQLYLGGNQLT 139

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY-VK 499
           G+IP  +S+   L  L    N L+ +IPS++ ++S L+ + L  N L G +P ++ Y + 
Sbjct: 140 GEIPREISHLLSLKILSFRSNNLTASIPSAIFNISSLQYIGLTYNSLSGTLPMDMCYSLP 199

Query: 500 TLETLILDFNDL 535
            L  L L  N L
Sbjct: 200 KLRGLYLSGNQL 211

[142][TOP]
>UniRef100_A5C1G0 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5C1G0_VITVI
          Length = 1904

 Score =  108 bits (270), Expect = 2e-22
 Identities = 74/170 (43%), Positives = 96/170 (56%), Gaps = 5/170 (2%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFS-GELP----MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           FG    L  L L+SN    GE      +++L+K R LKVLDLS ++F G LP S+ NLS 
Sbjct: 349 FGGMPNLWGLFLASNPLGKGEADDLSFLNSLMKCRALKVLDLSGSQFGGVLPNSIANLST 408

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L+ L L +N  SG I P +  N  N L +L L NN FTG IP  + N   L  + LS N
Sbjct: 409 QLMKLKLDNNQLSGTIPPGI-GNLVN-LTDLILANNDFTGSIPVLIGNLQMLGRIDLSRN 466

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG IPSSLG++++L  L L  N L G+IP     +  L+ L L +N L
Sbjct: 467 QLSGHIPSSLGNITRLYSLHLQNNHLSGKIPSSFGNLLYLQELDLSYNSL 516

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 60/169 (35%), Positives = 91/169 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           L P  G+ + L  L L  NNF G++P + L ++  L+ L+L+ N FSGE+P +L+  S +
Sbjct: 128 LSPSIGNLTFLTGLNLELNNFHGQIPQE-LGRLSRLRALNLTNNSFSGEIPANLSRCS-N 185

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+   L  NN  G I   L   PK    +L+  N   TG +P +L N + + SL  + N+
Sbjct: 186 LVYFRLGFNNLIGRIPSWLGSYPKVVRMQLHYNN--LTGPVPDSLGNLTSIKSLSFAVNH 243

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G+IP +LG L  L  + L +N   G IP  +  + +LE   L +N L
Sbjct: 244 LEGSIPQALGQLQTLEFMGLGMNGFSGIIPSSVYNMSSLEVFSLPYNKL 292

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 61/168 (36%), Positives = 97/168 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + L SL L +N+ SG++P  +   +  L+ LDLS+N  +G +PE + +L + 
Sbjct: 472 IPSSLGNITRLYSLHLQNNHLSGKIP-SSFGNLLYLQELDLSYNSLNGTIPEKVMDLVSL 530

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            ++L+L+ N  +G +LP+  +  KN L  L +  N  +G+IP  L +C  L  LH+  N+
Sbjct: 531 TISLNLARNQLTG-LLPSEVRKLKN-LGHLDVSENKLSGEIPDGLGSCLTLEHLHMEGNF 588

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             G+IP S  SL  L DL L  N L G+IP+ L  + +L  L L FN+
Sbjct: 589 FKGSIPPSFISLRGLLDLDLSRNNLSGQIPEFLQQL-SLSNLNLSFNN 635

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 63/175 (36%), Positives = 95/175 (54%)
 Frame = +2

Query: 11   LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
            L L   +PP  G+ S L ++ LS+N+F GE+P      +  +++L+L+ N   G++P +L
Sbjct: 1104 LGLVGSIPPLIGNLSFLRTINLSNNSFQGEVP-----PVVRMQILNLTNNWLEGQIPANL 1158

Query: 191  TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            +  S ++  L L +NNF G + P+   +  N LQ L++  N  TG I PT  N S L  L
Sbjct: 1159 SXCS-NMRILGLGNNNFWGEV-PSELGSLSNMLQ-LFIDYNSLTGTIAPTFGNLSSLRVL 1215

Query: 371  HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              + N L+G+IP SLG L  L  L L  N L G IP  +  + +L    + FN L
Sbjct: 1216 VAASNELNGSIPHSLGRLQSLVTLVLSTNQLSGTIPPSISNLTSLTQFGVAFNQL 1270

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 67/177 (37%), Positives = 87/177 (49%), Gaps = 8/177 (4%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMD---TLLKMR-----GLKVLDLSFNEFSGELPE 184
            +PP   + + L    ++ N   G LP+D   TL K+R      LK+L LS N F G LP 
Sbjct: 1250 IPPSISNLTSLTQFGVAFNQLKGSLPLDLWSTLSKLRLFSVHQLKILFLSDNNFGGVLPN 1309

Query: 185  SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
            SL NLS  L  L  ++N  SG I P    N  N +  L +  N FTG IP +  N  +L 
Sbjct: 1310 SLGNLSTQLQWLSFAANQISGNI-PTGIGNLANLIA-LDMHKNQFTGSIPTSNGNLHKLZ 1367

Query: 365  SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             +    N LSG IPSS+G+L+ L  L L  N  +  IP  L     L  L L  N+L
Sbjct: 1368 EVGFDKNKLSGVIPSSIGNLTLLNQLWLEENNFQXSIPSTLGNCHNLILLXLYGNNL 1424

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 60/155 (38%), Positives = 84/155 (54%)
 Frame = +2

Query: 14   SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
            + +  +P   G+C  L  L L  NN S ++P + +      K L+L+ N  SG LP  + 
Sbjct: 1399 NFQXSIPSTLGNCHNLILLXLYGNNLSXDIPREVIGLSSLAKSLNLARNSLSGLLPWEVG 1458

Query: 194  NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            NL  +L+ LD+S N  SG I  +L    +  L+ LY+ +N F G IP +L+    L  L 
Sbjct: 1459 NLR-NLVELDISQNQLSGDIPSSLGSCIR--LERLYMYDNSFGGDIPQSLNTLRGLEELD 1515

Query: 374  LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LS N LSG IP  L ++  LR+L L LN  EGEIP
Sbjct: 1516 LSHNNLSGEIPRYLATI-PLRNLNLSLNDFEGEIP 1549

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 59/159 (37%), Positives = 89/159 (55%), Gaps = 2/159 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           + +L LSS +  G L   ++  +  L  L+L  N F G++P+ L  LS  L  L+L++N+
Sbjct: 114 VNTLNLSSLHLVGSLS-PSIGNLTFLTGLNLELNNFHGQIPQELGRLSR-LRALNLTNNS 171

Query: 239 FSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           FSG I  NL  C N    L    L  N   G+IP  L +  ++V + L +N L+G +P S
Sbjct: 172 FSGEIPANLSRCSN----LVYFRLGFNNLIGRIPSWLGSYPKVVRMQLHYNNLTGPVPDS 227

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LG+L+ ++ L   +N LEG IPQ L  ++TLE + L  N
Sbjct: 228 LGNLTSIKSLSFAVNHLEGSIPQALGQLQTLEFMGLGMN 266

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 65/198 (32%), Positives = 96/198 (48%), Gaps = 29/198 (14%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S LE  +L  N   G LP D    +  L+VL++  N+F+G LP SL+N S +
Sbjct: 272 IPSSVYNMSSLEVFSLPYNKLYGSLPWDLAFTLPNLQVLNIGNNDFTGPLPSSLSNAS-N 330

Query: 209 LLTLDLSSNNFSGPI------LPN-----LCQNPK-----------------NTLQELYL 304
           LL  D++ +NF+G +      +PN     L  NP                    L+ L L
Sbjct: 331 LLEFDITMSNFTGKVSIDFGGMPNLWGLFLASNPLGKGEADDLSFLNSLMKCRALKVLDL 390

Query: 305 QNNGFTGKIPPTLSNCS-ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
             + F G +P +++N S +L+ L L  N LSGTIP  +G+L  L DL L  N   G IP 
Sbjct: 391 SGSQFGGVLPNSIANLSTQLMKLKLDNNQLSGTIPPGIGNLVNLTDLILANNDFTGSIPV 450

Query: 482 ELMYVKTLETLILDFNDL 535
            +  ++ L  + L  N L
Sbjct: 451 LIGNLQMLGRIDLSRNQL 468

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 58/169 (34%), Positives = 83/169 (49%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+   L+ +    N  SG +P  ++  +  L  L L  N F   +P +L N   +
Sbjct: 1356 IPTSNGNLHKLZEVGFDKNKLSGVIP-SSIGNLTLLNQLWLEENNFQXSIPSTLGNCH-N 1413

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L+ L L  NN S  I P       +  + L L  N  +G +P  + N   LV L +S N 
Sbjct: 1414 LILLXLYGNNLSXDI-PREVIGLSSLAKSLNLARNSLSGLLPWEVGNLRNLVELDISQNQ 1472

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG IPSSLGS  +L  L ++ N   G+IPQ L  ++ LE L L  N+L
Sbjct: 1473 LSGDIPSSLGSCIRLERLYMYDNSFGGDIPQSLNTLRGLEELDLSHNNL 1521

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 53/134 (39%), Positives = 72/134 (53%)
 Frame = +2

Query: 134 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
           +  L+LS     G L  S+ NL+  L  L+L  NNF G I   L +  +  L+ L L NN
Sbjct: 114 VNTLNLSSLHLVGSLSPSIGNLTF-LTGLNLELNNFHGQIPQELGRLSR--LRALNLTNN 170

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
            F+G+IP  LS CS LV   L FN L G IPS LGS  K+  ++L  N L G +P  L  
Sbjct: 171 SFSGEIPANLSRCSNLVYFRLGFNNLIGRIPSWLGSYPKVVRMQLHYNNLTGPVPDSLGN 230

Query: 494 VKTLETLILDFNDL 535
           + ++++L    N L
Sbjct: 231 LTSIKSLSFAVNHL 244

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 58/169 (34%), Positives = 80/169 (47%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+  +L  + LS N  SG +P  +L  +  L  L L  N  SG++P S  NL   
Sbjct: 448 IPVLIGNLQMLGRIDLSRNQLSGHIP-SSLGNITRLYSLHLQNNHLSGKIPSSFGNL-LY 505

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDLS N+ +G I P    +  +    L L  N  TG +P  +     L  L +S N 
Sbjct: 506 LQELDLSYNSLNGTI-PEKVMDLVSLTISLNLARNQLTGLLPSEVRKLKNLGHLDVSENK 564

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP  LGS   L  L +  N  +G IP   + ++ L  L L  N+L
Sbjct: 565 LSGEIPDGLGSCLTLEHLHMEGNFFKGSIPPSFISLRGLLDLDLSRNNL 613

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 51/141 (36%), Positives = 76/141 (53%), Gaps = 1/141 (0%)
 Frame = +2

Query: 17   LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
            LE  +P     CS +  L L +NNF GE+P + L  +  +  L + +N  +G +  +  N
Sbjct: 1150 LEGQIPANLSXCSNMRILGLGNNNFWGEVPSE-LGSLSNMLQLFIDYNSLTGTIAPTFGN 1208

Query: 197  LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            LS SL  L  +SN  +G I  +L +    +L  L L  N  +G IPP++SN + L    +
Sbjct: 1209 LS-SLRVLVAASNELNGSIPHSLGR--LQSLVTLVLSTNQLSGTIPPSISNLTSLTQFGV 1265

Query: 377  SFNYLSGTIPSSLGS-LSKLR 436
            +FN L G++P  L S LSKLR
Sbjct: 1266 AFNQLKGSLPLDLWSTLSKLR 1286

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 32/90 (35%), Positives = 42/90 (46%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
           C +    +  L L +    G + P++ N + L  L+L  N   G IP  LG LS+LR L 
Sbjct: 107 CGHRHQRVNTLNLSSLHLVGSLSPSIGNLTFLTGLNLELNNFHGQIPQELGRLSRLRALN 166

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N   GEIP  L     L    L FN+L
Sbjct: 167 LTNNSFSGEIPANLSRCSNLVYFRLGFNNL 196

[143][TOP]
>UniRef100_A3BD42 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3BD42_ORYSJ
          Length = 1119

 Score =  108 bits (270), Expect = 2e-22
 Identities = 69/173 (39%), Positives = 101/173 (58%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L+  +P  FG+   L++L L+ N  +G++P   L     L+ +DL  N  +G +PESL N
Sbjct: 176 LQGSIPSTFGNLPKLKTLVLARNRLTGDIP-PFLGSSVSLRYVDLGNNALTGSIPESLAN 234

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S+SL  L L SN+ SG +  +L     ++L  + LQ N F G IP   +  S +  L+L
Sbjct: 235 -SSSLQVLRLMSNSLSGQLPKSLLNT--SSLIAICLQQNSFVGSIPAVTAKSSPIKYLNL 291

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             NY+SG IPSSL +LS L  L+L  N L G IP+ L +++TLE L L+ N+L
Sbjct: 292 RNNYISGAIPSSLANLSSLLSLRLNENNLVGNIPESLGHIQTLEMLALNVNNL 344

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 71/171 (41%), Positives = 91/171 (53%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFS-GELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           L PFFGS   L  L +S N    G+   M +L     L  L L  N   G LP S+ NLS
Sbjct: 420 LIPFFGSLPNLNELDVSYNMLEPGDWGFMTSLSNCSRLTKLMLDGNNLQGNLPSSIGNLS 479

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           ++L  L L +N F GPI P+   N K+ L  L++  N FTG IPPT+ N + LV L  + 
Sbjct: 480 SNLEALWLKNNKFFGPI-PSEIGNLKS-LNRLFMDYNVFTGNIPPTIGNMNSLVVLSFAQ 537

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N LSG IP   G+LS+L DLKL  N   G+IP  +     L+ L +  N L
Sbjct: 538 NKLSGHIPDIFGNLSQLTDLKLDGNNFSGKIPASISQCTQLQILNIAHNSL 588

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 64/169 (37%), Positives = 95/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PPF GS   L  + L +N  +G +P ++L     L+VL L  N  SG+LP+SL N S S
Sbjct: 204 IPPFLGSSVSLRYVDLGNNALTGSIP-ESLANSSSLQVLRLMSNSLSGQLPKSLLNTS-S 261

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ + L  N+F G I     ++  + ++ L L+NN  +G IP +L+N S L+SL L+ N 
Sbjct: 262 LIAICLQQNSFVGSIPAVTAKS--SPIKYLNLRNNYISGAIPSSLANLSSLLSLRLNENN 319

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IP SLG +  L  L L +N L G +P  +  + +L  L +  N L
Sbjct: 320 LVGNIPESLGHIQTLEMLALNVNNLSGLVPPSIFNMSSLIFLAMANNSL 368

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 57/168 (33%), Positives = 92/168 (54%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  FG+ S L  L L  NNFSG++P  ++ +   L++L+++ N   G +P  +  +S+ 
Sbjct: 544  IPDIFGNLSQLTDLKLDGNNFSGKIPA-SISQCTQLQILNIAHNSLDGNIPSKIFEISSL 602

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               +DLS N  SG I PN   N  + L  L + NN  +GKIP +L  C  L  L +  N+
Sbjct: 603  SEEMDLSHNYLSGEI-PNEVGNLIH-LNRLVISNNMLSGKIPSSLGQCVVLEYLEIQNNF 660

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
              G+IP S  +L  ++ + +  N L G IP+ L  + +L +L L +N+
Sbjct: 661  FVGSIPQSFVNLVSIKRMDISQNNLSGNIPEFLTSLSSLHSLNLSYNN 708

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 67/173 (38%), Positives = 93/173 (53%), Gaps = 1/173 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LP    + S L ++ L  N+F G +P  T  K   +K L+L  N  SG +P SL 
Sbjct: 247 SLSGQLPKSLLNTSSLIAICLQQNSFVGSIPAVTA-KSSPIKYLNLRNNYISGAIPSSLA 305

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NLS SLL+L L+ NN  G I  +L      TL+ L L  N  +G +PP++ N S L+ L 
Sbjct: 306 NLS-SLLSLRLNENNLVGNIPESL--GHIQTLEMLALNVNNLSGLVPPSIFNMSSLIFLA 362

Query: 374 LSFNYLSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           ++ N L+G +PS +G +L K++ L L  N   G IP  L+    LE L L  N
Sbjct: 363 MANNSLTGRLPSDIGYTLPKIQGLILSTNKFVGPIPASLLNAYHLEMLYLGKN 415

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 68/195 (34%), Positives = 91/195 (46%), Gaps = 28/195 (14%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    LE LAL+ NN SG +P  ++  M  L  L ++ N  +G LP  +      
Sbjct: 324 IPESLGHIQTLEMLALNVNNLSGLVP-PSIFNMSSLIFLAMANNSLTGRLPSDIGYTLPK 382

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP------------------ 334
           +  L LS+N F GPI  +L       L+ LYL  N FTG IP                  
Sbjct: 383 IQGLILSTNKFVGPIPASLLN--AYHLEMLYLGKNSFTGLIPFFGSLPNLNELDVSYNML 440

Query: 335 --------PTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWL--NMLEGEIPQE 484
                    +LSNCS L  L L  N L G +PSS+G+LS   +  LWL  N   G IP E
Sbjct: 441 EPGDWGFMTSLSNCSRLTKLMLDGNNLQGNLPSSIGNLSSNLE-ALWLKNNKFFGPIPSE 499

Query: 485 LMYVKTLETLILDFN 529
           +  +K+L  L +D+N
Sbjct: 500 IGNLKSLNRLFMDYN 514

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 62/193 (32%), Positives = 93/193 (48%), Gaps = 23/193 (11%)
 Frame = +2

Query: 26   PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
            P+P   G+   L  L +  N F+G +P  T+  M  L VL  + N+ SG +P+   NLS 
Sbjct: 495  PIPSEIGNLKSLNRLFMDYNVFTGNIP-PTIGNMNSLVVLSFAQNKLSGHIPDIFGNLS- 552

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPK--------NTL---------------QELYLQNNG 316
             L  L L  NNFSG I  ++ Q  +        N+L               +E+ L +N 
Sbjct: 553  QLTDLKLDGNNFSGKIPASISQCTQLQILNIAHNSLDGNIPSKIFEISSLSEEMDLSHNY 612

Query: 317  FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
             +G+IP  + N   L  L +S N LSG IPSSLG    L  L++  N   G IPQ  + +
Sbjct: 613  LSGEIPNEVGNLIHLNRLVISNNMLSGKIPSSLGQCVVLEYLEIQNNFFVGSIPQSFVNL 672

Query: 497  KTLETLILDFNDL 535
             +++ + +  N+L
Sbjct: 673  VSIKRMDISQNNL 685

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 60/159 (37%), Positives = 82/159 (51%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L +L LS+N+F G +P   L  +  L  L+LS N   G +P  L++ S  L  L L +N+
Sbjct: 94  LTTLQLSNNSFHGSIP-SRLGLLSELNNLNLSMNSLEGNIPSELSSCS-QLEILGLWNNS 151

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
             G I  +L +     LQE+ L  N   G IP T  N  +L +L L+ N L+G IP  LG
Sbjct: 152 IQGEIPASLSKCIH--LQEINLSRNKLQGSIPSTFGNLPKLKTLVLARNRLTGDIPPFLG 209

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           S   LR + L  N L G IP+ L    +L+ L L  N L
Sbjct: 210 SSVSLRYVDLGNNALTGSIPESLANSSSLQVLRLMSNSL 248

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 53/138 (38%), Positives = 75/138 (54%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           ++ L+S   +G +    +  +  L  L LS N F G +P  L  LS  L  L+LS N+  
Sbjct: 72  AIDLASEGITGTISR-CIANLTSLTTLQLSNNSFHGSIPSRLGLLS-ELNNLNLSMNSLE 129

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I   L  +  + L+ L L NN   G+IP +LS C  L  ++LS N L G+IPS+ G+L
Sbjct: 130 GNIPSEL--SSCSQLEILGLWNNSIQGEIPASLSKCIHLQEINLSRNKLQGSIPSTFGNL 187

Query: 425 SKLRDLKLWLNMLEGEIP 478
            KL+ L L  N L G+IP
Sbjct: 188 PKLKTLVLARNRLTGDIP 205

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 45/109 (41%), Positives = 59/109 (54%)
 Frame = +2

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ +DL+S   +G I  + C     +L  L L NN F G IP  L   SEL +L+LS N 
Sbjct: 70  VIAIDLASEGITGTI--SRCIANLTSLTTLQLSNNSFHGSIPSRLGLLSELNNLNLSMNS 127

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G IPS L S S+L  L LW N ++GEIP  L     L+ + L  N L
Sbjct: 128 LEGNIPSELSSCSQLEILGLWNNSIQGEIPASLSKCIHLQEINLSRNKL 176

[144][TOP]
>UniRef100_A2ZBZ0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2ZBZ0_ORYSI
          Length = 1012

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/169 (42%), Positives = 97/169 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    + S LE L LS+N F G++P   L K++ L +++LS N   G +PES+ ++  +
Sbjct: 432 LPSSISNISNLEDLCLSTNLFGGKIPAG-LGKLQVLHLMELSDNNLLGSIPESIFSIP-T 489

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L    LS N   G  LP    N K  L  L+L  N  TG IP TLSNC  L  LHL  N+
Sbjct: 490 LTRCMLSFNKLDGA-LPTEIGNAKQ-LGSLHLSANKLTGHIPSTLSNCDSLEELHLDQNF 547

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IP+SLG++  L  + L  N L G IP  L  +++LE L L FN+L
Sbjct: 548 LNGSIPTSLGNMQSLTAVNLSYNDLSGSIPDSLGRLQSLEQLDLSFNNL 596

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 62/163 (38%), Positives = 89/163 (54%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +C+ L+ LAL  N   G++P         L+ L L  N+ SG  P  + NL  +L++L L
Sbjct: 341 NCTDLQVLALYDNKLKGQIPYSLGNLSIQLQYLFLGSNQLSGGFPSGIRNLP-NLISLGL 399

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
           + N+F+G I+P       N L+ +YL NN FTG +P ++SN S L  L LS N   G IP
Sbjct: 400 NENHFTG-IVPEWVGTLAN-LEGIYLDNNKFTGFLPSSISNISNLEDLCLSTNLFGGKIP 457

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           + LG L  L  ++L  N L G IP+ +  + TL   +L FN L
Sbjct: 458 AGLGKLQVLHLMELSDNNLLGSIPESIFSIPTLTRCMLSFNKL 500

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 58/150 (38%), Positives = 84/150 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G   +L  + LS NN  G +P +++  +  L    LSFN+  G LP  + N +  
Sbjct: 456 IPAGLGKLQVLHLMELSDNNLLGSIP-ESIFSIPTLTRCMLSFNKLDGALPTEIGN-AKQ 513

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L +L LS+N  +G I P+   N  ++L+EL+L  N   G IP +L N   L +++LS+N 
Sbjct: 514 LGSLHLSANKLTGHI-PSTLSNC-DSLEELHLDQNFLNGSIPTSLGNMQSLTAVNLSYND 571

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           LSG+IP SLG L  L  L L  N L GE+P
Sbjct: 572 LSGSIPDSLGRLQSLEQLDLSFNNLVGEVP 601

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 58/159 (36%), Positives = 85/159 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G  + L  L +S N   G +P D + KM  L  L +  N  SG  P +LTN+S S
Sbjct: 184 IPTSLGDVATLNILIVSYNYIEGSIP-DEIGKMPVLTNLYVGGNNLSGRFPLALTNIS-S 241

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L L  N F G + PNL  +    LQ L + +N F G +P ++SN + L ++  S NY
Sbjct: 242 LVELGLGFNYFHGGLPPNLGTSLPR-LQVLEIASNLFEGHLPYSISNATSLYTIDFSSNY 300

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            SG +PSS+G L +L  L L  N  E    ++L ++ +L
Sbjct: 301 FSGVVPSSIGMLKELSLLNLEWNQFESFNNKDLEFLHSL 339

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 58/167 (34%), Positives = 89/167 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           + P  G+ + LE L L++N  SG++P  +L  +  L+ L L+ N   G +P S  N SA 
Sbjct: 89  ISPSLGNLTSLEHLFLNTNQLSGQIP-PSLGHLHHLRSLYLANNTLQGNIP-SFANCSA- 145

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS N   G I  N+   P  ++ +L + +N  TG IP +L + + L  L +S+NY
Sbjct: 146 LKILHLSRNQIVGRIPKNVHLPP--SISQLIVNDNNLTGTIPTSLGDVATLNILIVSYNY 203

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           + G+IP  +G +  L +L +  N L G  P  L  + +L  L L FN
Sbjct: 204 IEGSIPDEIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVELGLGFN 250

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 62/164 (37%), Positives = 88/164 (53%), Gaps = 5/164 (3%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           S L  L L  N F G LP +    +  L+VL+++ N F G LP S++N + SL T+D SS
Sbjct: 240 SSLVELGLGFNYFHGGLPPNLGTSLPRLQVLEIASNLFEGHLPYSISN-ATSLYTIDFSS 298

Query: 233 NNFSGPILPNLCQNPKNTLQEL-YLQNNGFTGK---IPPTLSNCSELVSLHLSFNYLSGT 400
           N FSG +  ++    + +L  L + Q   F  K      +LSNC++L  L L  N L G 
Sbjct: 299 NYFSGVVPSSIGMLKELSLLNLEWNQFESFNNKDLEFLHSLSNCTDLQVLALYDNKLKGQ 358

Query: 401 IPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           IP SLG+LS +L+ L L  N L G  P  +  +  L +L L+ N
Sbjct: 359 IPYSLGNLSIQLQYLFLGSNQLSGGFPSGIRNLPNLISLGLNEN 402

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 58/160 (36%), Positives = 78/160 (48%), Gaps = 24/160 (15%)
 Frame = +2

Query: 128 RGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ 307
           R +  LDLS     G +  SL NL+ SL  L L++N  SG I P+L     + L+ LYL 
Sbjct: 73  RRVTSLDLSNRGLVGLISPSLGNLT-SLEHLFLNTNQLSGQIPPSL--GHLHHLRSLYLA 129

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNY------------------------LSGTIPSSL 415
           NN   G IP + +NCS L  LHLS N                         L+GTIP+SL
Sbjct: 130 NNTLQGNIP-SFANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSL 188

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G ++ L  L +  N +EG IP E+  +  L  L +  N+L
Sbjct: 189 GDVATLNILIVSYNYIEGSIPDEIGKMPVLTNLYVGGNNL 228

[145][TOP]
>UniRef100_UPI000198418F PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI000198418F
          Length = 1179

 Score =  108 bits (269), Expect = 3e-22
 Identities = 71/169 (42%), Positives = 95/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S L +++LS+NN SG LPMD       LK L+LS N  SG++P  L      
Sbjct: 163 IPATIFNISSLLNISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGKIPTGLGQC-IQ 221

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + L+ N+F+G I PN   N    LQ L L+NN  TG+IP  LS+C EL  L LS N 
Sbjct: 222 LQVISLAYNDFTGSI-PNGIGNLVE-LQRLSLRNNSLTGEIPSNLSHCRELRGLSLSINQ 279

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +G IP ++GSLS L +L L  N L G IP+E+  +  L  L L  N +
Sbjct: 280 FTGGIPQAIGSLSNLEELYLNYNKLTGGIPREIGNLSNLNILQLGSNGI 328

 Score =  100 bits (248), Expect = 9e-20
 Identities = 62/169 (36%), Positives = 96/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS S LE L L+ N  +G +P + +  +  L +L L  N  SG +P  +  +S S
Sbjct: 284 IPQAIGSLSNLEELYLNYNKLTGGIPRE-IGNLSNLNILQLGSNGISGPIPAEIFTVS-S 341

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +  ++N+ SG +  ++C++  N LQ LYL  N  +G++P TLS C EL+SL L  N 
Sbjct: 342 LQRIIFANNSLSGSLPMDICKHLPN-LQGLYLSQNHLSGQLPTTLSLCRELLSLALPMNK 400

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +G+IP  +G+LSKL ++ L  N L G IP     + TL+ L  + + L
Sbjct: 401 FTGSIPREIGNLSKLEEIDLSENSLIGSIPTSFGNLMTLKFLSFNISKL 449

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 71/221 (32%), Positives = 106/221 (47%), Gaps = 48/221 (21%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           + LE  + P  G+ S L SL LS+N F   +P D + K + L+ L+L  N+  G +PE++
Sbjct: 61  MGLEGTIAPQVGNLSFLVSLDLSNNYFHDSVPKD-IGKCKELQQLNLFNNKLVGGIPEAI 119

Query: 191 TNLS-----------------------------------------------ASLLTLDLS 229
            NLS                                               +SLL + LS
Sbjct: 120 CNLSKLEELYLGNNQLIGEIPKKMNHLQNLKVLSFPMNNLTGSIPATIFNISSLLNISLS 179

Query: 230 SNNFSGPILPNLC-QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
           +NN SG +  ++C  NPK  L+EL L +N  +GKIP  L  C +L  + L++N  +G+IP
Sbjct: 180 NNNLSGSLPMDMCYANPK--LKELNLSSNHLSGKIPTGLGQCIQLQVISLAYNDFTGSIP 237

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           + +G+L +L+ L L  N L GEIP  L + + L  L L  N
Sbjct: 238 NGIGNLVELQRLSLRNNSLTGEIPSNLSHCRELRGLSLSIN 278

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 63/157 (40%), Positives = 84/157 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  FG    L  L+L SN  +  +PM +   +R L VL+LS N  +G LP  + N+  S
Sbjct: 664  IPSCFGDLPALRELSLDSNVLAFNIPM-SFWSLRDLLVLNLSSNFLTGNLPPEVGNMK-S 721

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            + TLDLS N  SG I P+     +N +  L L  N   G IP    +   L SL LS N 
Sbjct: 722  ITTLDLSKNLVSGYI-PSRMGKLQNLIT-LSLSQNKLQGPIPVEFGDLVSLESLDLSQNN 779

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
            LSGTIP +L +L  L+ L +  N L+GEIP    +VK
Sbjct: 780  LSGTIPKTLEALIYLKYLNVSFNKLQGEIPNGGPFVK 816

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 60/169 (35%), Positives = 86/169 (50%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G    L++L++  N   G +P D L  ++ L  L LS+N+ SG +P    +L A 
Sbjct: 616  IPTTLGQLQKLQALSIVGNRIRGSIPND-LCHLKNLGYLRLSYNKLSGSIPSCFGDLPA- 673

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L L SN  +  I  +        L  L L +N  TG +PP + N   + +L LS N 
Sbjct: 674  LRELSLDSNVLAFNIPMSFWS--LRDLLVLNLSSNFLTGNLPPEVGNMKSITTLDLSKNL 731

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +SG IPS +G L  L  L L  N L+G IP E   + +LE+L L  N+L
Sbjct: 732  VSGYIPSRMGKLQNLITLSLSQNKLQGPIPVEFGDLVSLESLDLSQNNL 780

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 62/179 (34%), Positives = 91/179 (50%), Gaps = 11/179 (6%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    + S L+ +  ++N+ SG LPMD    +  L+ L LS N  SG+LP +L +L  
Sbjct: 331 PIPAEIFTVSSLQRIIFANNSLSGSLPMDICKHLPNLQGLYLSQNHLSGQLPTTL-SLCR 389

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS----------NCS 355
            LL+L L  N F+G I   +    K  L+E+ L  N   G IP +            N S
Sbjct: 390 ELLSLALPMNKFTGSIPREIGNLSK--LEEIDLSENSLIGSIPTSFGNLMTLKFLSFNIS 447

Query: 356 ELVSLHLSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           +L +L L  N+LSG++PSS+G+ L  L  L + +N   G IP  +  +  L  L L  N
Sbjct: 448 KLQTLGLVQNHLSGSLPSSIGTWLPDLEGLYIGINEFSGTIPMSISNMSKLTVLSLSDN 506

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 61/169 (36%), Positives = 87/169 (51%), Gaps = 10/169 (5%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L+ L LS N+ SG+LP  TL   R L  L L  N+F+G +P  + NLS  L  +DLS N+
Sbjct: 367 LQGLYLSQNHLSGQLPT-TLSLCRELLSLALPMNKFTGSIPREIGNLS-KLEEIDLSENS 424

Query: 239 FSGPILPNLCQNPK---------NTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNY 388
             G I P    N           + LQ L L  N  +G +P ++     +L  L++  N 
Sbjct: 425 LIGSI-PTSFGNLMTLKFLSFNISKLQTLGLVQNHLSGSLPSSIGTWLPDLEGLYIGINE 483

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            SGTIP S+ ++SKL  L L  N   G +P++L  +  L+ L L +N L
Sbjct: 484 FSGTIPMSISNMSKLTVLSLSDNSFTGNVPKDLCNLTKLQFLDLAYNQL 532

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 58/157 (36%), Positives = 80/157 (50%), Gaps = 9/157 (5%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS-- 202
           LP     C  L SLAL  N F+G +P + +  +  L+ +DLS N   G +P S  NL   
Sbjct: 381 LPTTLSLCRELLSLALPMNKFTGSIPRE-IGNLSKLEEIDLSENSLIGSIPTSFGNLMTL 439

Query: 203 -------ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL 361
                  + L TL L  N+ SG  LP+        L+ LY+  N F+G IP ++SN S+L
Sbjct: 440 KFLSFNISKLQTLGLVQNHLSGS-LPSSIGTWLPDLEGLYIGINEFSGTIPMSISNMSKL 498

Query: 362 VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 472
             L LS N  +G +P  L +L+KL+ L L  N L  E
Sbjct: 499 TVLSLSDNSFTGNVPKDLCNLTKLQFLDLAYNQLTDE 535

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 59/169 (34%), Positives = 88/169 (52%), Gaps = 8/169 (4%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           S L++L L  N+ SG LP      +  L+ L +  NEFSG +P S++N+S  L  L LS 
Sbjct: 447 SKLQTLGLVQNHLSGSLPSSIGTWLPDLEGLYIGINEFSGTIPMSISNMS-KLTVLSLSD 505

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGK-------IPPTLSNCSELVSLHLSFNYL 391
           N+F+G +  +LC   K  LQ L L  N  T +          +L+NC  L +L + +N L
Sbjct: 506 NSFTGNVPKDLCNLTK--LQFLDLAYNQLTDEHLASGVGFLTSLTNCKFLRNLWIGYNPL 563

Query: 392 SGTIPSSLGSLSKLRDLKL-WLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +GT+P+SLG+L    ++ +       G IP  +  +  L  L L  NDL
Sbjct: 564 TGTLPNSLGNLPIALEIFIASACQFRGTIPTGIGNLTNLIWLDLGANDL 612

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 34/90 (37%), Positives = 47/90 (52%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
           C  P+  +  + L N G  G I P + N S LVSL LS NY   ++P  +G   +L+ L 
Sbjct: 46  CNAPQQRVSAINLSNMGLEGTIAPQVGNLSFLVSLDLSNNYFHDSVPKDIGKCKELQQLN 105

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+ N L G IP+ +  +  LE L L  N L
Sbjct: 106 LFNNKLVGGIPEAICNLSKLEELYLGNNQL 135

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 38/106 (35%), Positives = 58/106 (54%)
 Frame = +2

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
           ++LS+    G I P +     + L  L L NN F   +P  +  C EL  L+L  N L G
Sbjct: 56  INLSNMGLEGTIAPQV--GNLSFLVSLDLSNNYFHDSVPKDIGKCKELQQLNLFNNKLVG 113

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            IP ++ +LSKL +L L  N L GEIP+++ +++ L+ L    N+L
Sbjct: 114 GIPEAICNLSKLEELYLGNNQLIGEIPKKMNHLQNLKVLSFPMNNL 159

[146][TOP]
>UniRef100_Q53PD2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=Q53PD2_ORYSJ
          Length = 2207

 Score =  108 bits (269), Expect = 3e-22
 Identities = 71/169 (42%), Positives = 97/169 (57%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            LP    + S LE L LS+N F G++P   L K++ L +++LS N   G +PES+ ++  +
Sbjct: 1716 LPSSISNISNLEDLRLSTNLFGGKIPAG-LGKLQVLHLMELSDNNLLGSIPESIFSIP-T 1773

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L    LS N   G  LP    N K  L  L+L  N  TG IP TLSNC  L  LHL  N+
Sbjct: 1774 LTRCMLSFNKLDGA-LPTEIGNAKQ-LGSLHLSANKLTGHIPSTLSNCDSLEELHLDQNF 1831

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G+IP+SLG++  L  + L  N L G IP  L  +++LE L L FN+L
Sbjct: 1832 LNGSIPTSLGNMQSLTAVNLSYNDLSGSIPDSLGRLQSLEQLDLSFNNL 1880

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 62/161 (38%), Positives = 89/161 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG    L  + +S N+ +G LP + + ++  +  +  SFN  SGELP  +   +  
Sbjct: 455 IPSSFGKLQFLTRIDISDNSLNGSLPKE-IFRIPTIAEVGFSFNNLSGELPTEV-GYAKQ 512

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L +L LSSNN SG I PN   N +N LQE+ L  N F G IP +L     L SL+LS N 
Sbjct: 513 LRSLHLSSNNLSGDI-PNTLGNCEN-LQEVVLDQNNFGGSIPASLGKLISLKSLNLSHNI 570

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLET 511
           L+G+IP SLG L  L  + L  N L G++P + ++  +  T
Sbjct: 571 LNGSIPVSLGDLELLEQIDLSFNHLSGQVPTKGIFKNSTAT 611

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 62/163 (38%), Positives = 87/163 (53%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +C+ L++L+++ N   G LP         L+ L L  N+ SG  P  + NL  +L+   L
Sbjct: 340 NCTQLQALSMAGNQLEGHLPNSVGNFSVQLQRLYLGQNQLSGSFPSGIENLP-NLIVFGL 398

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
             N F+G + P L      TLQ L L NN FTG IP +LSN S LV L+L  N L G IP
Sbjct: 399 DYNRFTGSVPPWL--GGLITLQVLSLTNNNFTGYIPSSLSNLSHLVELYLQSNQLLGNIP 456

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           SS G L  L  + +  N L G +P+E+  + T+  +   FN+L
Sbjct: 457 SSFGKLQFLTRIDISDNSLNGSLPKEIFRIPTIAEVGFSFNNL 499

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 62/163 (38%), Positives = 89/163 (54%)
 Frame = +2

Query: 47   SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
            +C+ L+ LAL  N   G++P         L+ L L  N+ SG  P  + NL  +L++L L
Sbjct: 1625 NCTDLQVLALYDNKLKGQIPYSLGNLSIQLQYLFLGSNQLSGGFPSGIRNLP-NLISLGL 1683

Query: 227  SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            + N+F+G I+P       N L+ +YL NN FTG +P ++SN S L  L LS N   G IP
Sbjct: 1684 NENHFTG-IVPEWVGTLAN-LEGIYLDNNKFTGFLPSSISNISNLEDLRLSTNLFGGKIP 1741

Query: 407  SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            + LG L  L  ++L  N L G IP+ +  + TL   +L FN L
Sbjct: 1742 AGLGKLQVLHLMELSDNNLLGSIPESIFSIPTLTRCMLSFNKL 1784

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 62/191 (32%), Positives = 93/191 (48%), Gaps = 22/191 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP+ G    L+ L+L++NNF+G +P  +L  +  L  L L  N+  G +P S   L   
Sbjct: 407 VPPWLGGLITLQVLSLTNNNFTGYIP-SSLSNLSHLVELYLQSNQLLGNIPSSFGKLQF- 464

Query: 209 LLTLDLSSNNFSGPILPNLCQNPK----------------------NTLQELYLQNNGFT 322
           L  +D+S N+ +G +   + + P                         L+ L+L +N  +
Sbjct: 465 LTRIDISDNSLNGSLPKEIFRIPTIAEVGFSFNNLSGELPTEVGYAKQLRSLHLSSNNLS 524

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G IP TL NC  L  + L  N   G+IP+SLG L  L+ L L  N+L G IP  L  ++ 
Sbjct: 525 GDIPNTLGNCENLQEVVLDQNNFGGSIPASLGKLISLKSLNLSHNILNGSIPVSLGDLEL 584

Query: 503 LETLILDFNDL 535
           LE + L FN L
Sbjct: 585 LEQIDLSFNHL 595

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 58/150 (38%), Positives = 84/150 (56%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G   +L  + LS NN  G +P +++  +  L    LSFN+  G LP  + N +  
Sbjct: 1740 IPAGLGKLQVLHLMELSDNNLLGSIP-ESIFSIPTLTRCMLSFNKLDGALPTEIGN-AKQ 1797

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L +L LS+N  +G I P+   N  ++L+EL+L  N   G IP +L N   L +++LS+N 
Sbjct: 1798 LGSLHLSANKLTGHI-PSTLSNC-DSLEELHLDQNFLNGSIPTSLGNMQSLTAVNLSYND 1855

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LSG+IP SLG L  L  L L  N L GE+P
Sbjct: 1856 LSGSIPDSLGRLQSLEQLDLSFNNLVGEVP 1885

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 58/159 (36%), Positives = 85/159 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G  + L  L +S N   G +P D + KM  L  L +  N  SG  P +LTN+S S
Sbjct: 1468 IPTSLGDVATLNILIVSYNYIEGSIP-DEIGKMPVLTNLYVGGNNLSGRFPLALTNIS-S 1525

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L+ L L  N F G + PNL  +    LQ L + +N F G +P ++SN + L ++  S NY
Sbjct: 1526 LVELGLGFNYFHGGLPPNLGTSLPR-LQVLEIASNLFEGHLPYSISNATSLYTIDFSSNY 1584

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
             SG +PSS+G L +L  L L  N  E    ++L ++ +L
Sbjct: 1585 FSGVVPSSIGMLKELSLLNLEWNQFESFNNKDLEFLHSL 1623

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 58/167 (34%), Positives = 89/167 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            + P  G+ + LE L L++N  SG++P  +L  +  L+ L L+ N   G +P S  N SA 
Sbjct: 1373 ISPSLGNLTSLEHLFLNTNQLSGQIP-PSLGHLHHLRSLYLANNTLQGNIP-SFANCSA- 1429

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L LS N   G I  N+   P  ++ +L + +N  TG IP +L + + L  L +S+NY
Sbjct: 1430 LKILHLSRNQIVGRIPKNVHLPP--SISQLIVNDNNLTGTIPTSLGDVATLNILIVSYNY 1487

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            + G+IP  +G +  L +L +  N L G  P  L  + +L  L L FN
Sbjct: 1488 IEGSIPDEIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVELGLGFN 1534

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 61/157 (38%), Positives = 90/157 (57%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           S+ LS+ N +G +   +L  +  LK L L+ NEF+G +PESL +L   L +L LS+N   
Sbjct: 78  SIDLSNQNLAGNIS-PSLGNLTFLKHLSLATNEFTGRIPESLGHLRR-LRSLYLSNNTLQ 135

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I+P+      + L+ L+L +N  TG +P  L     L  L +S N L GTIP SLG++
Sbjct: 136 G-IIPSFANC--SDLRVLWLDHNELTGGLPDGLP--LGLEELQVSSNTLVGTIPPSLGNV 190

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           + LR L+   N +EG IP EL  ++ +E L +  N L
Sbjct: 191 TTLRMLRFAFNGIEGGIPGELAALREMEILTIGGNRL 227

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 56/167 (33%), Positives = 87/167 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           + P  G+ + L+ L+L++N F+G +P ++L  +R L+ L LS N   G +P S  N S  
Sbjct: 90  ISPSLGNLTFLKHLSLATNEFTGRIP-ESLGHLRRLRSLYLSNNTLQGIIP-SFANCS-D 146

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N  +G +   L       L+EL + +N   G IPP+L N + L  L  +FN 
Sbjct: 147 LRVLWLDHNELTGGLPDGLPLG----LEELQVSSNTLVGTIPPSLGNVTTLRMLRFAFNG 202

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           + G IP  L +L ++  L +  N L G  P+ +M +  L  L L+ N
Sbjct: 203 IEGGIPGELAALREMEILTIGGNRLSGGFPEPIMNMSVLIRLSLETN 249

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 62/164 (37%), Positives = 88/164 (53%), Gaps = 5/164 (3%)
 Frame = +2

Query: 53   SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
            S L  L L  N F G LP +    +  L+VL+++ N F G LP S++N + SL T+D SS
Sbjct: 1524 SSLVELGLGFNYFHGGLPPNLGTSLPRLQVLEIASNLFEGHLPYSISN-ATSLYTIDFSS 1582

Query: 233  NNFSGPILPNLCQNPKNTLQEL-YLQNNGFTGK---IPPTLSNCSELVSLHLSFNYLSGT 400
            N FSG +  ++    + +L  L + Q   F  K      +LSNC++L  L L  N L G 
Sbjct: 1583 NYFSGVVPSSIGMLKELSLLNLEWNQFESFNNKDLEFLHSLSNCTDLQVLALYDNKLKGQ 1642

Query: 401  IPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            IP SLG+LS +L+ L L  N L G  P  +  +  L +L L+ N
Sbjct: 1643 IPYSLGNLSIQLQYLFLGSNQLSGGFPSGIRNLPNLISLGLNEN 1686

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 57/166 (34%), Positives = 87/166 (52%), Gaps = 7/166 (4%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           S+L  L+L +N FSG++P      +  L  L +  N F G LP SL N S +L+ LD+S 
Sbjct: 239 SVLIRLSLETNRFSGKMPSGIGTSLPNLWRLFIGGNFFQGNLPSSLANAS-NLVDLDISQ 297

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGK------IPPTLSNCSELVSLHLSFNYLS 394
           NNF G ++P       N L  L L+ N    +         +L+NC++L +L ++ N L 
Sbjct: 298 NNFVG-VVPAFIGKLAN-LTWLNLEMNQLHARSKQDWDFMDSLTNCTQLQALSMAGNQLE 355

Query: 395 GTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           G +P+S+G+ S +L+ L L  N L G  P  +  +  L    LD+N
Sbjct: 356 GHLPNSVGNFSVQLQRLYLGQNQLSGSFPSGIENLPNLIVFGLDYN 401

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 58/160 (36%), Positives = 78/160 (48%), Gaps = 24/160 (15%)
 Frame = +2

Query: 128  RGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ 307
            R +  LDLS     G +  SL NL+ SL  L L++N  SG I P+L     + L+ LYL 
Sbjct: 1357 RRVTSLDLSNRGLVGLISPSLGNLT-SLEHLFLNTNQLSGQIPPSL--GHLHHLRSLYLA 1413

Query: 308  NNGFTGKIPPTLSNCSELVSLHLSFNY------------------------LSGTIPSSL 415
            NN   G IP + +NCS L  LHLS N                         L+GTIP+SL
Sbjct: 1414 NNTLQGNIP-SFANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSL 1472

Query: 416  GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            G ++ L  L +  N +EG IP E+  +  L  L +  N+L
Sbjct: 1473 GDVATLNILIVSYNYIEGSIPDEIGKMPVLTNLYVGGNNL 1512

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 52/150 (34%), Positives = 70/150 (46%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L SL LS+N   G +P  +      L+VL L  NE +G LP+ L      
Sbjct: 114 IPESLGHLRRLRSLYLSNNTLQGIIP--SFANCSDLRVLWLDHNELTGGLPDGLP---LG 168

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L +SSN   G I P+L      TL+ L    NG  G IP  L+   E+  L +  N 
Sbjct: 169 LEELQVSSNTLVGTIPPSL--GNVTTLRMLRFAFNGIEGGIPGELAALREMEILTIGGNR 226

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           LSG  P  + ++S L  L L  N   G++P
Sbjct: 227 LSGGFPEPIMNMSVLIRLSLETNRFSGKMP 256

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 44/134 (32%), Positives = 60/134 (44%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F +L   LP   G    L SL LSSNN SG++P +TL     L+ + L  N F G +P S
Sbjct: 496 FNNLSGELPTEVGYAKQLRSLHLSSNNLSGDIP-NTLGNCENLQEVVLDQNNFGGSIPAS 554

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 367
           L  L                            +L+ L L +N   G IP +L +   L  
Sbjct: 555 LGKLI---------------------------SLKSLNLSHNILNGSIPVSLGDLELLEQ 587

Query: 368 LHLSFNYLSGTIPS 409
           + LSFN+LSG +P+
Sbjct: 588 IDLSFNHLSGQVPT 601

[147][TOP]
>UniRef100_C7J886 Os11g0569300 protein n=2 Tax=Oryza sativa Japonica Group
           RepID=C7J886_ORYSJ
          Length = 1071

 Score =  108 bits (269), Expect = 3e-22
 Identities = 67/168 (39%), Positives = 97/168 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + L SL L +N FSGE+P  T+  +  L  L+L+ N F+G +P  L N+ + 
Sbjct: 477 VPLAIGNLTKLSSLELQANAFSGEIP-STVANLTKLSALNLARNNFTGAIPRRLFNILSL 535

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              LD+S NN  G I P    N  N L+E + Q+N  +G+IPP+L  C  L +++L  N+
Sbjct: 536 SKILDISHNNLEGSI-PQEIGNLIN-LEEFHAQSNILSGEIPPSLGECQLLQNVYLQNNF 593

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L+GTI S+LG L  L  L L  N L G+IP+ L  +  L  L L FN+
Sbjct: 594 LNGTISSALGQLKGLESLDLSNNKLSGQIPRFLGNISMLSYLNLSFNN 641

 Score =  102 bits (254), Expect = 2e-20
 Identities = 64/158 (40%), Positives = 90/158 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G    LE++ L++N   G LP+ +L     L VL+L+ N+  GE+P ++     +
Sbjct: 131 IPPEIGRLGRLETVNLAANALQGTLPL-SLGNCTNLMVLNLTSNQLQGEIPSTIGARMVN 189

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDL  N FSG I  +L + P  +L+ L+L +N  +G+IP  LSN S L+ L L  N 
Sbjct: 190 LYILDLRQNGFSGEIPLSLAELP--SLEFLFLYSNKLSGEIPTALSNLSGLMHLDLDTNM 247

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           LSG IPSSLG LS L  L L  N L G IP  +  + +
Sbjct: 248 LSGAIPSSLGKLSSLIWLNLANNNLSGTIPSSIWNISS 285

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 55/159 (34%), Positives = 87/159 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S L  L L +N  SG +P  +L K+  L  L+L+ N  SG +P S+ N+S+S
Sbjct: 228 IPTALSNLSGLMHLDLDTNMLSGAIP-SSLGKLSSLIWLNLANNNLSGTIPSSIWNISSS 286

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L++  NN  G ++P         L+ + + NN F G++P +L N S +  L L FN+
Sbjct: 287 LWGLNIQQNNLVG-VVPTDAFTALPELRTISMDNNRFHGRLPTSLVNVSHVRMLQLGFNF 345

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            SGT+PS LG L  L    L+  +LE + P++  ++  L
Sbjct: 346 FSGTVPSELGMLKNLEQFLLFATLLEAKEPRDWEFITAL 384

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 64/169 (37%), Positives = 94/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           + PF  + S L  L L+ N  +GE+P + + ++  L+ ++L+ N   G LP SL N + +
Sbjct: 107 ISPFLANLSFLRELDLAGNQLAGEIPPE-IGRLGRLETVNLAANALQGTLPLSLGNCT-N 164

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L+L+SN   G I   +     N L  L L+ NGF+G+IP +L+    L  L L  N 
Sbjct: 165 LMVLNLTSNQLQGEIPSTIGARMVN-LYILDLRQNGFSGEIPLSLAELPSLEFLFLYSNK 223

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP++L +LS L  L L  NML G IP  L  + +L  L L  N+L
Sbjct: 224 LSGEIPTALSNLSGLMHLDLDTNMLSGAIPSSLGKLSSLIWLNLANNNL 272

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 70/174 (40%), Positives = 94/174 (54%), Gaps = 2/174 (1%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L+  LP   G+C+ L  L L+SN   GE+P     +M  L +LDL  N FSGE+P SL 
Sbjct: 150 ALQGTLPLSLGNCTNLMVLNLTSNQLQGEIPSTIGARMVNLYILDLRQNGFSGEIPLSLA 209

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            L  SL  L L SN  SG I P    N  + L  L L  N  +G IP +L   S L+ L+
Sbjct: 210 EL-PSLEFLFLYSNKLSGEI-PTALSN-LSGLMHLDLDTNMLSGAIPSSLGKLSSLIWLN 266

Query: 374 LSFNYLSGTIPSSLGSL-SKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDFN 529
           L+ N LSGTIPSS+ ++ S L  L +  N L G +P +    +  L T+ +D N
Sbjct: 267 LANNNLSGTIPSSIWNISSSLWGLNIQQNNLVGVVPTDAFTALPELRTISMDNN 320

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 61/155 (39%), Positives = 86/155 (55%), Gaps = 1/155 (0%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           LE L L SN  SGE+P   L  + GL  LDL  N  SG +P SL  LS SL+ L+L++NN
Sbjct: 214 LEFLFLYSNKLSGEIPT-ALSNLSGLMHLDLDTNMLSGAIPSSLGKLS-SLIWLNLANNN 271

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP-TLSNCSELVSLHLSFNYLSGTIPSSL 415
            SG I P+   N  ++L  L +Q N   G +P    +   EL ++ +  N   G +P+SL
Sbjct: 272 LSGTI-PSSIWNISSSLWGLNIQQNNLVGVVPTDAFTALPELRTISMDNNRFHGRLPTSL 330

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
            ++S +R L+L  N   G +P EL  +K LE  +L
Sbjct: 331 VNVSHVRMLQLGFNFFSGTVPSELGMLKNLEQFLL 365

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 61/169 (36%), Positives = 85/169 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP   G    L  L++  N  SG +P+  +  +  L  L+L  N FSGE+P ++ NL+  
Sbjct: 453 LPSSLGRLQNLNLLSVPKNKISGSVPL-AIGNLTKLSSLELQANAFSGEIPSTVANLT-K 510

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+L+ NNF+G I P    N  +  + L + +N   G IP  + N   L   H   N 
Sbjct: 511 LSALNLARNNFTGAI-PRRLFNILSLSKILDISHNNLEGSIPQEIGNLINLEEFHAQSNI 569

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP SLG    L+++ L  N L G I   L  +K LE+L L  N L
Sbjct: 570 LSGEIPPSLGECQLLQNVYLQNNFLNGTISSALGQLKGLESLDLSNNKL 618

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 62/178 (34%), Positives = 87/178 (48%), Gaps = 10/178 (5%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMD-----TLLKMRGLKVLDLSFNEFSGELPESLT 193
           +P   G    LE   L +     + P D      L     LK+L+L  ++F G LP+SL+
Sbjct: 350 VPSELGMLKNLEQFLLFATLLEAKEPRDWEFITALTNCSRLKILELGASKFGGVLPDSLS 409

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNT-----LQELYLQNNGFTGKIPPTLSNCSE 358
           NLS SL TL L  N  SG I       PK+      LQ L L +N F G +P +L     
Sbjct: 410 NLSTSLQTLSLQYNTISGRI-------PKDIGNLIGLQSLTLDDNSFIGTLPSSLGRLQN 462

Query: 359 LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L  L +  N +SG++P ++G+L+KL  L+L  N   GEIP  +  +  L  L L  N+
Sbjct: 463 LNLLSVPKNKISGSVPLAIGNLTKLSSLELQANAFSGEIPSTVANLTKLSALNLARNN 520

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 59/152 (38%), Positives = 78/152 (51%), Gaps = 2/152 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + + L +L L+ NNF+G +P      +   K+LD+S N   G +P+ + NL  +
Sbjct: 501 IPSTVANLTKLSALNLARNNFTGAIPRRLFNILSLSKILDISHNNLEGSIPQEIGNL-IN 559

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           L      SN  SG I P+L  CQ     LQ +YLQNN   G I   L     L SL LS 
Sbjct: 560 LEEFHAQSNILSGEIPPSLGECQ----LLQNVYLQNNFLNGTISSALGQLKGLESLDLSN 615

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           N LSG IP  LG++S L  L L  N   GE+P
Sbjct: 616 NKLSGQIPRFLGNISMLSYLNLSFNNFSGEVP 647

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 59/186 (31%), Positives = 87/186 (46%), Gaps = 29/186 (15%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL---TNLSASLL----- 214
           L ++++ +N F G LP  +L+ +  +++L L FN FSG +P  L    NL   LL     
Sbjct: 312 LRTISMDNNRFHGRLPT-SLVNVSHVRMLQLGFNFFSGTVPSELGMLKNLEQFLLFATLL 370

Query: 215 ---------------------TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI 331
                                 L+L ++ F G +LP+   N   +LQ L LQ N  +G+I
Sbjct: 371 EAKEPRDWEFITALTNCSRLKILELGASKFGG-VLPDSLSNLSTSLQTLSLQYNTISGRI 429

Query: 332 PPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLET 511
           P  + N   L SL L  N   GT+PSSLG L  L  L +  N + G +P  +  +  L +
Sbjct: 430 PKDIGNLIGLQSLTLDDNSFIGTLPSSLGRLQNLNLLSVPKNKISGSVPLAIGNLTKLSS 489

Query: 512 LILDFN 529
           L L  N
Sbjct: 490 LELQAN 495

[148][TOP]
>UniRef100_C5YC38 Putative uncharacterized protein Sb06g001310 n=1 Tax=Sorghum
           bicolor RepID=C5YC38_SORBI
          Length = 1172

 Score =  108 bits (269), Expect = 3e-22
 Identities = 72/174 (41%), Positives = 99/174 (56%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P   G+CS L ++ L  N+ SG LP  +L  +  L+ L L  N  +G +P+S  
Sbjct: 251 SLSGGIPAELGNCSNLTNVYLYENSLSGPLP-PSLGALPQLQKLLLWQNALTGPIPDSFG 309

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL+ SL++LDLS N  SG I P+L +     LQ+L L +N  TG IPP L+N + LV L 
Sbjct: 310 NLT-SLVSLDLSINAISGVIPPSLGRLA--ALQDLMLSDNNVTGTIPPELANATSLVQLQ 366

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +  N +SG +P  LG L+ L+ L  W N LEG IP  L  +  L+ L L  N L
Sbjct: 367 VDTNEISGLVPPELGRLTALQVLFAWQNQLEGAIPPTLASLSNLQALDLSHNHL 420

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 67/192 (34%), Positives = 95/192 (49%), Gaps = 24/192 (12%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS- 202
           P+PP  G+ S L++LAL+SN  SG +P +       L  L L  N  SG+LP SL +L  
Sbjct: 133 PIPPSLGNASALQTLALNSNQLSGSIPPELAYLAPTLTNLLLFDNRLSGDLPPSLGDLRL 192

Query: 203 -----------------------ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 313
                                  ++L+ L L+    SGP+  +L Q    +LQ L +   
Sbjct: 193 LESLRAGGNRELAGLIPESFSKLSNLVVLGLADTKISGPLPASLGQ--LQSLQTLSIYTT 250

Query: 314 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 493
             +G IP  L NCS L +++L  N LSG +P SLG+L +L+ L LW N L G IP     
Sbjct: 251 SLSGGIPAELGNCSNLTNVYLYENSLSGPLPPSLGALPQLQKLLLWQNALTGPIPDSFGN 310

Query: 494 VKTLETLILDFN 529
           + +L +L L  N
Sbjct: 311 LTSLVSLDLSIN 322

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 70/174 (40%), Positives = 90/174 (51%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL  PLPP  G+   L+ L L  N  +G +P D+   +  L  LDLS N  SG +P SL 
Sbjct: 275 SLSGPLPPSLGALPQLQKLLLWQNALTGPIP-DSFGNLTSLVSLDLSINAISGVIPPSLG 333

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            L+A L  L LS NN +G I P L      +L +L +  N  +G +PP L   + L  L 
Sbjct: 334 RLAA-LQDLMLSDNNVTGTIPPELAN--ATSLVQLQVDTNEISGLVPPELGRLTALQVLF 390

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
              N L G IP +L SLS L+ L L  N L G IP  L  ++ L  L+L  NDL
Sbjct: 391 AWQNQLEGAIPPTLASLSNLQALDLSHNHLTGVIPPGLFLLRNLTKLLLLSNDL 444

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 64/153 (41%), Positives = 93/153 (60%), Gaps = 3/153 (1%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P   G+CS L+ L LS+N+ +G LP ++L  + GL+ LD+S N  +G +P++L  L  
Sbjct: 495 PVPAELGNCSQLQMLDLSNNSLTGPLP-ESLAAVHGLQELDVSHNRLTGAVPDALGRLE- 552

Query: 206 SLLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL-VSLHL 376
           +L  L LS N+ SGPI P L  C+N    L+ L L +N  TG IP  L     L ++L+L
Sbjct: 553 TLSRLVLSGNSLSGPIPPALGKCRN----LELLDLSDNELTGNIPDELCGIDGLDIALNL 608

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 475
           S N L+G IP+ + +LSKL  L L  N L+G +
Sbjct: 609 SRNGLTGPIPAKISALSKLSVLDLSYNTLDGSL 641

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 66/170 (38%), Positives = 87/170 (51%), Gaps = 2/170 (1%)
 Frame = +2

Query: 5   LFLSLEL--PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGEL 178
           L LS +L  PLPP  G  + L  L L  N  +G +P   +  M+ +  LDL  N  +G +
Sbjct: 438 LLLSNDLSGPLPPEIGKAASLVRLRLGGNRIAGSIPA-AVAGMKSINFLDLGSNRLAGPV 496

Query: 179 PESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSE 358
           P  L N S  L  LDLS+N+ +GP+  +L     + LQEL + +N  TG +P  L     
Sbjct: 497 PAELGNCS-QLQMLDLSNNSLTGPLPESLAA--VHGLQELDVSHNRLTGAVPDALGRLET 553

Query: 359 LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE 508
           L  L LS N LSG IP +LG    L  L L  N L G IP EL  +  L+
Sbjct: 554 LSRLVLSGNSLSGPIPPALGKCRNLELLDLSDNELTGNIPDELCGIDGLD 603

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 65/168 (38%), Positives = 90/168 (53%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P  FG+ + L SL LS N  SG +P  +L ++  L+ L LS N  +G +P  L N + 
Sbjct: 303 PIPDSFGNLTSLVSLDLSINAISGVIP-PSLGRLAALQDLMLSDNNVTGTIPPELAN-AT 360

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SL+ L + +N  SG + P L +     LQ L+   N   G IPPTL++ S L +L LS N
Sbjct: 361 SLVQLQVDTNEISGLVPPELGR--LTALQVLFAWQNQLEGAIPPTLASLSNLQALDLSHN 418

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           +L+G IP  L  L  L  L L  N L G +P E+    +L  L L  N
Sbjct: 419 HLTGVIPPGLFLLRNLTKLLLLSNDLSGPLPPEIGKAASLVRLRLGGN 466

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 70/195 (35%), Positives = 91/195 (46%), Gaps = 28/195 (14%)
 Frame = +2

Query: 35  PFFGSCSLLESLA---LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P  G C+ L  L    +S  N +G +P D L + R L VLD+S N  +G +P SL N SA
Sbjct: 85  PATGLCAALPGLVSFVVSDANLTGAVP-DDLWRCRRLAVLDVSGNALTGPIPPSLGNASA 143

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL-------------- 343
            L TL L+SN  SG I P L      TL  L L +N  +G +PP+L              
Sbjct: 144 -LQTLALNSNQLSGSIPPELAYLAP-TLTNLLLFDNRLSGDLPPSLGDLRLLESLRAGGN 201

Query: 344 -----------SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM 490
                      S  S LV L L+   +SG +P+SLG L  L+ L ++   L G IP EL 
Sbjct: 202 RELAGLIPESFSKLSNLVVLGLADTKISGPLPASLGQLQSLQTLSIYTTSLSGGIPAELG 261

Query: 491 YVKTLETLILDFNDL 535
               L  + L  N L
Sbjct: 262 NCSNLTNVYLYENSL 276

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 56/169 (33%), Positives = 89/169 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   + + L  L + +N  SG +P + L ++  L+VL    N+  G +P +L +LS +
Sbjct: 352 IPPELANATSLVQLQVDTNEISGLVPPE-LGRLTALQVLFAWQNQLEGAIPPTLASLS-N 409

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDLS N+ +G I P L       L +L L +N  +G +PP +   + LV L L  N 
Sbjct: 410 LQALDLSHNHLTGVIPPGLFL--LRNLTKLLLLSNDLSGPLPPEIGKAASLVRLRLGGNR 467

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++G+IP+++  +  +  L L  N L G +P EL     L+ L L  N L
Sbjct: 468 IAGSIPAAVAGMKSINFLDLGSNRLAGPVPAELGNCSQLQMLDLSNNSL 516

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/128 (35%), Positives = 66/128 (51%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L  L LS N+ SG +P   L K R L++LDLS NE +G +P+ L  +   
Sbjct: 544 VPDALGRLETLSRLVLSGNSLSGPIP-PALGKCRNLELLDLSDNELTGNIPDELCGIDGL 602

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            + L+LS N  +GPI   +    K  L  L L  N   G + P L+    LV+L++S N 
Sbjct: 603 DIALNLSRNGLTGPIPAKISALSK--LSVLDLSYNTLDGSLAP-LAGLDNLVTLNVSNNN 659

Query: 389 LSGTIPSS 412
            SG +P +
Sbjct: 660 FSGYLPDT 667

[149][TOP]
>UniRef100_C5XPC8 Putative uncharacterized protein Sb03g005740 n=1 Tax=Sorghum
           bicolor RepID=C5XPC8_SORBI
          Length = 1038

 Score =  108 bits (269), Expect = 3e-22
 Identities = 71/169 (42%), Positives = 99/169 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           L P  G+ S L +L LSSN FSG +P D+L ++R L+ LDLS+N FSG++P +L++ + S
Sbjct: 89  LSPAVGNLSFLTTLNLSSNAFSGGIP-DSLGRLRRLQELDLSYNAFSGKVPANLSSCT-S 146

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ + L  N  +G +     +   N L  L + NN  TG IP +L+N S L  L L+FN 
Sbjct: 147 LVLMRLRFNQLTGSVPREFGEKLVN-LMVLSVWNNSLTGTIPASLANLSSLSILSLAFNQ 205

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L GTIP  LG +  LR L L  N L GE P  L  + +LE   ++ N L
Sbjct: 206 LHGTIPPGLGGIQALRHLDLNNNHLSGEPPHSLYNLSSLERFQINDNML 254

 Score =  102 bits (253), Expect = 2e-20
 Identities = 68/170 (40%), Positives = 94/170 (55%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P   G+   L +L LS N  +G +  + + K+  L  L+LS+N  SG LP  +++L  
Sbjct: 457 PIPASIGNIENLWTLDLSKNFLNGSISNE-IFKLPSLVYLNLSYNSLSGHLPSEMSSLG- 514

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           +L  L LS N  SG I  ++ +     LQ L L NN F G IP TLSN   L +L LS N
Sbjct: 515 NLNQLVLSGNQLSGEIPESIGEC--TVLQYLGLDNNSFDGSIPQTLSNLKGLTALSLSMN 572

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G IPS++G++  L+ L L  N L G IP  L  +  L  L L FN+L
Sbjct: 573 KLTGAIPSNIGTIQDLQVLYLAHNNLSGPIPSLLQNLTALSELDLSFNNL 622

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 58/164 (35%), Positives = 90/164 (54%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P    + S L  L+L+ N   G +P   L  ++ L+ LDL+ N  SGE P SL 
Sbjct: 181 SLTGTIPASLANLSSLSILSLAFNQLHGTIPPG-LGGIQALRHLDLNNNHLSGEPPHSLY 239

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NLS SL    ++ N   G I P++  +  +++ EL    N FTG IP +L N + L  L 
Sbjct: 240 NLS-SLERFQINDNMLHGRI-PDVIGSKFHSMLELEFYANHFTGSIPVSLFNLTTLQMLD 297

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
           LS N+L G +PS++G L  L+ L L+ N+L+ +  +   ++ +L
Sbjct: 298 LSENWLRGYVPSAIGRLVALQSLSLYRNLLQADGKEGWEFITSL 341

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 52/131 (39%), Positives = 68/131 (51%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LP    S   L  L LS N  SGE+P +++ +   L+ L L  N F G +P++L+
Sbjct: 501 SLSGHLPSEMSSLGNLNQLVLSGNQLSGEIP-ESIGECTVLQYLGLDNNSFDGSIPQTLS 559

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL   L  L LS N  +G I  N+       LQ LYL +N  +G IP  L N + L  L 
Sbjct: 560 NLKG-LTALSLSMNKLTGAIPSNI--GTIQDLQVLYLAHNNLSGPIPSLLQNLTALSELD 616

Query: 374 LSFNYLSGTIP 406
           LSFN L G +P
Sbjct: 617 LSFNNLQGEVP 627

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 52/169 (30%), Positives = 85/169 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    + S L+ L    +  SG +P   +  +  L+VL +S    SG +PES++ L  +
Sbjct: 362 LPSSIANLSSLQMLRFDGSGISGSIP-SAISSLLNLQVLGMSSTFISGVIPESISRLG-N 419

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DL + + SG I  ++    +  + + +  N  F G IP ++ N   L +L LS N+
Sbjct: 420 LSVIDLFNTDLSGIIPLSIGNLTRLIVFDAHHCN--FGGPIPASIGNIENLWTLDLSKNF 477

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+I + +  L  L  L L  N L G +P E+  +  L  L+L  N L
Sbjct: 478 LNGSISNEIFKLPSLVYLNLSYNSLSGHLPSEMSSLGNLNQLVLSGNQL 526

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 54/200 (27%), Positives = 89/200 (44%), Gaps = 31/200 (15%)
 Frame = +2

Query: 8   FLSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 187
           F  L   +PP  G    L  L L++N+ SGE P  +L  +  L+   ++ N   G +P+ 
Sbjct: 203 FNQLHGTIPPGLGGIQALRHLDLNNNHLSGE-PPHSLYNLSSLERFQINDNMLHGRIPDV 261

Query: 188 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP----------- 334
           + +   S+L L+  +N+F+G I  +L      TLQ L L  N   G +P           
Sbjct: 262 IGSKFHSMLELEFYANHFTGSIPVSLFN--LTTLQMLDLSENWLRGYVPSAIGRLVALQS 319

Query: 335 -------------------PTLSNCSELVSLHLSFNY-LSGTIPSSLGSLSKLRDLKLWL 454
                               +LSNC++L    +  N  L+G +PSS+ +LS L+ L+   
Sbjct: 320 LSLYRNLLQADGKEGWEFITSLSNCTQLTQFEIGLNAGLTGQLPSSIANLSSLQMLRFDG 379

Query: 455 NMLEGEIPQELMYVKTLETL 514
           + + G IP  +  +  L+ L
Sbjct: 380 SGISGSIPSAISSLLNLQVL 399

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 55/177 (31%), Positives = 91/177 (51%), Gaps = 8/177 (4%)
 Frame = +2

Query: 29  LPPFFGSC--SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           +P   GS   S+LE L   +N+F+G +P+ +L  +  L++LDLS N   G +P ++  L 
Sbjct: 258 IPDVIGSKFHSMLE-LEFYANHFTGSIPV-SLFNLTTLQMLDLSENWLRGYVPSAIGRLV 315

Query: 203 ASLLTLDLSSNNFSGP------ILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
           A L +L L  N            + +L    + T  E+ L N G TG++P +++N S L 
Sbjct: 316 A-LQSLSLYRNLLQADGKEGWEFITSLSNCTQLTQFEIGL-NAGLTGQLPSSIANLSSLQ 373

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L    + +SG+IPS++ SL  L+ L +    + G IP+ +  +  L  + L   DL
Sbjct: 374 MLRFDGSGISGSIPSAISSLLNLQVLGMSSTFISGVIPESISRLGNLSVIDLFNTDL 430

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 33/90 (36%), Positives = 47/90 (52%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
           C      +  L L  +G +G + P + N S L +L+LS N  SG IP SLG L +L++L 
Sbjct: 68  CGTRHRRVVALSLPLHGLSGALSPAVGNLSFLTTLNLSSNAFSGGIPDSLGRLRRLQELD 127

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N   G++P  L    +L  + L FN L
Sbjct: 128 LSYNAFSGKVPANLSSCTSLVLMRLRFNQL 157

[150][TOP]
>UniRef100_Q2R9X8 Leucine Rich Repeat family protein, expressed n=3 Tax=Oryza sativa
           Japonica Group RepID=Q2R9X8_ORYSJ
          Length = 1012

 Score =  108 bits (269), Expect = 3e-22
 Identities = 71/169 (42%), Positives = 97/169 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP    + S LE L LS+N F G++P   L K++ L +++LS N   G +PES+ ++  +
Sbjct: 432 LPSSISNISNLEDLRLSTNLFGGKIPAG-LGKLQVLHLMELSDNNLLGSIPESIFSIP-T 489

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L    LS N   G  LP    N K  L  L+L  N  TG IP TLSNC  L  LHL  N+
Sbjct: 490 LTRCMLSFNKLDGA-LPTEIGNAKQ-LGSLHLSANKLTGHIPSTLSNCDSLEELHLDQNF 547

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IP+SLG++  L  + L  N L G IP  L  +++LE L L FN+L
Sbjct: 548 LNGSIPTSLGNMQSLTAVNLSYNDLSGSIPDSLGRLQSLEQLDLSFNNL 596

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 62/163 (38%), Positives = 89/163 (54%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +C+ L+ LAL  N   G++P         L+ L L  N+ SG  P  + NL  +L++L L
Sbjct: 341 NCTDLQVLALYDNKLKGQIPYSLGNLSIQLQYLFLGSNQLSGGFPSGIRNLP-NLISLGL 399

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
           + N+F+G I+P       N L+ +YL NN FTG +P ++SN S L  L LS N   G IP
Sbjct: 400 NENHFTG-IVPEWVGTLAN-LEGIYLDNNKFTGFLPSSISNISNLEDLRLSTNLFGGKIP 457

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           + LG L  L  ++L  N L G IP+ +  + TL   +L FN L
Sbjct: 458 AGLGKLQVLHLMELSDNNLLGSIPESIFSIPTLTRCMLSFNKL 500

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 58/150 (38%), Positives = 84/150 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G   +L  + LS NN  G +P +++  +  L    LSFN+  G LP  + N +  
Sbjct: 456 IPAGLGKLQVLHLMELSDNNLLGSIP-ESIFSIPTLTRCMLSFNKLDGALPTEIGN-AKQ 513

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L +L LS+N  +G I P+   N  ++L+EL+L  N   G IP +L N   L +++LS+N 
Sbjct: 514 LGSLHLSANKLTGHI-PSTLSNC-DSLEELHLDQNFLNGSIPTSLGNMQSLTAVNLSYND 571

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           LSG+IP SLG L  L  L L  N L GE+P
Sbjct: 572 LSGSIPDSLGRLQSLEQLDLSFNNLVGEVP 601

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 58/159 (36%), Positives = 85/159 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G  + L  L +S N   G +P D + KM  L  L +  N  SG  P +LTN+S S
Sbjct: 184 IPTSLGDVATLNILIVSYNYIEGSIP-DEIGKMPVLTNLYVGGNNLSGRFPLALTNIS-S 241

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ L L  N F G + PNL  +    LQ L + +N F G +P ++SN + L ++  S NY
Sbjct: 242 LVELGLGFNYFHGGLPPNLGTSLPR-LQVLEIASNLFEGHLPYSISNATSLYTIDFSSNY 300

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            SG +PSS+G L +L  L L  N  E    ++L ++ +L
Sbjct: 301 FSGVVPSSIGMLKELSLLNLEWNQFESFNNKDLEFLHSL 339

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 58/167 (34%), Positives = 89/167 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           + P  G+ + LE L L++N  SG++P  +L  +  L+ L L+ N   G +P S  N SA 
Sbjct: 89  ISPSLGNLTSLEHLFLNTNQLSGQIP-PSLGHLHHLRSLYLANNTLQGNIP-SFANCSA- 145

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS N   G I  N+   P  ++ +L + +N  TG IP +L + + L  L +S+NY
Sbjct: 146 LKILHLSRNQIVGRIPKNVHLPP--SISQLIVNDNNLTGTIPTSLGDVATLNILIVSYNY 203

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           + G+IP  +G +  L +L +  N L G  P  L  + +L  L L FN
Sbjct: 204 IEGSIPDEIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVELGLGFN 250

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 62/164 (37%), Positives = 88/164 (53%), Gaps = 5/164 (3%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           S L  L L  N F G LP +    +  L+VL+++ N F G LP S++N + SL T+D SS
Sbjct: 240 SSLVELGLGFNYFHGGLPPNLGTSLPRLQVLEIASNLFEGHLPYSISN-ATSLYTIDFSS 298

Query: 233 NNFSGPILPNLCQNPKNTLQEL-YLQNNGFTGK---IPPTLSNCSELVSLHLSFNYLSGT 400
           N FSG +  ++    + +L  L + Q   F  K      +LSNC++L  L L  N L G 
Sbjct: 299 NYFSGVVPSSIGMLKELSLLNLEWNQFESFNNKDLEFLHSLSNCTDLQVLALYDNKLKGQ 358

Query: 401 IPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           IP SLG+LS +L+ L L  N L G  P  +  +  L +L L+ N
Sbjct: 359 IPYSLGNLSIQLQYLFLGSNQLSGGFPSGIRNLPNLISLGLNEN 402

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 58/160 (36%), Positives = 78/160 (48%), Gaps = 24/160 (15%)
 Frame = +2

Query: 128 RGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ 307
           R +  LDLS     G +  SL NL+ SL  L L++N  SG I P+L     + L+ LYL 
Sbjct: 73  RRVTSLDLSNRGLVGLISPSLGNLT-SLEHLFLNTNQLSGQIPPSL--GHLHHLRSLYLA 129

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNY------------------------LSGTIPSSL 415
           NN   G IP + +NCS L  LHLS N                         L+GTIP+SL
Sbjct: 130 NNTLQGNIP-SFANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSL 188

Query: 416 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G ++ L  L +  N +EG IP E+  +  L  L +  N+L
Sbjct: 189 GDVATLNILIVSYNYIEGSIPDEIGKMPVLTNLYVGGNNL 228

[151][TOP]
>UniRef100_B9FTY2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FTY2_ORYSJ
          Length = 1126

 Score =  108 bits (269), Expect = 3e-22
 Identities = 70/169 (41%), Positives = 97/169 (57%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG+   ++ + L+SN  +G++P  +L     L  +DL  N+ +G +PESL N S+S
Sbjct: 188 IPSDFGNLPKMQIIVLASNRLTGDIP-PSLGSGHSLTYVDLGSNDLTGSIPESLVN-SSS 245

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L+SN  SG  LP    N  ++L  +YL  N F G IPP  +    L  L+L  N 
Sbjct: 246 LQVLVLTSNTLSGE-LPKALFN-SSSLIAIYLDENSFVGSIPPATAISLPLKYLYLGGNK 303

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSGTIPSSLG+LS L DL L  N L G +P  L  +  L+ L L+ N+L
Sbjct: 304 LSGTIPSSLGNLSSLLDLSLTRNNLVGNVPDSLGLIPKLDLLNLNANNL 352

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 69/171 (40%), Positives = 88/171 (51%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGE--LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           L PFFGS   L+ L LS N         + +L     L  L +  N   G+LP S+ NLS
Sbjct: 428 LIPFFGSLKNLKELMLSYNKLEAADWSFISSLSNCSKLTKLLIDGNNLKGKLPHSIGNLS 487

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           +SL  L +  N  SG I P +      +L+ LY+  N  TG IPPT+ N   LV L ++ 
Sbjct: 488 SSLKWLWIRDNKISGNIPPEI--GNLKSLEMLYMDYNLLTGDIPPTIGNLHNLVVLAIAQ 545

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N LSG IP ++G+L KL DLKL  N   G IP  L +   LE L L  N L
Sbjct: 546 NKLSGQIPDTIGNLVKLTDLKLDRNNFSGGIPVTLEHCTQLEILNLAHNSL 596

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 65/169 (38%), Positives = 94/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  GS   L  + L SN+ +G +P ++L+    L+VL L+ N  SGELP++L N S+S
Sbjct: 212 IPPSLGSGHSLTYVDLGSNDLTGSIP-ESLVNSSSLQVLVLTSNTLSGELPKALFN-SSS 269

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+ + L  N+F G I P    +    L+ LYL  N  +G IP +L N S L+ L L+ N 
Sbjct: 270 LIAIYLDENSFVGSIPPATAISLP--LKYLYLGGNKLSGTIPSSLGNLSSLLDLSLTRNN 327

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G +P SLG + KL  L L  N L G +P  +  + +L  L +  N L
Sbjct: 328 LVGNVPDSLGLIPKLDLLNLNANNLIGHVPSSIFNMSSLTILTMANNSL 376

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 64/172 (37%), Positives = 93/172 (54%), Gaps = 3/172 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L  L+L+ NN  G +P D+L  +  L +L+L+ N   G +P S+ N+S S
Sbjct: 308 IPSSLGNLSSLLDLSLTRNNLVGNVP-DSLGLIPKLDLLNLNANNLIGHVPSSIFNMS-S 365

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L +++N+  G +  NL     N ++ L L NN F G IPPTL N S+L  L++  N 
Sbjct: 366 LTILTMANNSLIGELPSNLGYTLPN-IETLVLSNNRFKGFIPPTLLNASDLSLLYMRNNS 424

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEG---EIPQELMYVKTLETLILDFNDL 535
           L+G IP   GSL  L++L L  N LE         L     L  L++D N+L
Sbjct: 425 LTGLIP-FFGSLKNLKELMLSYNKLEAADWSFISSLSNCSKLTKLLIDGNNL 475

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 59/168 (35%), Positives = 87/168 (51%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+   L  L L  NNFSG +P+ TL     L++L+L+ N   G +P  +  +S+ 
Sbjct: 552  IPDTIGNLVKLTDLKLDRNNFSGGIPV-TLEHCTQLEILNLAHNSLDGRIPNQIFKISSF 610

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               LDLS N   G I P    N  N L++L + +N  +G IP TL  C  L SL +  N 
Sbjct: 611  SQELDLSHNYLYGGI-PEEVGNLIN-LKKLSISDNRLSGNIPSTLGQCVVLESLEMQSNL 668

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
             +G+IP+S  +L  ++ L +  N + G+IP  L     L  L L FN+
Sbjct: 669  FAGSIPNSFENLVGIQKLDISRNNMSGKIPDFLGNFSLLYDLNLSFNN 716

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 60/169 (35%), Positives = 88/169 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           + P   + + L  L LS+N+F G +P +  L +  L  L+LS N   G +P  L++ S  
Sbjct: 92  ISPCIANLTFLTRLQLSNNSFHGSIPSELGL-LSQLNTLNLSTNALEGNIPSELSSCS-Q 149

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  LDLS+N   G I  +L Q   N L+++ L  N   G IP    N  ++  + L+ N 
Sbjct: 150 LEILDLSNNFIQGEIPASLSQC--NHLKDIDLSKNKLKGMIPSDFGNLPKMQIIVLASNR 207

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G IP SLGS   L  + L  N L G IP+ L+   +L+ L+L  N L
Sbjct: 208 LTGDIPPSLGSGHSLTYVDLGSNDLTGSIPESLVNSSSLQVLVLTSNTL 256

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 58/169 (34%), Positives = 87/169 (51%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP  G+   L  LA++ N  SG++P DT+  +  L  L L  N FSG +P +L + +  
Sbjct: 528  IPPTIGNLHNLVVLAIAQNKLSGQIP-DTIGNLVKLTDLKLDRNNFSGGIPVTLEHCT-Q 585

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L+L+ N+  G I PN      +  QEL L +N   G IP  + N   L  L +S N 
Sbjct: 586  LEILNLAHNSLDGRI-PNQIFKISSFSQELDLSHNYLYGGIPEEVGNLINLKKLSISDNR 644

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG IPS+LG    L  L++  N+  G IP     +  ++ L +  N++
Sbjct: 645  LSGNIPSTLGQCVVLESLEMQSNLFAGSIPNSFENLVGIQKLDISRNNM 693

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 55/150 (36%), Positives = 75/150 (50%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P     C+ LE L L+ N+  G +P          + LDLS N   G +PE + NL  +
Sbjct: 576  IPVTLEHCTQLEILNLAHNSLDGRIPNQIFKISSFSQELDLSHNYLYGGIPEEVGNL-IN 634

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L +S N  SG I   L Q     L+ L +Q+N F G IP +  N   +  L +S N 
Sbjct: 635  LKKLSISDNRLSGNIPSTLGQCV--VLESLEMQSNLFAGSIPNSFENLVGIQKLDISRNN 692

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            +SG IP  LG+ S L DL L  N  +GE+P
Sbjct: 693  MSGKIPDFLGNFSLLYDLNLSFNNFDGEVP 722

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 60/157 (38%), Positives = 82/157 (52%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           S+ L+S   SG +    +  +  L  L LS N F G +P  L  LS  L TL+LS+N   
Sbjct: 80  SIDLASEGISGFIS-PCIANLTFLTRLQLSNNSFHGSIPSELGLLS-QLNTLNLSTNALE 137

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I   L  +  + L+ L L NN   G+IP +LS C+ L  + LS N L G IPS  G+L
Sbjct: 138 GNIPSEL--SSCSQLEILDLSNNFIQGEIPASLSQCNHLKDIDLSKNKLKGMIPSDFGNL 195

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            K++ + L  N L G+IP  L    +L  + L  NDL
Sbjct: 196 PKMQIIVLASNRLTGDIPPSLGSGHSLTYVDLGSNDL 232

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 48/136 (35%), Positives = 72/136 (52%)
 Frame = +2

Query: 128 RGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ 307
           R +  +DL+    SG +   + NL+  L  L LS+N+F G I   L     + L  L L 
Sbjct: 76  RRVASIDLASEGISGFISPCIANLTF-LTRLQLSNNSFHGSIPSEL--GLLSQLNTLNLS 132

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            N   G IP  LS+CS+L  L LS N++ G IP+SL   + L+D+ L  N L+G IP + 
Sbjct: 133 TNALEGNIPSELSSCSQLEILDLSNNFIQGEIPASLSQCNHLKDIDLSKNKLKGMIPSDF 192

Query: 488 MYVKTLETLILDFNDL 535
             +  ++ ++L  N L
Sbjct: 193 GNLPKMQIIVLASNRL 208

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 45/124 (36%), Positives = 66/124 (53%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           F   S  + L LS N   G +P + +  +  LK L +S N  SG +P +L      L +L
Sbjct: 605 FKISSFSQELDLSHNYLYGGIP-EEVGNLINLKKLSISDNRLSGNIPSTLGQCVV-LESL 662

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
           ++ SN F+G I PN  +N    +Q+L +  N  +GKIP  L N S L  L+LSFN   G 
Sbjct: 663 EMQSNLFAGSI-PNSFENLVG-IQKLDISRNNMSGKIPDFLGNFSLLYDLNLSFNNFDGE 720

Query: 401 IPSS 412
           +P++
Sbjct: 721 VPAN 724

[152][TOP]
>UniRef100_B8BL48 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
            RepID=B8BL48_ORYSI
          Length = 1287

 Score =  108 bits (269), Expect = 3e-22
 Identities = 67/168 (39%), Positives = 97/168 (57%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ + L SL L +N FSGE+P  T+  +  L  L+L+ N F+G +P  L N+ + 
Sbjct: 693  VPLAIGNLTKLSSLELQANAFSGEIP-STVANLTKLSALNLARNNFTGAIPRRLFNILSL 751

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               LD+S NN  G I P    N  N L+E + Q+N  +G+IPP+L  C  L +++L  N+
Sbjct: 752  SKILDISHNNLEGSI-PQEIGNLIN-LEEFHAQSNILSGEIPPSLGECQLLQNVYLQNNF 809

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            L+GTI S+LG L  L  L L  N L G+IP+ L  +  L  L L FN+
Sbjct: 810  LNGTISSALGQLKGLESLDLSNNKLSGQIPRFLGNISMLSYLNLSFNN 857

 Score =  103 bits (256), Expect = 1e-20
 Identities = 64/175 (36%), Positives = 97/175 (55%), Gaps = 6/175 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDT---LLKMRG---LKVLDLSFNEFSGELPESL 190
           + PF G+ S L++L L +N   G++P D     ++MRG   L  L L  N+  GE+P  +
Sbjct: 87  ISPFLGNLSFLKTLDLGNNQLVGQIPSDLGSIPVEMRGCTKLMTLHLGNNQLQGEIPAEI 146

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            +   +L+ L L+ N  SG I  +L + P  +L+ L L +N  +G++P  LSN + L+++
Sbjct: 147 GSSLKNLINLYLTRNRLSGEIPQSLAELP--SLELLSLSHNKLSGEVPSALSNLTNLLNI 204

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             S N LSG IPSSLG L  L +L L  N L G IP  +  + +L  L +  N L
Sbjct: 205 RFSNNMLSGVIPSSLGMLPNLYELSLGFNNLSGPIPTSIWNISSLRVLSVQGNML 259

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 65/170 (38%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P     C+ L +L L +N   GE+P +    ++ L  L L+ N  SGE+P+SL  L  S
Sbjct: 118 IPVEMRGCTKLMTLHLGNNQLQGEIPAEIGSSLKNLINLYLTRNRLSGEIPQSLAELP-S 176

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS N  SG + P+   N  N L  +   NN  +G IP +L     L  L L FN 
Sbjct: 177 LELLSLSHNKLSGEV-PSALSNLTNLLN-IRFSNNMLSGVIPSSLGMLPNLYELSLGFNN 234

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM-YVKTLETLILDFNDL 535
           LSG IP+S+ ++S LR L +  NML G IP      +  LE L +D N L
Sbjct: 235 LSGPIPTSIWNISSLRVLSVQGNMLSGTIPANAFETLPHLEELYMDHNHL 284

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 61/169 (36%), Positives = 85/169 (50%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            LP   G    L  L++  N  SG +P+  +  +  L  L+L  N FSGE+P ++ NL+  
Sbjct: 669  LPSSLGRLQNLNLLSVPKNKISGSVPL-AIGNLTKLSSLELQANAFSGEIPSTVANLT-K 726

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L+L+ NNF+G I P    N  +  + L + +N   G IP  + N   L   H   N 
Sbjct: 727  LSALNLARNNFTGAI-PRRLFNILSLSKILDISHNNLEGSIPQEIGNLINLEEFHAQSNI 785

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG IP SLG    L+++ L  N L G I   L  +K LE+L L  N L
Sbjct: 786  LSGEIPPSLGECQLLQNVYLQNNFLNGTISSALGQLKGLESLDLSNNKL 834

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 59/152 (38%), Positives = 78/152 (51%), Gaps = 2/152 (1%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P    + + L +L L+ NNF+G +P      +   K+LD+S N   G +P+ + NL  +
Sbjct: 717  IPSTVANLTKLSALNLARNNFTGAIPRRLFNILSLSKILDISHNNLEGSIPQEIGNL-IN 775

Query: 209  LLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
            L      SN  SG I P+L  CQ     LQ +YLQNN   G I   L     L SL LS 
Sbjct: 776  LEEFHAQSNILSGEIPPSLGECQ----LLQNVYLQNNFLNGTISSALGQLKGLESLDLSN 831

Query: 383  NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            N LSG IP  LG++S L  L L  N   GE+P
Sbjct: 832  NKLSGQIPRFLGNISMLSYLNLSFNNFSGEVP 863

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 61/179 (34%), Positives = 93/179 (51%), Gaps = 25/179 (13%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L +L L+ N  SGE+P  +L ++  L++L LS N+ SGE+P +L+NL+ +LL +  S+N 
Sbjct: 153 LINLYLTRNRLSGEIPQ-SLAELPSLELLSLSHNKLSGEVPSALSNLT-NLLNIRFSNNM 210

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL------------------- 361
            SG I  +L   P   L EL L  N  +G IP ++ N S L                   
Sbjct: 211 LSGVIPSSLGMLPN--LYELSLGFNNLSGPIPTSIWNISSLRVLSVQGNMLSGTIPANAF 268

Query: 362 ------VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
                   L++  N+L G IP SLG+ S +  + L  N+  G +PQE+  ++ LE L+L
Sbjct: 269 ETLPHLEELYMDHNHLHGKIPVSLGNSSNMSMIILGANLFNGIVPQEIGRLRKLEQLVL 327

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 50/159 (31%), Positives = 81/159 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + + L ++  S+N  SG +P  +L  +  L  L L FN  SG +P S+ N+S S
Sbjct: 191 VPSALSNLTNLLNIRFSNNMLSGVIP-SSLGMLPNLYELSLGFNNLSGPIPTSIWNIS-S 248

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L +  N  SG I  N  +   + L+ELY+ +N   GKIP +L N S +  + L  N 
Sbjct: 249 LRVLSVQGNMLSGTIPANAFETLPH-LEELYMDHNHLHGKIPVSLGNSSNMSMIILGANL 307

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            +G +P  +G L KL  L L   ++  +  ++  ++  L
Sbjct: 308 FNGIVPQEIGRLRKLEQLVLTQTLVGAKEQKDWEFITAL 346

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 44/138 (31%), Positives = 69/138 (50%), Gaps = 6/138 (4%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN------EFSGELPESL 190
           +P   G+ S +  + L +N F+G +P + + ++R L+ L L+        +   E   +L
Sbjct: 288 IPVSLGNSSNMSMIILGANLFNGIVPQE-IGRLRKLEQLVLTQTLVGAKEQKDWEFITAL 346

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            N S  L  L L    F G +LPN   +   +L+ L L  N  +G IP  + N   L  L
Sbjct: 347 ANCS-QLQVLVLRMCEFGG-VLPNSLSSLSTSLKYLSLSYNNISGSIPKDIGNLFNLQVL 404

Query: 371 HLSFNYLSGTIPSSLGSL 424
            L++N  +GT+PSSLG L
Sbjct: 405 DLAWNSFTGTLPSSLGEL 422

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 30/82 (36%), Positives = 45/82 (54%)
 Frame = +2

Query: 287 LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLE 466
           LQ L L +N F G +P +L     L  L +  N +SG++P ++G+L+KL  L+L  N   
Sbjct: 655 LQSLTLDDNSFIGTLPSSLGRLQNLNLLSVPKNKISGSVPLAIGNLTKLSSLELQANAFS 714

Query: 467 GEIPQELMYVKTLETLILDFND 532
           GEIP  +  +  L  L L  N+
Sbjct: 715 GEIPSTVANLTKLSALNLARNN 736

[153][TOP]
>UniRef100_B8B370 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8B370_ORYSI
          Length = 745

 Score =  108 bits (269), Expect = 3e-22
 Identities = 72/168 (42%), Positives = 98/168 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + L  + L SN+FSG +P  TL  +  L++L LS N F+G++P  L N +A 
Sbjct: 5   VPSAIGNLTELNYMNLESNSFSGRIP-STLGNLGMLELLVLSSNNFTGQVPVELFNSTA- 62

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            +++DLS NN  G I P    N K  + E Y Q N  +G+IP T+  C  L +LHL  N 
Sbjct: 63  -VSVDLSYNNLEGSI-PQEISNLKGLI-EFYAQWNKLSGEIPSTIGECQLLQNLHLQNNI 119

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L+GTIPSSLG L  L +L L  N L GEIP+ L  +  L  L L FN+
Sbjct: 120 LNGTIPSSLGQLQGLENLDLSNNNLSGEIPKLLGNLSMLYYLNLSFNN 167

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 61/152 (40%), Positives = 83/152 (54%), Gaps = 2/152 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+  +LE L LSSNNF+G++P++ L     + V DLS+N   G +P+ ++NL   
Sbjct: 29  IPSTLGNLGMLELLVLSSNNFTGQVPVE-LFNSTAVSV-DLSYNNLEGSIPQEISNLKG- 85

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
           L+      N  SG I   +  CQ     LQ L+LQNN   G IP +L     L +L LS 
Sbjct: 86  LIEFYAQWNKLSGEIPSTIGECQ----LLQNLHLQNNILNGTIPSSLGQLQGLENLDLSN 141

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           N LSG IP  LG+LS L  L L  N   G++P
Sbjct: 142 NNLSGEIPKLLGNLSMLYYLNLSFNNFVGQVP 173

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 55/148 (37%), Positives = 78/148 (52%)
 Frame = +2

Query: 92  SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ 271
           SG +P   +  +  L  ++L  N FSG +P +L NL   L  L LSSNNF+G +   L  
Sbjct: 2   SGSVP-SAIGNLTELNYMNLESNSFSGRIPSTLGNLGM-LELLVLSSNNFTGQVPVELFN 59

Query: 272 NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLW 451
           +   T   + L  N   G IP  +SN   L+  +  +N LSG IPS++G    L++L L 
Sbjct: 60  S---TAVSVDLSYNNLEGSIPQEISNLKGLIEFYAQWNKLSGEIPSTIGECQLLQNLHLQ 116

Query: 452 LNMLEGEIPQELMYVKTLETLILDFNDL 535
            N+L G IP  L  ++ LE L L  N+L
Sbjct: 117 NNILNGTIPSSLGQLQGLENLDLSNNNL 144

[154][TOP]
>UniRef100_B8AE61 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
            RepID=B8AE61_ORYSI
          Length = 1031

 Score =  108 bits (269), Expect = 3e-22
 Identities = 63/168 (37%), Positives = 92/168 (54%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G+ S L    L  NN +G +P + + + R L+ L+LS N FSG +P  +  +S+ 
Sbjct: 554  IPDSIGNLSQLNEFYLDRNNLNGSIPAN-IGQWRQLEKLNLSHNSFSGSMPSEVFKISSL 612

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
               LDLS N F+GPILP +       L  + + NN  TG IP TL  C  L  LH+  N 
Sbjct: 613  SQNLDLSHNLFTGPILPEI--GNLINLGSISIANNRLTGDIPSTLGKCVLLEYLHMEGNL 670

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
            L+G+IP S  +L  +++  L  N L G++P+ L    +L+ L L FND
Sbjct: 671  LTGSIPQSFMNLKSIKEFDLSRNRLSGKVPEFLTLFSSLQKLNLSFND 718

 Score =  101 bits (251), Expect = 4e-20
 Identities = 68/173 (39%), Positives = 95/173 (54%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           LE  +P  FG+   L++L LS+N  +GE+P   L        +DL  N+ +G +PE L N
Sbjct: 186 LEGSIPTGFGTLRELKTLDLSNNALTGEIP-PLLGSSPSFVYVDLGGNQLTGGIPEFLAN 244

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            S+SL  L L  N+ +G I P L  +  +TL  +YL  N   G IPP  +  + +  L L
Sbjct: 245 -SSSLQVLRLMQNSLTGEIPPALFNS--STLTTIYLNRNNLAGSIPPVTAIAAPIQFLSL 301

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           + N L+G IP +LG+LS L  L L  N L G IP+ L  +  LE LIL +N L
Sbjct: 302 TQNKLTGGIPPTLGNLSSLVRLSLAANNLVGSIPESLSKIPALERLILTYNKL 354

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 63/169 (37%), Positives = 87/169 (51%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  GS      + L  N  +G +P + L     L+VL L  N  +GE+P +L N S++
Sbjct: 214 IPPLLGSSPSFVYVDLGGNQLTGGIP-EFLANSSSLQVLRLMQNSLTGEIPPALFN-SST 271

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L T+ L+ NN +G I P         +Q L L  N  TG IPPTL N S LV L L+ N 
Sbjct: 272 LTTIYLNRNNLAGSIPPVTAIAAP--IQFLSLTQNKLTGGIPPTLGNLSSLVRLSLAANN 329

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L G+IP SL  +  L  L L  N L G +P+ +  + +L  L +  N L
Sbjct: 330 LVGSIPESLSKIPALERLILTYNKLSGPVPESIFNMSSLRYLEMANNSL 378

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 69/193 (35%), Positives = 96/193 (49%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ S + SL LSSN F G++P + L ++  +  L+LS N   G +P+ L++ S +
Sbjct: 94  IPPCIGNLSSIASLDLSSNAFLGKVPSE-LGRLGQISYLNLSINSLVGRIPDELSSCS-N 151

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L +N+  G I P+L Q     LQ++ L NN   G IP       EL +L LS N 
Sbjct: 152 LQVLGLWNNSLQGEIPPSLTQCTH--LQQVILYNNKLEGSIPTGFGTLRELKTLDLSNNA 209

Query: 389 LSGTIPSSLGS------------------------LSKLRDLKLWLNMLEGEIPQELMYV 496
           L+G IP  LGS                         S L+ L+L  N L GEIP  L   
Sbjct: 210 LTGEIPPLLGSSPSFVYVDLGGNQLTGGIPEFLANSSSLQVLRLMQNSLTGEIPPALFNS 269

Query: 497 KTLETLILDFNDL 535
            TL T+ L+ N+L
Sbjct: 270 STLTTIYLNRNNL 282

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 63/192 (32%), Positives = 91/192 (47%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
            +P   G+   L  L +  N FSG +P  T+  +  L VL  + N  SG +P+S+ NLS  
Sbjct: 506  IPAEIGNLKSLTILYMDDNMFSGSIPQ-TIGNLTNLLVLSFAKNNLSGRIPDSIGNLSQL 564

Query: 206  ----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 319
                                   L  L+LS N+FSG  +P+      +  Q L L +N F
Sbjct: 565  NEFYLDRNNLNGSIPANIGQWRQLEKLNLSHNSFSGS-MPSEVFKISSLSQNLDLSHNLF 623

Query: 320  TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
            TG I P + N   L S+ ++ N L+G IPS+LG    L  L +  N+L G IPQ  M +K
Sbjct: 624  TGPILPEIGNLINLGSISIANNRLTGDIPSTLGKCVLLEYLHMEGNLLTGSIPQSFMNLK 683

Query: 500  TLETLILDFNDL 535
            +++   L  N L
Sbjct: 684  SIKEFDLSRNRL 695

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 64/167 (38%), Positives = 86/167 (51%), Gaps = 2/167 (1%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNF-SGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P FG    L  L L+ N+  +G+   + +L     LK L L  N   G LP S+ NL+  
Sbjct: 432 PSFGLLPNLRYLDLAYNHLEAGDWSFLSSLANCTQLKKLLLDGNGLKGSLPSSVGNLAPQ 491

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  N  SG I P    N K+ L  LY+ +N F+G IP T+ N + L+ L  + N 
Sbjct: 492 LDWLWLKQNKLSGTI-PAEIGNLKS-LTILYMDDNMFSGSIPQTIGNLTNLLVLSFAKNN 549

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG IP S+G+LS+L +  L  N L G IP  +   + LE L L  N
Sbjct: 550 LSGRIPDSIGNLSQLNEFYLDRNNLNGSIPANIGQWRQLEKLNLSHN 596

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 58/170 (34%), Positives = 91/170 (53%), Gaps = 1/170 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP   + S L ++ L+ NN +G +P  T +    ++ L L+ N+ +G +P +L 
Sbjct: 257 SLTGEIPPALFNSSTLTTIYLNRNNLAGSIPPVTAI-AAPIQFLSLTQNKLTGGIPPTLG 315

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NLS SL+ L L++NN  G I  +L + P   L+ L L  N  +G +P ++ N S L  L 
Sbjct: 316 NLS-SLVRLSLAANNLVGSIPESLSKIP--ALERLILTYNKLSGPVPESIFNMSSLRYLE 372

Query: 374 LSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
           ++ N L G +P  +G+ L  L+ L L    L G IP  L  +  LE + L
Sbjct: 373 MANNSLIGRLPQDIGNRLPNLQSLILSTIQLNGPIPASLANMTKLEMIYL 422

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 55/150 (36%), Positives = 78/150 (52%)
 Frame = +2

Query: 86  NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNL 265
           N+ G    +T  ++R +  L++S     G +P  + NLS S+ +LDLSSN F G +   L
Sbjct: 65  NWQGVSCNNTQTQLR-VMALNISSKGLGGSIPPCIGNLS-SIASLDLSSNAFLGKVPSEL 122

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
            +     +  L L  N   G+IP  LS+CS L  L L  N L G IP SL   + L+ + 
Sbjct: 123 GR--LGQISYLNLSINSLVGRIPDELSSCSNLQVLGLWNNSLQGEIPPSLTQCTHLQQVI 180

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+ N LEG IP     ++ L+TL L  N L
Sbjct: 181 LYNNKLEGSIPTGFGTLRELKTLDLSNNAL 210

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 67/244 (27%), Positives = 103/244 (42%), Gaps = 75/244 (30%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
            +PP  G+ S L  L+L++NN  G +P ++L K+  L+ L L++N+ SG +PES+ N+S+ 
Sbjct: 310  IPPTLGNLSSLVRLSLAANNLVGSIP-ESLSKIPALERLILTYNKLSGPVPESIFNMSSL 368

Query: 206  -----------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNG 316
                                   +L +L LS+   +GPI  +L    K  L+ +YL   G
Sbjct: 369  RYLEMANNSLIGRLPQDIGNRLPNLQSLILSTIQLNGPIPASLANMTK--LEMIYLVATG 426

Query: 317  FTGKIPP--------------------------TLSNCSELVSL---------------- 370
             TG +P                           +L+NC++L  L                
Sbjct: 427  LTGVVPSFGLLPNLRYLDLAYNHLEAGDWSFLSSLANCTQLKKLLLDGNGLKGSLPSSVG 486

Query: 371  ---------HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILD 523
                      L  N LSGTIP+ +G+L  L  L +  NM  G IPQ +  +  L  L   
Sbjct: 487  NLAPQLDWLWLKQNKLSGTIPAEIGNLKSLTILYMDDNMFSGSIPQTIGNLTNLLVLSFA 546

Query: 524  FNDL 535
             N+L
Sbjct: 547  KNNL 550

[155][TOP]
>UniRef100_Q9LP24-3 Isoform 3 of Probable leucine-rich repeat receptor-like protein
           kinase At1g35710 n=1 Tax=Arabidopsis thaliana
           RepID=Q9LP24-3
          Length = 845

 Score =  108 bits (269), Expect = 3e-22
 Identities = 69/169 (40%), Positives = 99/169 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   + +LALS N  +G +P  +L  ++ L +L L  N  +G +P  L N+  S
Sbjct: 262 IPPEIGNMESMTNLALSQNKLTGSIP-SSLGNLKNLTLLSLFQNYLTGGIPPKLGNIE-S 319

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ L+LS+N  +G I P+   N KN L  LYL  N  TG IPP L N   ++ L L+ N 
Sbjct: 320 MIDLELSNNKLTGSI-PSSLGNLKN-LTILYLYENYLTGVIPPELGNMESMIDLQLNNNK 377

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IPSS G+L  L  L L+LN L G IPQEL  ++++  L L  N L
Sbjct: 378 LTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKL 426

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 68/169 (40%), Positives = 94/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP FG+ S L    LS+N+ +GE+   +L  ++ L VL L  N  +  +P  L N+  S
Sbjct: 118 IPPQFGNLSKLIYFDLSTNHLTGEIS-PSLGNLKNLTVLYLHQNYLTSVIPSELGNME-S 175

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +  L LS N  +G I P+   N KN L  LYL  N  TG IPP L N   +  L LS N 
Sbjct: 176 MTDLALSQNKLTGSI-PSSLGNLKN-LMVLYLYENYLTGVIPPELGNMESMTDLALSQNK 233

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IPS+LG+L  L  L L+ N L G IP E+  ++++  L L  N L
Sbjct: 234 LTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKL 282

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 67/169 (39%), Positives = 93/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+   +  LALS N  +G +P  +L  ++ L VL L  N  +G +P  L N+  S
Sbjct: 166 IPSELGNMESMTDLALSQNKLTGSIP-SSLGNLKNLMVLYLYENYLTGVIPPELGNME-S 223

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +  L LS N  +G I P+   N KN L  LYL  N  TG IPP + N   + +L LS N 
Sbjct: 224 MTDLALSQNKLTGSI-PSTLGNLKN-LMVLYLYENYLTGVIPPEIGNMESMTNLALSQNK 281

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IPSSLG+L  L  L L+ N L G IP +L  ++++  L L  N L
Sbjct: 282 LTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKL 330

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 64/159 (40%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           +E L L++    G       + +  L  +DLS N  SG +P    NLS  L+  DLS+N+
Sbjct: 79  IEELNLTNTGIEGTFQDFPFISLSNLAYVDLSMNLLSGTIPPQFGNLS-KLIYFDLSTNH 137

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G I P+L  N KN L  LYL  N  T  IP  L N   +  L LS N L+G+IPSSLG
Sbjct: 138 LTGEISPSL-GNLKN-LTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLG 195

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +L  L  L L+ N L G IP EL  ++++  L L  N L
Sbjct: 196 NLKNLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKL 234

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 60/159 (37%), Positives = 92/159 (57%)
 Frame = +2

Query: 59   LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
            L +L +S+NN +G +P + +  M  L  LDLS N   GELPE++ NL+ +L  L L+ N 
Sbjct: 560  LGALIMSNNNITGAIPTE-IWNMTQLVELDLSTNNLFGELPEAIGNLT-NLSRLRLNGNQ 617

Query: 239  FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
             SG +   L  +    L+ L L +N F+ +IP T  +  +L  ++LS N   G+IP  L 
Sbjct: 618  LSGRVPAGL--SFLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIPR-LS 674

Query: 419  SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L++L  L L  N L+GEIP +L  +++L+ L L  N+L
Sbjct: 675  KLTQLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNL 713

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 53/159 (33%), Positives = 86/159 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   +  L L++N  +G +P  +   ++ L  L L  N  +G +P+ L N+  S
Sbjct: 358 IPPELGNMESMIDLQLNNNKLTGSIP-SSFGNLKNLTYLYLYLNYLTGVIPQELGNME-S 415

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ LDLS N  +G +  +     K  L+ LYL+ N  +G IPP ++N S L +L L  N 
Sbjct: 416 MINLDLSQNKLTGSVPDSFGNFTK--LESLYLRVNHLSGAIPPGVANSSHLTTLILDTNN 473

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            +G  P ++    KL+++ L  N LEG IP+ L   K+L
Sbjct: 474 FTGFFPETVCKGRKLQNISLDYNHLEGPIPKSLRDCKSL 512

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 55/150 (36%), Positives = 80/150 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            LP   G+ + L  L L+ N  SG +P   L  +  L+ LDLS N FS E+P++  +    
Sbjct: 598  LPEAIGNLTNLSRLRLNGNQLSGRVPAG-LSFLTNLESLDLSSNNFSSEIPQTFDSF-LK 655

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  ++LS N F G I P L +  +  L +L L +N   G+IP  LS+   L  L LS N 
Sbjct: 656  LHDMNLSRNKFDGSI-PRLSKLTQ--LTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNN 712

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LSG IP++   +  L ++ +  N LEG +P
Sbjct: 713  LSGLIPTTFEGMIALTNVDISNNKLEGPLP 742

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 53/169 (31%), Positives = 88/169 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   + S L +L L +NNF+G  P +T+ K R L+ + L +N   G +P+SL +   S
Sbjct: 454 IPPGVANSSHLTTLILDTNNFTGFFP-ETVCKGRKLQNISLDYNHLEGPIPKSLRDCK-S 511

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+      N F+G I       P   L  +   +N F G+I        +L +L +S N 
Sbjct: 512 LIRARFLGNKFTGDIFEAFGIYPD--LNFIDFSHNKFHGEISSNWEKSPKLGALIMSNNN 569

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++G IP+ + ++++L +L L  N L GE+P+ +  +  L  L L+ N L
Sbjct: 570 ITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQL 618

[156][TOP]
>UniRef100_Q9LP24 Probable leucine-rich repeat receptor-like protein kinase At1g35710
           n=1 Tax=Arabidopsis thaliana RepID=Y1571_ARATH
          Length = 1120

 Score =  108 bits (269), Expect = 3e-22
 Identities = 69/169 (40%), Positives = 99/169 (58%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   + +LALS N  +G +P  +L  ++ L +L L  N  +G +P  L N+  S
Sbjct: 262 IPPEIGNMESMTNLALSQNKLTGSIP-SSLGNLKNLTLLSLFQNYLTGGIPPKLGNIE-S 319

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ L+LS+N  +G I P+   N KN L  LYL  N  TG IPP L N   ++ L L+ N 
Sbjct: 320 MIDLELSNNKLTGSI-PSSLGNLKN-LTILYLYENYLTGVIPPELGNMESMIDLQLNNNK 377

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IPSS G+L  L  L L+LN L G IPQEL  ++++  L L  N L
Sbjct: 378 LTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKL 426

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 68/169 (40%), Positives = 94/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP FG+ S L    LS+N+ +GE+   +L  ++ L VL L  N  +  +P  L N+  S
Sbjct: 118 IPPQFGNLSKLIYFDLSTNHLTGEIS-PSLGNLKNLTVLYLHQNYLTSVIPSELGNME-S 175

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +  L LS N  +G I P+   N KN L  LYL  N  TG IPP L N   +  L LS N 
Sbjct: 176 MTDLALSQNKLTGSI-PSSLGNLKN-LMVLYLYENYLTGVIPPELGNMESMTDLALSQNK 233

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IPS+LG+L  L  L L+ N L G IP E+  ++++  L L  N L
Sbjct: 234 LTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKL 282

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 67/169 (39%), Positives = 93/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+   +  LALS N  +G +P  +L  ++ L VL L  N  +G +P  L N+  S
Sbjct: 166 IPSELGNMESMTDLALSQNKLTGSIP-SSLGNLKNLMVLYLYENYLTGVIPPELGNME-S 223

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           +  L LS N  +G I P+   N KN L  LYL  N  TG IPP + N   + +L LS N 
Sbjct: 224 MTDLALSQNKLTGSI-PSTLGNLKN-LMVLYLYENYLTGVIPPEIGNMESMTNLALSQNK 281

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IPSSLG+L  L  L L+ N L G IP +L  ++++  L L  N L
Sbjct: 282 LTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKL 330

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 64/159 (40%), Positives = 85/159 (53%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           +E L L++    G       + +  L  +DLS N  SG +P    NLS  L+  DLS+N+
Sbjct: 79  IEELNLTNTGIEGTFQDFPFISLSNLAYVDLSMNLLSGTIPPQFGNLS-KLIYFDLSTNH 137

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            +G I P+L  N KN L  LYL  N  T  IP  L N   +  L LS N L+G+IPSSLG
Sbjct: 138 LTGEISPSL-GNLKN-LTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLG 195

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +L  L  L L+ N L G IP EL  ++++  L L  N L
Sbjct: 196 NLKNLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKL 234

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 60/159 (37%), Positives = 92/159 (57%)
 Frame = +2

Query: 59   LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
            L +L +S+NN +G +P + +  M  L  LDLS N   GELPE++ NL+ +L  L L+ N 
Sbjct: 560  LGALIMSNNNITGAIPTE-IWNMTQLVELDLSTNNLFGELPEAIGNLT-NLSRLRLNGNQ 617

Query: 239  FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
             SG +   L  +    L+ L L +N F+ +IP T  +  +L  ++LS N   G+IP  L 
Sbjct: 618  LSGRVPAGL--SFLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIPR-LS 674

Query: 419  SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             L++L  L L  N L+GEIP +L  +++L+ L L  N+L
Sbjct: 675  KLTQLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNL 713

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 53/159 (33%), Positives = 86/159 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+   +  L L++N  +G +P  +   ++ L  L L  N  +G +P+ L N+  S
Sbjct: 358 IPPELGNMESMIDLQLNNNKLTGSIP-SSFGNLKNLTYLYLYLNYLTGVIPQELGNME-S 415

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           ++ LDLS N  +G +  +     K  L+ LYL+ N  +G IPP ++N S L +L L  N 
Sbjct: 416 MINLDLSQNKLTGSVPDSFGNFTK--LESLYLRVNHLSGAIPPGVANSSHLTTLILDTNN 473

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            +G  P ++    KL+++ L  N LEG IP+ L   K+L
Sbjct: 474 FTGFFPETVCKGRKLQNISLDYNHLEGPIPKSLRDCKSL 512

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 55/150 (36%), Positives = 80/150 (53%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            LP   G+ + L  L L+ N  SG +P   L  +  L+ LDLS N FS E+P++  +    
Sbjct: 598  LPEAIGNLTNLSRLRLNGNQLSGRVPAG-LSFLTNLESLDLSSNNFSSEIPQTFDSF-LK 655

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  ++LS N F G I P L +  +  L +L L +N   G+IP  LS+   L  L LS N 
Sbjct: 656  LHDMNLSRNKFDGSI-PRLSKLTQ--LTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNN 712

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            LSG IP++   +  L ++ +  N LEG +P
Sbjct: 713  LSGLIPTTFEGMIALTNVDISNNKLEGPLP 742

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 53/169 (31%), Positives = 88/169 (52%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   + S L +L L +NNF+G  P +T+ K R L+ + L +N   G +P+SL +   S
Sbjct: 454 IPPGVANSSHLTTLILDTNNFTGFFP-ETVCKGRKLQNISLDYNHLEGPIPKSLRDCK-S 511

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L+      N F+G I       P   L  +   +N F G+I        +L +L +S N 
Sbjct: 512 LIRARFLGNKFTGDIFEAFGIYPD--LNFIDFSHNKFHGEISSNWEKSPKLGALIMSNNN 569

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           ++G IP+ + ++++L +L L  N L GE+P+ +  +  L  L L+ N L
Sbjct: 570 ITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQL 618

[157][TOP]
>UniRef100_A7Q541 Chromosome undetermined scaffold_51, whole genome shotgun sequence
           n=2 Tax=Vitis vinifera RepID=A7Q541_VITVI
          Length = 946

 Score =  107 bits (268), Expect = 4e-22
 Identities = 69/170 (40%), Positives = 94/170 (55%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G   LL  L LS N   G +P DT+  M  LK L LS N   GE+P+SL+NL  +
Sbjct: 253 IPDTVGKMVLLSHLDLSLNQLQGSIP-DTVGNMVSLKKLSLSENHLQGEIPKSLSNL-CN 310

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+L  NN SG + P+      +TL+ L+L +N F+G +P  L   S L  LHL FN 
Sbjct: 311 LQELELDRNNLSGQLAPDFVACANDTLETLFLSDNQFSGSVP-ALIGFSSLRELHLDFNQ 369

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ-ELMYVKTLETLILDFNDL 535
           L+GT+P S+G L+ L+ L +  N L+G I +  L  +  L  L L  N L
Sbjct: 370 LNGTLPESVGQLANLQSLDIASNSLQGTISEAHLFNLSWLSYLNLSSNSL 419

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 56/147 (38%), Positives = 82/147 (55%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           FGS S ++   +SSN F G +P         ++ LDLS N+ SG +   L  +   LL L
Sbjct: 503 FGSFSNID---MSSNCFEGSIPQLPY----DVQWLDLSNNKLSGSI-SLLCTVGTELLLL 554

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
           DLS+N+ SG  LPN C     +L  L L+NN F+G+IP +  +   + +LHL  N L+G 
Sbjct: 555 DLSNNSLSGG-LPN-CWAQWESLVVLNLENNRFSGQIPISFGSLRSIQTLHLRNNNLTGE 612

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
           +P S  + + LR + L  N L G+IP+
Sbjct: 613 LPLSFKNCTSLRFIDLAKNRLSGKIPE 639

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 61/177 (34%), Positives = 85/177 (48%), Gaps = 7/177 (3%)
 Frame = +2

Query: 26  PLPPF------FGSCSL-LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE 184
           P+PP        G+ S+ L  L LS N  +  +    L     L  LDLSFN  +G +PE
Sbjct: 147 PIPPLTIPSLSHGNSSVPLVFLDLSGNYLTSSIYPWLLNFSTTLLHLDLSFNGLNGSIPE 206

Query: 185 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 364
                 +SL  LDL S+     I   +      +L  L +  N   G IP T+     L 
Sbjct: 207 YAFGNMSSLEYLDLHSSELDDEIPDTI--GDMGSLAYLDISENQLWGSIPDTVGKMVLLS 264

Query: 365 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L LS N L G+IP ++G++  L+ L L  N L+GEIP+ L  +  L+ L LD N+L
Sbjct: 265 HLDLSLNQLQGSIPDTVGNMVSLKKLSLSENHLQGEIPKSLSNLCNLQELELDRNNL 321

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 57/196 (29%), Positives = 90/196 (45%), Gaps = 27/196 (13%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P  FGS   +++L L +NN +GELP+ +      L+ +DL+ N  SG++PE +     +
Sbjct: 589  IPISFGSLRSIQTLHLRNNNLTGELPL-SFKNCTSLRFIDLAKNRLSGKIPEWIGGSLPN 647

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV---SLHLS 379
            L  L+L SN FSG I P LCQ     +Q L L +N   G +P  +   + +    SL + 
Sbjct: 648  LTVLNLGSNRFSGGICPELCQ--LKNIQILDLSSNNMLGVVPRCVGGFTAMTKKGSLVIV 705

Query: 380  FNYLSGTIPSSL------------------------GSLSKLRDLKLWLNMLEGEIPQEL 487
             NY      S                           +L  ++ +    N L GEIP+E+
Sbjct: 706  HNYSFADFSSKYSLIRNAFYVDRALVKWKGREFEYKSTLGLVKSIDFSSNKLSGEIPEEV 765

Query: 488  MYVKTLETLILDFNDL 535
            + +  L +L L  N+L
Sbjct: 766  IDLVELVSLNLSRNNL 781

 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 55/166 (33%), Positives = 79/166 (47%)
 Frame = +2

Query: 38  FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 217
           F+   S + +L++S+N   G LP +   +      +D+S N F G +P+    L   +  
Sbjct: 475 FWNVTSTVNTLSISNNRIKGTLP-NLSSEFGSFSNIDMSSNCFEGSIPQ----LPYDVQW 529

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
           LDLS+N  SG I  +L       L  L L NN  +G +P   +    LV L+L  N  SG
Sbjct: 530 LDLSNNKLSGSI--SLLCTVGTELLLLDLSNNSLSGGLPNCWAQWESLVVLNLENNRFSG 587

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            IP S GSL  ++ L L  N L GE+P       +L  + L  N L
Sbjct: 588 QIPISFGSLRSIQTLHLRNNNLTGELPLSFKNCTSLRFIDLAKNRL 633

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 47/140 (33%), Positives = 68/140 (48%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LP  +     L  L L +N FSG++P+ +   +R ++ L L  N  +GELP S  
Sbjct: 560 SLSGGLPNCWAQWESLVVLNLENNRFSGQIPI-SFGSLRSIQTLHLRNNNLTGELPLSFK 618

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N + SL  +DL+ N  SG I P         L  L L +N F+G I P L     +  L 
Sbjct: 619 NCT-SLRFIDLAKNRLSGKI-PEWIGGSLPNLTVLNLGSNRFSGGICPELCQLKNIQILD 676

Query: 374 LSFNYLSGTIPSSLGSLSKL 433
           LS N + G +P  +G  + +
Sbjct: 677 LSSNNMLGVVPRCVGGFTAM 696

[158][TOP]
>UniRef100_A5BAW3 Putative uncharacterized protein n=2 Tax=Vitis vinifera
           RepID=A5BAW3_VITVI
          Length = 639

 Score =  107 bits (268), Expect = 4e-22
 Identities = 75/209 (35%), Positives = 105/209 (50%), Gaps = 42/209 (20%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMD-----TLLKM----------------RGLKVL 145
           LP   G  S L+ L LSSNN SGE+P +     TL +                 R LK+L
Sbjct: 232 LPARIGDLSKLKILILSSNNLSGEIPTNLSNIRTLSRFAANENNFNGNIPNGISRFLKIL 291

Query: 146 DLSFNEFSGELPESL---------------------TNLSASLLTLDLSSNNFSGPILPN 262
           DLS+N+ SG +P  L                      N+S+SL+ L L SN+ SG ++P+
Sbjct: 292 DLSYNKLSGSIPSDLMMQPKLQRVDLSYNLLGGSIPANMSSSLVRLRLGSNSLSG-VIPS 350

Query: 263 LCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 442
                   L  L L+NN  +G IPP L +C  L  L+L+ N L+G +P  LGSL+ L+ L
Sbjct: 351 AKLGTLLKLTYLELENNSLSGSIPPELGSCQSLALLNLAMNNLAGRLPLELGSLNHLQVL 410

Query: 443 KLWLNMLEGEIPQELMYVKTLETLILDFN 529
           KL  N L GEIP ++  +++L  L +  N
Sbjct: 411 KLQSNKLTGEIPDQITQIQSLLVLNISEN 439

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 64/163 (39%), Positives = 89/163 (54%)
 Frame = +2

Query: 44  GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 223
           G    L+ L+ S N   G LP  T     GL+ LD S+N  SG +   L  L+  L TL+
Sbjct: 118 GKIGGLKLLSFSRNRLVGALP--TFNGFIGLQFLDFSYNSLSGNIGLQLDGLN-ELRTLN 174

Query: 224 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 403
           LSSN FSG +  +L ++    L+ L L  N F G IP  + +  +LV + LS N LSG++
Sbjct: 175 LSSNQFSGHVPTHLGKS--RVLEHLLLSKNFFHGGIPKVIFDYHKLVLIDLSNNQLSGSL 232

Query: 404 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           P+ +G LSKL+ L L  N L GEIP  L  ++TL     + N+
Sbjct: 233 PARIGDLSKLKILILSSNNLSGEIPTNLSNIRTLSRFAANENN 275

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 66/196 (33%), Positives = 97/196 (49%), Gaps = 22/196 (11%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP  GSC  L  L L+ NN +G LP++ L  +  L+VL L  N+ +GE+P+ +T
Sbjct: 368 SLSGSIPPELGSCQSLALLNLAMNNLAGRLPLE-LGSLNHLQVLKLQSNKLTGEIPDQIT 426

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL---- 361
            +  SLL L++S N  SG I  ++ +    +L  L L  N   G IPP++S  + L    
Sbjct: 427 QIQ-SLLVLNISENLLSGGIPSSIWR--LKSLTNLNLGGNRLLGSIPPSISRFNSLLELQ 483

Query: 362 ------------------VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
                             ++L+LS N   G IP++L  LS L    L  N   GEIP  L
Sbjct: 484 LGRNQLSGHIPMMPSSLQIALNLSHNLFEGPIPNTLSRLSSLEVWDLSNNKFSGEIPIFL 543

Query: 488 MYVKTLETLILDFNDL 535
              +++  L+L  N L
Sbjct: 544 TLFRSMTQLLLSNNQL 559

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 62/161 (38%), Positives = 83/161 (51%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           S L  L L SN+ SG +P   L  +  L  L+L  N  SG +P  L +   SL  L+L+ 
Sbjct: 332 SSLVRLRLGSNSLSGVIPSAKLGTLLKLTYLELENNSLSGSIPPELGSCQ-SLALLNLAM 390

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           NN +G +   L     N LQ L LQ+N  TG+IP  ++    L+ L++S N LSG IPSS
Sbjct: 391 NNLAGRLPLEL--GSLNHLQVLKLQSNKLTGEIPDQITQIQSLLVLNISENLLSGGIPSS 448

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +  L  L +L L  N L G IP  +    +L  L L  N L
Sbjct: 449 IWRLKSLTNLNLGGNRLLGSIPPSISRFNSLLELQLGRNQL 489

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 60/169 (35%), Positives = 80/169 (47%), Gaps = 43/169 (25%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP------ESL 190
           LP   GS + L+ L L SN  +GE+P D + +++ L VL++S N  SG +P      +SL
Sbjct: 397 LPLELGSLNHLQVLKLQSNKLTGEIP-DQITQIQSLLVLNISENLLSGGIPSSIWRLKSL 455

Query: 191 TNLSA-----------------SLLTLDLSSNNFSG--PILP-----------NLCQNP- 277
           TNL+                  SLL L L  N  SG  P++P           NL + P 
Sbjct: 456 TNLNLGGNRLLGSIPPSISRFNSLLELQLGRNQLSGHIPMMPSSLQIALNLSHNLFEGPI 515

Query: 278 KNTLQELY------LQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            NTL  L       L NN F+G+IP  L+    +  L LS N LSG IP
Sbjct: 516 PNTLSRLSSLEVWDLSNNKFSGEIPIFLTLFRSMTQLLLSNNQLSGVIP 564

[159][TOP]
>UniRef100_Q5Z664 Os06g0692700 protein n=2 Tax=Oryza sativa Japonica Group
           RepID=Q5Z664_ORYSJ
          Length = 673

 Score =  107 bits (268), Expect = 4e-22
 Identities = 71/171 (41%), Positives = 95/171 (55%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           + P  G+ + L  L LS N  +G LPM+ LL  R + VLD+SFN   G LPE  ++    
Sbjct: 37  ISPLLGNLTGLLHLNLSHNLLNGNLPME-LLFSRSIIVLDVSFNRLDGSLPELQSSSGGF 95

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS-NCSELVSLHLSF 382
            L  L++SSN F+G     L +  KN +  L   NN FTG+IP ++  N   L  L LS+
Sbjct: 96  PLQVLNISSNLFTGQFSSKLWEAMKNIVA-LNASNNSFTGQIPSSICINSPSLAILDLSY 154

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N  SG+IP  LG+ SKLR+ K   N   G +P+EL    +LE L L  NDL
Sbjct: 155 NQFSGSIPPELGNCSKLREFKAGYNNFNGALPEELFSATSLEHLSLPSNDL 205

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 59/193 (30%), Positives = 85/193 (44%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+CS L       NNF+G LP + L     L+ L L  N+  G L  S       
Sbjct: 161 IPPELGNCSKLREFKAGYNNFNGALP-EELFSATSLEHLSLPSNDLQGVLDGSDILKLVK 219

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL---- 376
           L  LDL S   SG I  ++ Q   +TL+EL L NN  +G++P  + NC+ L  L L    
Sbjct: 220 LTVLDLGSTGLSGNIPDSIGQ--LSTLEELRLDNNNMSGELPSAVGNCTNLRYLSLRNNK 277

Query: 377 --------------------SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
                               S N  +GT+P S+ S S L  L+L  N   G++   +  +
Sbjct: 278 FVGDLSKVNFTRLNLRIADFSINNFTGTVPESIYSCSNLIALRLAFNKFHGQLSPRMGNL 337

Query: 497 KTLETLILDFNDL 535
           K++    +  N L
Sbjct: 338 KSMSFFSIADNHL 350

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 61/190 (32%), Positives = 89/190 (46%), Gaps = 31/190 (16%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L  L + S    G++P   + K++ L+VLDLS N  SG++P  +++L   L  LD+++N+
Sbjct: 392 LRVLTIDSCGLVGQIPT-WISKLKKLEVLDLSNNMLSGKIPFWISDLPV-LFYLDITNNS 449

Query: 239 FSGPILPNLCQNP-----KNTLQ--------------------------ELYLQNNGFTG 325
            +G I   L   P     KN  Q                           L L NNGFTG
Sbjct: 450 LTGDIPTALMNTPMLQLGKNAAQLDPNFLELPVYWTRSRQYRLLNAFPNALNLGNNGFTG 509

Query: 326 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
            IPP +     L   ++SFN LSG IP  + +L+ L+ L L  N L GE+P  L  +  L
Sbjct: 510 VIPPEIGRLKMLDGFNISFNRLSGEIPQQICNLTNLQLLDLSSNQLTGELPSALTDMHFL 569

Query: 506 ETLILDFNDL 535
               +  N+L
Sbjct: 570 SKFNVSNNEL 579

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 58/210 (27%), Positives = 87/210 (41%), Gaps = 50/210 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP   G+C+ L  L+L +N F G+L      ++  L++ D S N F+G +PES+ + S +
Sbjct: 258 LPSAVGNCTNLRYLSLRNNKFVGDLSKVNFTRLN-LRIADFSINNFTGTVPESIYSCS-N 315

Query: 209 LLTLDLSSNNFSGPILPNL----------------------------CQNPK-------- 280
           L+ L L+ N F G + P +                            C+N          
Sbjct: 316 LIALRLAFNKFHGQLSPRMGNLKSMSFFSIADNHLTNITNALQILKSCKNLTAVLIGTNF 375

Query: 281 --------------NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
                           L+ L + + G  G+IP  +S   +L  L LS N LSG IP  + 
Sbjct: 376 KGETISKSETIDGFENLRVLTIDSCGLVGQIPTWISKLKKLEVLDLSNNMLSGKIPFWIS 435

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLE 508
            L  L  L +  N L G+IP  LM    L+
Sbjct: 436 DLPVLFYLDITNNSLTGDIPTALMNTPMLQ 465

[160][TOP]
>UniRef100_A7BSI0 Putative uncharacterized protein n=1 Tax=Beggiatoa sp. PS
           RepID=A7BSI0_9GAMM
          Length = 1308

 Score =  107 bits (268), Expect = 4e-22
 Identities = 67/169 (39%), Positives = 94/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ + L  L L+ N+ SG +P + +  +  L +L L FN+ SG +P  + NL+  
Sbjct: 273 IPPEIGNLTQLTRLYLADNSLSGSIPQE-IGNLTQLNLLSLMFNQLSGSIPPEIGNLT-Q 330

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS N  SG I P +       L ELYL +N  +G IPP + N ++LVSL L  N 
Sbjct: 331 LTYLSLSHNQLSGSIPPEI--GNLTQLTELYLADNSLSGSIPPEIGNLTQLVSLWLGNNQ 388

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS +IP  +G L++L  L L  N L G IP E+ ++  L  L LD N L
Sbjct: 389 LSASIPPEIGHLTQLDTLILSGNQLSGSIPPEIGHLTQLMYLYLDSNQL 437

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 59/169 (34%), Positives = 91/169 (53%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ + L  L L+ N+ +G +P + +  +  L  L L+FN+ SG +P  + NL   
Sbjct: 177 IPSKIGNLNQLVHLDLACNHLTGSIPPE-IGNLTQLTELILAFNQLSGSIPPEIGNL-IQ 234

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+L +N  +G I P +       L+ L L  N  +G IPP + N ++L  L+L+ N 
Sbjct: 235 LTELNLGNNPLNGLIPPEI--GNLTQLESLNLYENLLSGSIPPEIGNLTQLTRLYLADNS 292

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG+IP  +G+L++L  L L  N L G IP E+  +  L  L L  N L
Sbjct: 293 LSGSIPQEIGNLTQLNLLSLMFNQLSGSIPPEIGNLTQLTYLSLSHNQL 341

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 61/170 (35%), Positives = 93/170 (54%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ + L  L L+ N+ SG +P + +  +  L  L L  N+ S  +P  + +L+  
Sbjct: 345 IPPEIGNLTQLTELYLADNSLSGSIPPE-IGNLTQLVSLWLGNNQLSASIPPEIGHLT-Q 402

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TL LS N  SG I P +       L  LYL +N  +G IPP + N ++L +L L+ N 
Sbjct: 403 LDTLILSGNQLSGSIPPEI--GHLTQLMYLYLDSNQLSGSIPPEIGNLTQLYNLELNSNQ 460

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV-KTLETLILDFNDL 535
           LSG+IP  +G+L +L  L L  N L G+IP  L  + + L+ +  D+ DL
Sbjct: 461 LSGSIPPEIGNLIELYYLDLSKNQLSGDIPSSLSNLSRLLDGVDYDYTDL 510

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 62/153 (40%), Positives = 83/153 (54%), Gaps = 3/153 (1%)
 Frame = +2

Query: 86  NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP-- 259
           N +G +P   +  +  L  LDL+ N  +G +P  + NL+  L  L L+ N  SG I P  
Sbjct: 172 NLNGSIP-SKIGNLNQLVHLDLACNHLTGSIPPEIGNLT-QLTELILAFNQLSGSIPPEI 229

Query: 260 -NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLR 436
            NL Q     L EL L NN   G IPP + N ++L SL+L  N LSG+IP  +G+L++L 
Sbjct: 230 GNLIQ-----LTELNLGNNPLNGLIPPEIGNLTQLESLNLYENLLSGSIPPEIGNLTQLT 284

Query: 437 DLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L L  N L G IPQE+  +  L  L L FN L
Sbjct: 285 RLYLADNSLSGSIPQEIGNLTQLNLLSLMFNQL 317

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 30/76 (39%), Positives = 44/76 (57%)
 Frame = +2

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           N    G IP  + N ++LV L L+ N+L+G+IP  +G+L++L +L L  N L G IP E+
Sbjct: 170 NYNLNGSIPSKIGNLNQLVHLDLACNHLTGSIPPEIGNLTQLTELILAFNQLSGSIPPEI 229

Query: 488 MYVKTLETLILDFNDL 535
             +  L  L L  N L
Sbjct: 230 GNLIQLTELNLGNNPL 245

[161][TOP]
>UniRef100_Q9T033 Receptor protein kinase-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T033_ARATH
          Length = 864

 Score =  107 bits (268), Expect = 4e-22
 Identities = 73/168 (43%), Positives = 102/168 (60%), Gaps = 1/168 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSL-LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           P+P  FGS  L LE L LSS + +G +P ++L ++  LKVLDLS N  +G++P SLT+L 
Sbjct: 116 PIPALFGSSLLTLEVLDLSSCSITGTIP-ESLTRLSHLKVLDLSKNAINGDIPLSLTSLQ 174

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
            +L  LDLSSN+  G I  N+    K  LQ L L  N  T  IPP+L + S L+ L LSF
Sbjct: 175 -NLSILDLSSNSVFGSIPANIGALSK--LQRLNLSRNTLTSSIPPSLGDLSVLIDLDLSF 231

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDF 526
           N +SG++PS L  L  L+ L +  N L G +P +L  + + +  I+DF
Sbjct: 232 NGMSGSVPSDLKGLRNLQTLVIAGNRLSGSLPPDLFSLLS-KLQIIDF 278

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 1/156 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L   +PP  G  S+L  L LS N  SG +P D L  +R L+ L ++ N  SG LP  L 
Sbjct: 209 TLTSSIPPSLGDLSVLIDLDLSFNGMSGSVPSD-LKGLRNLQTLVIAGNRLSGSLPPDLF 267

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS-L 370
           +L + L  +D   + F G +   L   P+  L+ L +  N F+  +P T  +    VS L
Sbjct: 268 SLLSKLQIIDFRGSGFIGALPSRLWSLPE--LKFLDISGNHFSDMLPNTTVSFDSTVSML 325

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           ++S N   G +      L++ + + L  N  EG+IP
Sbjct: 326 NISGNMFYGNLTL---LLTRFQVVDLSENYFEGKIP 358

[162][TOP]
>UniRef100_Q9LGH9 Putative uncharacterized protein P0009G03.33 n=1 Tax=Oryza sativa
           Japonica Group RepID=Q9LGH9_ORYSJ
          Length = 1050

 Score =  107 bits (268), Expect = 4e-22
 Identities = 73/181 (40%), Positives = 96/181 (53%), Gaps = 7/181 (3%)
 Frame = +2

Query: 14  SLELP-------LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SL LP       L P  G+ +    L LSSN   GE+P  ++ ++R L+ L+LS+N FSG
Sbjct: 74  SLSLPSSNLAGTLSPAIGNLTFPRRLNLSSNGLYGEIPT-SIGRLRRLQWLNLSYNSFSG 132

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
             P +LT+   SL  LDL  N   G I+P    N    LQ L L NN   G IPP+L+N 
Sbjct: 133 AFPVNLTSC-ISLKILDLDYNQLGG-IIPVELGNTLTQLQMLLLTNNSIIGPIPPSLANL 190

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           S L  L+L +N+L G IP  LG+   L +L L  NML GE P  L  +  L  + +  N 
Sbjct: 191 SLLQDLYLDYNHLEGLIPPCLGNFPVLHELSLEANMLTGEFPHSLWNLSALRVIGVGLNM 250

Query: 533 L 535
           L
Sbjct: 251 L 251

 Score =  100 bits (249), Expect = 7e-20
 Identities = 63/153 (41%), Positives = 84/153 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L+ L LS N+FSG  P++ L     LK+LDL +N+  G +P  L N    
Sbjct: 110 IPTSIGRLRRLQWLNLSYNSFSGAFPVN-LTSCISLKILDLDYNQLGGIIPVELGNTLTQ 168

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L++N+  GPI P+L     + LQ+LYL  N   G IPP L N   L  L L  N 
Sbjct: 169 LQMLLLTNNSIIGPIPPSLAN--LSLLQDLYLDYNHLEGLIPPCLGNFPVLHELSLEANM 226

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           L+G  P SL +LS LR + + LNML+G IP  +
Sbjct: 227 LTGEFPHSLWNLSALRVIGVGLNMLQGSIPANI 259

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 61/164 (37%), Positives = 89/164 (54%), Gaps = 1/164 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +CS L+ L LS N F G+LP   +     L++LDL  N FSG +P  ++NL   L  LDL
Sbjct: 340 NCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISNL-IGLRLLDL 398

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
             N  SG I  ++       L +L L N G +G IP T+ N ++L  L      L G IP
Sbjct: 399 GFNPISGVIPESI--GKLTNLVDLALYNTGLSGLIPSTIGNLTKLNRLLAFHTNLEGPIP 456

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI-LDFNDL 535
           +++G L  L +L L  N L G IP+E++ + +L  ++ L +N L
Sbjct: 457 ATIGRLKNLFNLDLSFNRLNGSIPREILELPSLAWILDLSYNSL 500

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 67/174 (38%), Positives = 93/174 (53%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +LE P+P   G    L +L LS N  +G +P + L       +LDLS+N  SG LP  + 
Sbjct: 450 NLEGPIPATIGRLKNLFNLDLSFNRLNGSIPREILELPSLAWILDLSYNSLSGHLPSEVG 509

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            L A+L  L LS N  SG I PN   N +  L+ L L NN F G +P +L+N   L  L+
Sbjct: 510 TL-ANLNQLILSGNQLSGQI-PNSIGNCE-VLEFLLLDNNSFGGDMPQSLTNLKGLNVLN 566

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+ N LSG IP+++ ++  L+ L L  N   G IP  L     L+ L + FN+L
Sbjct: 567 LTVNKLSGRIPNAISNIGNLQYLCLAHNNFSGPIPAALQNFTLLKQLDVSFNNL 620

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 64/167 (38%), Positives = 89/167 (53%), Gaps = 4/167 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF---SGELPESLTNL 199
           +P    + S L  L L+ NNF+G +P  TL  +  LK L +  N+    +G+  E +T+L
Sbjct: 280 IPSSLSNLSRLTDLYLADNNFTGFVP-PTLGMLHSLKYLYIGTNQLEADNGKGSEFVTSL 338

Query: 200 S-ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
           +  S L   + S+NF G  LP    N   TLQ L L+NN F+G IP  +SN   L  L L
Sbjct: 339 ANCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISNLIGLRLLDL 398

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 517
            FN +SG IP S+G L+ L DL L+   L G IP  +  +  L  L+
Sbjct: 399 GFNPISGVIPESIGKLTNLVDLALYNTGLSGLIPSTIGNLTKLNRLL 445

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/131 (41%), Positives = 73/131 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LP   G+ + L  L LS N  SG++P +++     L+ L L  N F G++P+SLT
Sbjct: 499 SLSGHLPSEVGTLANLNQLILSGNQLSGQIP-NSIGNCEVLEFLLLDNNSFGGDMPQSLT 557

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL   L  L+L+ N  SG I PN   N  N LQ L L +N F+G IP  L N + L  L 
Sbjct: 558 NLKG-LNVLNLTVNKLSGRI-PNAISNIGN-LQYLCLAHNNFSGPIPAALQNFTLLKQLD 614

Query: 374 LSFNYLSGTIP 406
           +SFN L G +P
Sbjct: 615 VSFNNLQGEVP 625

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 64/205 (31%), Positives = 98/205 (47%), Gaps = 32/205 (15%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN------------ 160
           LE  +PP  G+  +L  L+L +N  +GE P  +L  +  L+V+ +  N            
Sbjct: 203 LEGLIPPCLGNFPVLHELSLEANMLTGEFP-HSLWNLSALRVIGVGLNMLQGSIPANIGD 261

Query: 161 -------------EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY 301
                         F G +P SL+NLS  L  L L+ NNF+G + P L     ++L+ LY
Sbjct: 262 KFPAMRFFGLHENRFHGAIPSSLSNLS-RLTDLYLADNNFTGFVPPTL--GMLHSLKYLY 318

Query: 302 L------QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNM 460
           +       +NG   +   +L+NCS+L  L LS N+  G +P S+ +LS  L+ L L  N 
Sbjct: 319 IGTNQLEADNGKGSEFVTSLANCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNS 378

Query: 461 LEGEIPQELMYVKTLETLILDFNDL 535
             G IP ++  +  L  L L FN +
Sbjct: 379 FSGTIPHDISNLIGLRLLDLGFNPI 403

[163][TOP]
>UniRef100_Q8LPG4 Receptor protein kinase-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8LPG4_ARATH
          Length = 864

 Score =  107 bits (268), Expect = 4e-22
 Identities = 73/168 (43%), Positives = 102/168 (60%), Gaps = 1/168 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSL-LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           P+P  FGS  L LE L LSS + +G +P ++L ++  LKVLDLS N  +G++P SLT+L 
Sbjct: 116 PIPALFGSSLLTLEVLDLSSCSITGTIP-ESLTRLSHLKVLDLSKNAINGDIPLSLTSLQ 174

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
            +L  LDLSSN+  G I  N+    K  LQ L L  N  T  IPP+L + S L+ L LSF
Sbjct: 175 -NLSILDLSSNSVFGSIPANIGALSK--LQRLNLSRNTLTSSIPPSLGDLSVLIDLDLSF 231

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDF 526
           N +SG++PS L  L  L+ L +  N L G +P +L  + + +  I+DF
Sbjct: 232 NGMSGSVPSDLKGLRNLQTLVIAGNRLSGSLPPDLFSLLS-KLQIIDF 278

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 1/156 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L   +PP  G  S+L  L LS N  SG +P D L  +R L+ L ++ N  SG LP  L 
Sbjct: 209 TLTSSIPPSLGDLSVLIDLDLSFNGMSGSVPSD-LKGLRNLQTLVIAGNRLSGSLPPDLF 267

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS-L 370
           +L + L  +D   + F G +   L   P+  L+ L +  N F+  +P T  +    VS L
Sbjct: 268 SLLSKLQIIDFRGSGFIGALPSRLWSLPE--LKFLDISGNHFSDMLPNTTVSFDSTVSML 325

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           ++S N   G +      L++ + + L  N  EG+IP
Sbjct: 326 NISGNMFYGNLTL---LLTRFQVVDLSENYFEGKIP 358

[164][TOP]
>UniRef100_Q3E9N4 Putative uncharacterized protein At4g39270.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q3E9N4_ARATH
          Length = 694

 Score =  107 bits (268), Expect = 4e-22
 Identities = 73/168 (43%), Positives = 102/168 (60%), Gaps = 1/168 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSL-LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 202
           P+P  FGS  L LE L LSS + +G +P ++L ++  LKVLDLS N  +G++P SLT+L 
Sbjct: 116 PIPALFGSSLLTLEVLDLSSCSITGTIP-ESLTRLSHLKVLDLSKNAINGDIPLSLTSLQ 174

Query: 203 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 382
            +L  LDLSSN+  G I  N+    K  LQ L L  N  T  IPP+L + S L+ L LSF
Sbjct: 175 -NLSILDLSSNSVFGSIPANIGALSK--LQRLNLSRNTLTSSIPPSLGDLSVLIDLDLSF 231

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDF 526
           N +SG++PS L  L  L+ L +  N L G +P +L  + + +  I+DF
Sbjct: 232 NGMSGSVPSDLKGLRNLQTLVIAGNRLSGSLPPDLFSLLS-KLQIIDF 278

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 1/156 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L   +PP  G  S+L  L LS N  SG +P D L  +R L+ L ++ N  SG LP  L 
Sbjct: 209 TLTSSIPPSLGDLSVLIDLDLSFNGMSGSVPSD-LKGLRNLQTLVIAGNRLSGSLPPDLF 267

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS-L 370
           +L + L  +D   + F G +   L   P+  L+ L +  N F+  +P T  +    VS L
Sbjct: 268 SLLSKLQIIDFRGSGFIGALPSRLWSLPE--LKFLDISGNHFSDMLPNTTVSFDSTVSML 325

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           ++S N   G +      L++ + + L  N  EG+IP
Sbjct: 326 NISGNMFYGNLTL---LLTRFQVVDLSENYFEGKIP 358

[165][TOP]
>UniRef100_Q2R102 Leucine Rich Repeat family protein, expressed n=2 Tax=Oryza sativa
           Japonica Group RepID=Q2R102_ORYSJ
          Length = 736

 Score =  107 bits (268), Expect = 4e-22
 Identities = 67/169 (39%), Positives = 96/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L  L L  NNFSG +P  ++ + + L +L+LS N F+G +P  L ++S+ 
Sbjct: 159 IPQSIGKLEKLGELYLQENNFSGAIP-SSIGRCKNLVMLNLSCNTFNGIIPPELLSISSL 217

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              LDLS N FSGPI P+   +  N L  + + NN  +G+IP TL  C  L SL L  N+
Sbjct: 218 SKGLDLSYNGFSGPI-PSKIGSLIN-LDSINISNNQLSGEIPHTLGECLHLESLQLEVNF 275

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IP S  SL  + ++ L  N L GEIP+      +L+ L L FN+L
Sbjct: 276 LNGSIPDSFTSLRGINEMDLSQNNLSGEIPKFFETFSSLQLLNLSFNNL 324

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 58/160 (36%), Positives = 83/160 (51%), Gaps = 2/160 (1%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL--SASLLTLDLSS 232
           L+ L +  N F+G +P  +   ++ L  LDL  N F      SL++   S  L+ + L +
Sbjct: 22  LQVLEVRDNTFTGVVP--SFWALQNLTQLDLGANLFESVDWTSLSSKINSTKLVAIYLDN 79

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           N   G ILP+   N   +LQ LY+ NN   G IP  + N + L  LHL+ N +SG IP +
Sbjct: 80  NRIHG-ILPSSIGNLPGSLQTLYMTNNRIAGTIPSEIGNLNNLTVLHLAENLISGDIPET 138

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L +L  L  L L  N L GEIPQ +  ++ L  L L  N+
Sbjct: 139 LCNLVNLFVLGLHRNNLSGEIPQSIGKLEKLGELYLQENN 178

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 61/167 (36%), Positives = 78/167 (46%), Gaps = 2/167 (1%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGE--LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P F +   L  L L +N F       + + +    L  + L  N   G LP S+ NL  S
Sbjct: 37  PSFWALQNLTQLDLGANLFESVDWTSLSSKINSTKLVAIYLDNNRIHGILPSSIGNLPGS 96

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L TL +++N  +G I P+   N  N L  L+L  N  +G IP TL N   L  L L  N 
Sbjct: 97  LQTLYMTNNRIAGTI-PSEIGN-LNNLTVLHLAENLISGDIPETLCNLVNLFVLGLHRNN 154

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           LSG IP S+G L KL +L L  N   G IP  +   K L  L L  N
Sbjct: 155 LSGEIPQSIGKLEKLGELYLQENNFSGAIPSSIGRCKNLVMLNLSCN 201

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 55/158 (34%), Positives = 79/158 (50%), Gaps = 1/158 (0%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
           L ++ L +N   G LP         L+ L ++ N  +G +P  + NL+ +L  L L+ N 
Sbjct: 72  LVAIYLDNNRIHGILPSSIGNLPGSLQTLYMTNNRIAGTIPSEIGNLN-NLTVLHLAENL 130

Query: 239 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
            SG I   LC N  N L  L L  N  +G+IP ++    +L  L+L  N  SG IPSS+G
Sbjct: 131 ISGDIPETLC-NLVN-LFVLGLHRNNLSGEIPQSIGKLEKLGELYLQENNFSGAIPSSIG 188

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTL-ETLILDFN 529
               L  L L  N   G IP EL+ + +L + L L +N
Sbjct: 189 RCKNLVMLNLSCNTFNGIIPPELLSISSLSKGLDLSYN 226

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 48/138 (34%), Positives = 77/138 (55%), Gaps = 4/138 (2%)
 Frame = +2

Query: 134 LKVLDLSFNEFSGELPE--SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNT-LQELYL 304
           L+VL++  N F+G +P   +L NL+     LDL +N F      +L     +T L  +YL
Sbjct: 22  LQVLEVRDNTFTGVVPSFWALQNLTQ----LDLGANLFESVDWTSLSSKINSTKLVAIYL 77

Query: 305 QNNGFTGKIPPTLSNC-SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
            NN   G +P ++ N    L +L+++ N ++GTIPS +G+L+ L  L L  N++ G+IP+
Sbjct: 78  DNNRIHGILPSSIGNLPGSLQTLYMTNNRIAGTIPSEIGNLNNLTVLHLAENLISGDIPE 137

Query: 482 ELMYVKTLETLILDFNDL 535
            L  +  L  L L  N+L
Sbjct: 138 TLCNLVNLFVLGLHRNNL 155

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 47/149 (31%), Positives = 71/149 (47%), Gaps = 22/149 (14%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C  L  L LS N F+G +P + L      K LDLS+N FSG +P  + +L  +
Sbjct: 183 IPSSIGRCKNLVMLNLSCNTFNGIIPPELLSISSLSKGLDLSYNGFSGPIPSKIGSL-IN 241

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNT--------------------LQELYLQNNGFT 322
           L ++++S+N  SG I   L  C + ++                     + E+ L  N  +
Sbjct: 242 LDSINISNNQLSGEIPHTLGECLHLESLQLEVNFLNGSIPDSFTSLRGINEMDLSQNNLS 301

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPS 409
           G+IP      S L  L+LSFN L G +P+
Sbjct: 302 GEIPKFFETFSSLQLLNLSFNNLEGMVPT 330

[166][TOP]
>UniRef100_Q0JQL8 Os01g0152600 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q0JQL8_ORYSJ
          Length = 1410

 Score =  107 bits (268), Expect = 4e-22
 Identities = 73/181 (40%), Positives = 96/181 (53%), Gaps = 7/181 (3%)
 Frame = +2

Query: 14  SLELP-------LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SL LP       L P  G+ +    L LSSN   GE+P  ++ ++R L+ L+LS+N FSG
Sbjct: 74  SLSLPSSNLAGTLSPAIGNLTFPRRLNLSSNGLYGEIPT-SIGRLRRLQWLNLSYNSFSG 132

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
             P +LT+   SL  LDL  N   G I+P    N    LQ L L NN   G IPP+L+N 
Sbjct: 133 AFPVNLTSC-ISLKILDLDYNQLGG-IIPVELGNTLTQLQMLLLTNNSIIGPIPPSLANL 190

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           S L  L+L +N+L G IP  LG+   L +L L  NML GE P  L  +  L  + +  N 
Sbjct: 191 SLLQDLYLDYNHLEGLIPPCLGNFPVLHELSLEANMLTGEFPHSLWNLSALRVIGVGLNM 250

Query: 533 L 535
           L
Sbjct: 251 L 251

 Score =  100 bits (249), Expect = 7e-20
 Identities = 63/153 (41%), Positives = 84/153 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L+ L LS N+FSG  P++ L     LK+LDL +N+  G +P  L N    
Sbjct: 110 IPTSIGRLRRLQWLNLSYNSFSGAFPVN-LTSCISLKILDLDYNQLGGIIPVELGNTLTQ 168

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L++N+  GPI P+L     + LQ+LYL  N   G IPP L N   L  L L  N 
Sbjct: 169 LQMLLLTNNSIIGPIPPSLAN--LSLLQDLYLDYNHLEGLIPPCLGNFPVLHELSLEANM 226

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           L+G  P SL +LS LR + + LNML+G IP  +
Sbjct: 227 LTGEFPHSLWNLSALRVIGVGLNMLQGSIPANI 259

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 61/164 (37%), Positives = 89/164 (54%), Gaps = 1/164 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +CS L+ L LS N F G+LP   +     L++LDL  N FSG +P  ++NL   L  LDL
Sbjct: 340 NCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISNL-IGLRLLDL 398

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
             N  SG I  ++       L +L L N G +G IP T+ N ++L  L      L G IP
Sbjct: 399 GFNPISGVIPESI--GKLTNLVDLALYNTGLSGLIPSTIGNLTKLNRLLAFHTNLEGPIP 456

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI-LDFNDL 535
           +++G L  L +L L  N L G IP+E++ + +L  ++ L +N L
Sbjct: 457 ATIGRLKNLFNLDLSFNRLNGSIPREILELPSLAWILDLSYNSL 500

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 67/174 (38%), Positives = 93/174 (53%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +LE P+P   G    L +L LS N  +G +P + L       +LDLS+N  SG LP  + 
Sbjct: 450 NLEGPIPATIGRLKNLFNLDLSFNRLNGSIPREILELPSLAWILDLSYNSLSGHLPSEVG 509

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            L A+L  L LS N  SG I PN   N +  L+ L L NN F G +P +L+N   L  L+
Sbjct: 510 TL-ANLNQLILSGNQLSGQI-PNSIGNCE-VLEFLLLDNNSFGGDMPQSLTNLKGLNVLN 566

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+ N LSG IP+++ ++  L+ L L  N   G IP  L     L+ L + FN+L
Sbjct: 567 LTVNKLSGRIPNAISNIGNLQYLCLAHNNFSGPIPAALQNFTLLKQLDVSFNNL 620

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 64/167 (38%), Positives = 89/167 (53%), Gaps = 4/167 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF---SGELPESLTNL 199
           +P    + S L  L L+ NNF+G +P  TL  +  LK L +  N+    +G+  E +T+L
Sbjct: 280 IPSSLSNLSRLTDLYLADNNFTGFVP-PTLGMLHSLKYLYIGTNQLEADNGKGSEFVTSL 338

Query: 200 S-ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
           +  S L   + S+NF G  LP    N   TLQ L L+NN F+G IP  +SN   L  L L
Sbjct: 339 ANCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISNLIGLRLLDL 398

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 517
            FN +SG IP S+G L+ L DL L+   L G IP  +  +  L  L+
Sbjct: 399 GFNPISGVIPESIGKLTNLVDLALYNTGLSGLIPSTIGNLTKLNRLL 445

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/131 (41%), Positives = 73/131 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LP   G+ + L  L LS N  SG++P +++     L+ L L  N F G++P+SLT
Sbjct: 499 SLSGHLPSEVGTLANLNQLILSGNQLSGQIP-NSIGNCEVLEFLLLDNNSFGGDMPQSLT 557

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL   L  L+L+ N  SG I PN   N  N LQ L L +N F+G IP  L N + L  L 
Sbjct: 558 NLKG-LNVLNLTVNKLSGRI-PNAISNIGN-LQYLCLAHNNFSGPIPAALQNFTLLKQLD 614

Query: 374 LSFNYLSGTIP 406
           +SFN L G +P
Sbjct: 615 VSFNNLQGEVP 625

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 64/205 (31%), Positives = 98/205 (47%), Gaps = 32/205 (15%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN------------ 160
           LE  +PP  G+  +L  L+L +N  +GE P  +L  +  L+V+ +  N            
Sbjct: 203 LEGLIPPCLGNFPVLHELSLEANMLTGEFP-HSLWNLSALRVIGVGLNMLQGSIPANIGD 261

Query: 161 -------------EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY 301
                         F G +P SL+NLS  L  L L+ NNF+G + P L     ++L+ LY
Sbjct: 262 KFPAMRFFGLHENRFHGAIPSSLSNLS-RLTDLYLADNNFTGFVPPTL--GMLHSLKYLY 318

Query: 302 L------QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNM 460
           +       +NG   +   +L+NCS+L  L LS N+  G +P S+ +LS  L+ L L  N 
Sbjct: 319 IGTNQLEADNGKGSEFVTSLANCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNS 378

Query: 461 LEGEIPQELMYVKTLETLILDFNDL 535
             G IP ++  +  L  L L FN +
Sbjct: 379 FSGTIPHDISNLIGLRLLDLGFNPI 403

[167][TOP]
>UniRef100_C7J8G3 Os11g0624600 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=C7J8G3_ORYSJ
          Length = 1073

 Score =  107 bits (268), Expect = 4e-22
 Identities = 67/169 (39%), Positives = 96/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L  L L  NNFSG +P  ++ + + L +L+LS N F+G +P  L ++S+ 
Sbjct: 496 IPQSIGKLEKLGELYLQENNFSGAIP-SSIGRCKNLVMLNLSCNTFNGIIPPELLSISSL 554

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
              LDLS N FSGPI P+   +  N L  + + NN  +G+IP TL  C  L SL L  N+
Sbjct: 555 SKGLDLSYNGFSGPI-PSKIGSLIN-LDSINISNNQLSGEIPHTLGECLHLESLQLEVNF 612

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IP S  SL  + ++ L  N L GEIP+      +L+ L L FN+L
Sbjct: 613 LNGSIPDSFTSLRGINEMDLSQNNLSGEIPKFFETFSSLQLLNLSFNNL 661

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 67/197 (34%), Positives = 95/197 (48%), Gaps = 29/197 (14%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L SL ++ NN  G +P D++ K+  L+ LDL++N  +G +P SL  +S  
Sbjct: 320 IPAALGNLSSLSSLLVAQNNLQGNIP-DSITKIPYLQELDLAYNNLTGTVPPSLYTISTL 378

Query: 209 L---LTLDLSSNNFSGP--------------------------ILPNLCQNPKNTLQELY 301
               L LDL +N F                             ILP+   N   +LQ LY
Sbjct: 379 TYLGLGLDLGANLFESVDWTSLSSKINSTKLVAIYLDNNRIHGILPSSIGNLPGSLQTLY 438

Query: 302 LQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 481
           + NN   G IP  + N + L  LHL+ N +SG IP +L +L  L  L L  N L GEIPQ
Sbjct: 439 MTNNRIAGTIPSEIGNLNNLTVLHLAENLISGDIPETLCNLVNLFVLGLHRNNLSGEIPQ 498

Query: 482 ELMYVKTLETLILDFND 532
            +  ++ L  L L  N+
Sbjct: 499 SIGKLEKLGELYLQENN 515

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 60/175 (34%), Positives = 91/175 (52%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           LSL   +PP     S L ++ +  N  SG +P + + ++  L+ L+L  N  +G +P+++
Sbjct: 97  LSLTGQIPPCIADLSFLTTIYMPDNQISGHIPPE-IGRLTQLRNLNLGMNSITGMIPDTI 155

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
           ++ +  L  +D+ SNN  G I  NL     + LQE+ L +N   G IPP + +   L  L
Sbjct: 156 SSCT-HLEVIDMWSNNIEGEIPSNLANC--SLLQEIALSHNNLNGTIPPGIGSLPNLKYL 212

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+ N L G+IP SLGS + L  + L  N L G IP  L    +L  L L  N L
Sbjct: 213 LLANNKLVGSIPRSLGSRTSLSMVVLAYNSLTGSIPPILANCSSLRYLDLSQNKL 267

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 63/192 (32%), Positives = 89/192 (46%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G  + L +L L  N+ +G +P DT+     L+V+D+  N   GE+P +L N S  
Sbjct: 127 IPPEIGRLTQLRNLNLGMNSITGMIP-DTISSCTHLEVIDMWSNNIEGEIPSNLANCSL- 184

Query: 209 LLTLDLSSNNFSGPILPNLCQNP----------------------KNTLQELYLQNNGFT 322
           L  + LS NN +G I P +   P                      + +L  + L  N  T
Sbjct: 185 LQEIALSHNNLNGTIPPGIGSLPNLKYLLLANNKLVGSIPRSLGSRTSLSMVVLAYNSLT 244

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWL-NMLEGEIPQELMYVK 499
           G IPP L+NCS L  L LS N L G IPS+L + S L  L L   N +   IP   +   
Sbjct: 245 GSIPPILANCSSLRYLDLSQNKLGGVIPSALFNSSSLLSLDLSSNNFIRWSIPSAPLISA 304

Query: 500 TLETLILDFNDL 535
            +  +IL  N +
Sbjct: 305 PILHVILTNNTI 316

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 65/199 (32%), Positives = 99/199 (49%), Gaps = 25/199 (12%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           ++E  +P    +CSLL+ +ALS NN +G +P   +  +  LK L L+ N+  G +P SL 
Sbjct: 170 NIEGEIPSNLANCSLLQEIALSHNNLNGTIPPG-IGSLPNLKYLLLANNKLVGSIPRSLG 228

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           + + SL  + L+ N+ +G I P L     ++L+ L L  N   G IP  L N S L+SL 
Sbjct: 229 SRT-SLSMVVLAYNSLTGSIPPILANC--SSLRYLDLSQNKLGGVIPSALFNSSSLLSLD 285

Query: 374 LSFNY-------------------------LSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
           LS N                          + G IP++LG+LS L  L +  N L+G IP
Sbjct: 286 LSSNNFIRWSIPSAPLISAPILHVILTNNTIFGGIPAALGNLSSLSSLLVAQNNLQGNIP 345

Query: 479 QELMYVKTLETLILDFNDL 535
             +  +  L+ L L +N+L
Sbjct: 346 DSITKIPYLQELDLAYNNL 364

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 52/174 (29%), Positives = 86/174 (49%), Gaps = 11/174 (6%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRG-----LKVLD------LSFNEFSGELPESLT 193
           SC  + SLA S  + + E     LL +R      L  LD      L+F ++ G    +  
Sbjct: 26  SCPCVSSLAPSRTHNTSEADRQALLCLRSQFSDPLGALDSWRKESLAFCDWHGVTCSNQG 85

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
             +A ++ L L S + +G I P  C    + L  +Y+ +N  +G IPP +   ++L +L+
Sbjct: 86  --AARVVALRLKSLSLTGQIPP--CIADLSFLTTIYMPDNQISGHIPPEIGRLTQLRNLN 141

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N ++G IP ++ S + L  + +W N +EGEIP  L     L+ + L  N+L
Sbjct: 142 LGMNSITGMIPDTISSCTHLEVIDMWSNNIEGEIPSNLANCSLLQEIALSHNNL 195

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 47/149 (31%), Positives = 71/149 (47%), Gaps = 22/149 (14%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G C  L  L LS N F+G +P + L      K LDLS+N FSG +P  + +L  +
Sbjct: 520 IPSSIGRCKNLVMLNLSCNTFNGIIPPELLSISSLSKGLDLSYNGFSGPIPSKIGSL-IN 578

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNT--------------------LQELYLQNNGFT 322
           L ++++S+N  SG I   L  C + ++                     + E+ L  N  +
Sbjct: 579 LDSINISNNQLSGEIPHTLGECLHLESLQLEVNFLNGSIPDSFTSLRGINEMDLSQNNLS 638

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPS 409
           G+IP      S L  L+LSFN L G +P+
Sbjct: 639 GEIPKFFETFSSLQLLNLSFNNLEGMVPT 667

[168][TOP]
>UniRef100_C5Y7F5 Putative uncharacterized protein Sb05g026010 n=1 Tax=Sorghum
           bicolor RepID=C5Y7F5_SORBI
          Length = 1116

 Score =  107 bits (268), Expect = 4e-22
 Identities = 73/175 (41%), Positives = 95/175 (54%), Gaps = 1/175 (0%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +P    +CS LE++ L SN+  GE+P  +L +   L+ + L +N   G +P  L 
Sbjct: 138 SLRCEIPEALSACSHLETIDLDSNSLQGEIP-PSLARCSSLQTVILGYNNLQGSIPPQL- 195

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            L  SL TL L SNN +G I P      KN L  + LQNN  TG IPP L NC+ L  + 
Sbjct: 196 GLLPSLYTLFLPSNNLTGSI-PEFLGQSKN-LTWVNLQNNSLTGWIPPALFNCTSLHYID 253

Query: 374 LSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N LSG++P  L  S S L  L L+ N L GEIP  L  + +L  L+L  N L
Sbjct: 254 LSHNALSGSVPPFLQASSSALNYLSLYENNLSGEIPSSLGNLSSLALLLLSHNSL 308

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 63/174 (36%), Positives = 92/174 (52%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L+  +PP  G    L +L L SNN +G +P + L + + L  ++L  N  +G +P +L 
Sbjct: 186 NLQGSIPPQLGLLPSLYTLFLPSNNLTGSIP-EFLGQSKNLTWVNLQNNSLTGWIPPALF 244

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           N + SL  +DLS N  SG + P L Q   + L  L L  N  +G+IP +L N S L  L 
Sbjct: 245 NCT-SLHYIDLSHNALSGSVPPFL-QASSSALNYLSLYENNLSGEIPSSLGNLSSLALLL 302

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LS N L G++P SLG L  L+ L L  N L G +   +  + +L  L L  N +
Sbjct: 303 LSHNSLGGSLPESLGKLKTLQALDLSYNNLSGTVAPAIYNISSLNFLGLGANQI 356

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 62/169 (36%), Positives = 85/169 (50%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G    L  L  + NN +G +P  +L   + L  L+LS N   G +P  L ++S  
Sbjct: 532  IPRSIGKLEKLTELLFNENNLTGLIP-SSLEGCKQLTTLNLSSNSLYGGIPRELFSISTL 590

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
             + LDLS+N  +G I   +       L  L L NN  +G+IP TL  C  L SLHL  N 
Sbjct: 591  SVGLDLSNNKLTGDIPFEI--GGLINLNSLSLSNNQLSGEIPSTLGQCLLLQSLHLEANN 648

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  +IP S  +L  +  + L  N L G IPQ L  + +L+ L L FNDL
Sbjct: 649  LHRSIPDSFINLKGITVMDLSQNNLSGRIPQFLESLSSLQILNLSFNDL 697

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/168 (36%), Positives = 84/168 (50%), Gaps = 1/168 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   +C+ L  + LS N  SG +P         L  L L  N  SGE+P SL NLS S
Sbjct: 239 IPPALFNCTSLHYIDLSHNALSGSVPPFLQASSSALNYLSLYENNLSGEIPSSLGNLS-S 297

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L LS N+  G +  +L      TLQ L L  N  +G + P + N S L  L L  N 
Sbjct: 298 LALLLLSHNSLGGSLPESL--GKLKTLQALDLSYNNLSGTVAPAIYNISSLNFLGLGANQ 355

Query: 389 LSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           + GT+P+S+G +L+ + +L L  +  EG IP  L     L+ L L  N
Sbjct: 356 IVGTLPTSIGNTLTSITELILEGSRFEGPIPASLANATNLQYLDLRSN 403

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 62/169 (36%), Positives = 83/169 (49%), Gaps = 2/169 (1%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNF-SGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           P  GS +LL  L L +N   +G+   M +L+    LK L L  N   G +   +TN+  S
Sbjct: 410 PSLGSLTLLSYLDLGANRLQAGDWSFMSSLVNCTQLKNLWLDRNNLQGTISTYITNIPKS 469

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + L  N F+G I   + +    T+  + L NN  +G+IP TL N   +  L +S N 
Sbjct: 470 LEIMVLKHNQFTGSIPSEIGKFTNLTV--IQLDNNFLSGEIPDTLGNLQNMSILTISKNQ 527

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            SG IP S+G L KL +L    N L G IP  L   K L TL L  N L
Sbjct: 528 FSGEIPRSIGKLEKLTELLFNENNLTGLIPSSLEGCKQLTTLNLSSNSL 576

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 58/175 (33%), Positives = 88/175 (50%), Gaps = 3/175 (1%)
 Frame = +2

Query: 20  ELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG---ELPESL 190
           E P+P    + + L+ L L SN F+G +P  +L  +  L  LDL  N           SL
Sbjct: 382 EGPIPASLANATNLQYLDLRSNAFTGVIP--SLGSLTLLSYLDLGANRLQAGDWSFMSSL 439

Query: 191 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 370
            N +  L  L L  NN  G I   +   PK+ L+ + L++N FTG IP  +   + L  +
Sbjct: 440 VNCT-QLKNLWLDRNNLQGTISTYITNIPKS-LEIMVLKHNQFTGSIPSEIGKFTNLTVI 497

Query: 371 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L  N+LSG IP +LG+L  +  L +  N   GEIP+ +  ++ L  L+ + N+L
Sbjct: 498 QLDNNFLSGEIPDTLGNLQNMSILTISKNQFSGEIPRSIGKLEKLTELLFNENNL 552

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 58/167 (34%), Positives = 85/167 (50%)
 Frame = +2

Query: 35  PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 214
           P   + S LE + + +N   G++  D + ++  L+ L+LS N    E+PE+L+  S  L 
Sbjct: 97  PCVANLSFLERIHMPNNQLVGQISPD-IGQLTQLRYLNLSMNSLRCEIPEALSACS-HLE 154

Query: 215 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS 394
           T+DL SN+  G I P+L +   ++LQ + L  N   G IPP L     L +L L  N L+
Sbjct: 155 TIDLDSNSLQGEIPPSLARC--SSLQTVILGYNNLQGSIPPQLGLLPSLYTLFLPSNNLT 212

Query: 395 GTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           G+IP  LG    L  + L  N L G IP  L    +L  + L  N L
Sbjct: 213 GSIPEFLGQSKNLTWVNLQNNSLTGWIPPALFNCTSLHYIDLSHNAL 259

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 62/170 (36%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKV-LDLSFNEFSGELPESLTNLSA 205
            +P     C  L +L LSSN+  G +P + L  +  L V LDLS N+ +G++P  +  L  
Sbjct: 556  IPSSLEGCKQLTTLNLSSNSLYGGIPRE-LFSISTLSVGLDLSNNKLTGDIPFEIGGL-I 613

Query: 206  SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            +L +L LS+N  SG I   L Q     LQ L+L+ N     IP +  N   +  + LS N
Sbjct: 614  NLNSLSLSNNQLSGEIPSTLGQCL--LLQSLHLEANNLHRSIPDSFINLKGITVMDLSQN 671

Query: 386  YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             LSG IP  L SLS L+ L L  N LEG +P   ++ +  +  I   N L
Sbjct: 672  NLSGRIPQFLESLSSLQILNLSFNDLEGPVPGGGIFARPNDVFIQGNNKL 721

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 51/153 (33%), Positives = 77/153 (50%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P F G    L  + L +N+ +G +P   L     L  +DLS N  SG +P  L   S++
Sbjct: 215 IPEFLGQSKNLTWVNLQNNSLTGWIP-PALFNCTSLHYIDLSHNALSGSVPPFLQASSSA 273

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L  NN SG I  +L     ++L  L L +N   G +P +L     L +L LS+N 
Sbjct: 274 LNYLSLYENNLSGEIPSSL--GNLSSLALLLLSHNSLGGSLPESLGKLKTLQALDLSYNN 331

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           LSGT+  ++ ++S L  L L  N + G +P  +
Sbjct: 332 LSGTVAPAIYNISSLNFLGLGANQIVGTLPTSI 364

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 50/153 (32%), Positives = 81/153 (52%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +C+ L++L L  NN  G +        + L+++ L  N+F+G +P  +   + +L  + L
Sbjct: 441 NCTQLKNLWLDRNNLQGTISTYITNIPKSLEIMVLKHNQFTGSIPSEIGKFT-NLTVIQL 499

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            +N  SG I P+   N +N +  L +  N F+G+IP ++    +L  L  + N L+G IP
Sbjct: 500 DNNFLSGEI-PDTLGNLQN-MSILTISKNQFSGEIPRSIGKLEKLTELLFNENNLTGLIP 557

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
           SSL    +L  L L  N L G IP+EL  + TL
Sbjct: 558 SSLEGCKQLTTLNLSSNSLYGGIPRELFSISTL 590

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 40/112 (35%), Positives = 64/112 (57%)
 Frame = +2

Query: 200 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           ++ ++ LDL S N +G I P  C    + L+ +++ NN   G+I P +   ++L  L+LS
Sbjct: 78  ASRVIALDLESENIAGSIFP--CVANLSFLERIHMPNNQLVGQISPDIGQLTQLRYLNLS 135

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            N L   IP +L + S L  + L  N L+GEIP  L    +L+T+IL +N+L
Sbjct: 136 MNSLRCEIPEALSACSHLETIDLDSNSLQGEIPPSLARCSSLQTVILGYNNL 187

[169][TOP]
>UniRef100_B9ESX3 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9ESX3_ORYSJ
          Length = 1305

 Score =  107 bits (268), Expect = 4e-22
 Identities = 73/181 (40%), Positives = 96/181 (53%), Gaps = 7/181 (3%)
 Frame = +2

Query: 14  SLELP-------LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 172
           SL LP       L P  G+ +    L LSSN   GE+P  ++ ++R L+ L+LS+N FSG
Sbjct: 74  SLSLPSSNLAGTLSPAIGNLTFPRRLNLSSNGLYGEIPT-SIGRLRRLQWLNLSYNSFSG 132

Query: 173 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 352
             P +LT+   SL  LDL  N   G I+P    N    LQ L L NN   G IPP+L+N 
Sbjct: 133 AFPVNLTSC-ISLKILDLDYNQLGG-IIPVELGNTLTQLQMLLLTNNSIIGPIPPSLANL 190

Query: 353 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           S L  L+L +N+L G IP  LG+   L +L L  NML GE P  L  +  L  + +  N 
Sbjct: 191 SLLQDLYLDYNHLEGLIPPCLGNFPVLHELSLEANMLTGEFPHSLWNLSALRVIGVGLNM 250

Query: 533 L 535
           L
Sbjct: 251 L 251

 Score =  100 bits (249), Expect = 7e-20
 Identities = 63/153 (41%), Positives = 84/153 (54%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G    L+ L LS N+FSG  P++ L     LK+LDL +N+  G +P  L N    
Sbjct: 110 IPTSIGRLRRLQWLNLSYNSFSGAFPVN-LTSCISLKILDLDYNQLGGIIPVELGNTLTQ 168

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L++N+  GPI P+L     + LQ+LYL  N   G IPP L N   L  L L  N 
Sbjct: 169 LQMLLLTNNSIIGPIPPSLAN--LSLLQDLYLDYNHLEGLIPPCLGNFPVLHELSLEANM 226

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
           L+G  P SL +LS LR + + LNML+G IP  +
Sbjct: 227 LTGEFPHSLWNLSALRVIGVGLNMLQGSIPANI 259

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 61/164 (37%), Positives = 89/164 (54%), Gaps = 1/164 (0%)
 Frame = +2

Query: 47  SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 226
           +CS L+ L LS N F G+LP   +     L++LDL  N FSG +P  ++NL   L  LDL
Sbjct: 340 NCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISNL-IGLRLLDL 398

Query: 227 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
             N  SG I  ++       L +L L N G +G IP T+ N ++L  L      L G IP
Sbjct: 399 GFNPISGVIPESI--GKLTNLVDLALYNTGLSGLIPSTIGNLTKLNRLLAFHTNLEGPIP 456

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI-LDFNDL 535
           +++G L  L +L L  N L G IP+E++ + +L  ++ L +N L
Sbjct: 457 ATIGRLKNLFNLDLSFNRLNGSIPREILELPSLAWILDLSYNSL 500

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 67/174 (38%), Positives = 93/174 (53%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +LE P+P   G    L +L LS N  +G +P + L       +LDLS+N  SG LP  + 
Sbjct: 450 NLEGPIPATIGRLKNLFNLDLSFNRLNGSIPREILELPSLAWILDLSYNSLSGHLPSEVG 509

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
            L A+L  L LS N  SG I PN   N +  L+ L L NN F G +P +L+N   L  L+
Sbjct: 510 TL-ANLNQLILSGNQLSGQI-PNSIGNCE-VLEFLLLDNNSFGGDMPQSLTNLKGLNVLN 566

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+ N LSG IP+++ ++  L+ L L  N   G IP  L     L+ L + FN+L
Sbjct: 567 LTVNKLSGRIPNAISNIGNLQYLCLAHNNFSGPIPAALQNFTLLKQLDVSFNNL 620

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 64/167 (38%), Positives = 89/167 (53%), Gaps = 4/167 (2%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF---SGELPESLTNL 199
           +P    + S L  L L+ NNF+G +P  TL  +  LK L +  N+    +G+  E +T+L
Sbjct: 280 IPSSLSNLSRLTDLYLADNNFTGFVP-PTLGMLHSLKYLYIGTNQLEADNGKGSEFVTSL 338

Query: 200 S-ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
           +  S L   + S+NF G  LP    N   TLQ L L+NN F+G IP  +SN   L  L L
Sbjct: 339 ANCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISNLIGLRLLDL 398

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 517
            FN +SG IP S+G L+ L DL L+   L G IP  +  +  L  L+
Sbjct: 399 GFNPISGVIPESIGKLTNLVDLALYNTGLSGLIPSTIGNLTKLNRLL 445

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/131 (41%), Positives = 73/131 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   LP   G+ + L  L LS N  SG++P +++     L+ L L  N F G++P+SLT
Sbjct: 499 SLSGHLPSEVGTLANLNQLILSGNQLSGQIP-NSIGNCEVLEFLLLDNNSFGGDMPQSLT 557

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL   L  L+L+ N  SG I PN   N  N LQ L L +N F+G IP  L N + L  L 
Sbjct: 558 NLKG-LNVLNLTVNKLSGRI-PNAISNIGN-LQYLCLAHNNFSGPIPAALQNFTLLKQLD 614

Query: 374 LSFNYLSGTIP 406
           +SFN L G +P
Sbjct: 615 VSFNNLQGEVP 625

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 64/205 (31%), Positives = 98/205 (47%), Gaps = 32/205 (15%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN------------ 160
           LE  +PP  G+  +L  L+L +N  +GE P  +L  +  L+V+ +  N            
Sbjct: 203 LEGLIPPCLGNFPVLHELSLEANMLTGEFP-HSLWNLSALRVIGVGLNMLQGSIPANIGD 261

Query: 161 -------------EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY 301
                         F G +P SL+NLS  L  L L+ NNF+G + P L     ++L+ LY
Sbjct: 262 KFPAMRFFGLHENRFHGAIPSSLSNLS-RLTDLYLADNNFTGFVPPTL--GMLHSLKYLY 318

Query: 302 L------QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNM 460
           +       +NG   +   +L+NCS+L  L LS N+  G +P S+ +LS  L+ L L  N 
Sbjct: 319 IGTNQLEADNGKGSEFVTSLANCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNS 378

Query: 461 LEGEIPQELMYVKTLETLILDFNDL 535
             G IP ++  +  L  L L FN +
Sbjct: 379 FSGTIPHDISNLIGLRLLDLGFNPI 403

[170][TOP]
>UniRef100_B9FQM7 Putative uncharacterized protein n=2 Tax=Oryza sativa
           RepID=B9FQM7_ORYSJ
          Length = 748

 Score =  107 bits (268), Expect = 4e-22
 Identities = 71/171 (41%), Positives = 95/171 (55%), Gaps = 2/171 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA- 205
           + P  G+ + L  L LS N  +G LPM+ LL  R + VLD+SFN   G LPE  ++    
Sbjct: 102 ISPLLGNLTGLLHLNLSHNLLNGNLPME-LLFSRSIIVLDVSFNRLDGSLPELQSSSGGF 160

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS-NCSELVSLHLSF 382
            L  L++SSN F+G     L +  KN +  L   NN FTG+IP ++  N   L  L LS+
Sbjct: 161 PLQVLNISSNLFTGQFSSKLWEAMKNIVA-LNASNNSFTGQIPSSICINSPSLAILDLSY 219

Query: 383 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           N  SG+IP  LG+ SKLR+ K   N   G +P+EL    +LE L L  NDL
Sbjct: 220 NQFSGSIPPELGNCSKLREFKAGYNNFNGALPEELFSATSLEHLSLPSNDL 270

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 59/193 (30%), Positives = 85/193 (44%), Gaps = 24/193 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+CS L       NNF+G LP + L     L+ L L  N+  G L  S       
Sbjct: 226 IPPELGNCSKLREFKAGYNNFNGALP-EELFSATSLEHLSLPSNDLQGVLDGSDILKLVK 284

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL---- 376
           L  LDL S   SG I  ++ Q   +TL+EL L NN  +G++P  + NC+ L  L L    
Sbjct: 285 LTVLDLGSTGLSGNIPDSIGQ--LSTLEELRLDNNNMSGELPSAVGNCTNLRYLSLRNNK 342

Query: 377 --------------------SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
                               S N  +GT+P S+ S S L  L+L  N   G++   +  +
Sbjct: 343 FVGDLSKVNFTRLNLRIADFSINNFTGTVPESIYSCSNLIALRLAFNKFHGQLSPRMGNL 402

Query: 497 KTLETLILDFNDL 535
           K++    +  N L
Sbjct: 403 KSMSFFSIADNHL 415

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 61/190 (32%), Positives = 89/190 (46%), Gaps = 31/190 (16%)
 Frame = +2

Query: 59   LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 238
            L  L + S    G++P   + K++ L+VLDLS N  SG++P  +++L   L  LD+++N+
Sbjct: 457  LRVLTIDSCGLVGQIPT-WISKLKKLEVLDLSNNMLSGKIPFWISDLPV-LFYLDITNNS 514

Query: 239  FSGPILPNLCQNP-----KNTLQ--------------------------ELYLQNNGFTG 325
             +G I   L   P     KN  Q                           L L NNGFTG
Sbjct: 515  LTGDIPTALMNTPMLQLGKNAAQLDPNFLELPVYWTRSRQYRLLNAFPNALNLGNNGFTG 574

Query: 326  KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 505
             IPP +     L   ++SFN LSG IP  + +L+ L+ L L  N L GE+P  L  +  L
Sbjct: 575  VIPPEIGRLKMLDGFNISFNRLSGEIPQQICNLTNLQLLDLSSNQLTGELPSALTDMHFL 634

Query: 506  ETLILDFNDL 535
                +  N+L
Sbjct: 635  SKFNVSNNEL 644

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 58/210 (27%), Positives = 87/210 (41%), Gaps = 50/210 (23%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           LP   G+C+ L  L+L +N F G+L      ++  L++ D S N F+G +PES+ + S +
Sbjct: 323 LPSAVGNCTNLRYLSLRNNKFVGDLSKVNFTRLN-LRIADFSINNFTGTVPESIYSCS-N 380

Query: 209 LLTLDLSSNNFSGPILPNL----------------------------CQNPK-------- 280
           L+ L L+ N F G + P +                            C+N          
Sbjct: 381 LIALRLAFNKFHGQLSPRMGNLKSMSFFSIADNHLTNITNALQILKSCKNLTAVLIGTNF 440

Query: 281 --------------NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 418
                           L+ L + + G  G+IP  +S   +L  L LS N LSG IP  + 
Sbjct: 441 KGETISKSETIDGFENLRVLTIDSCGLVGQIPTWISKLKKLEVLDLSNNMLSGKIPFWIS 500

Query: 419 SLSKLRDLKLWLNMLEGEIPQELMYVKTLE 508
            L  L  L +  N L G+IP  LM    L+
Sbjct: 501 DLPVLFYLDITNNSLTGDIPTALMNTPMLQ 530

[171][TOP]
>UniRef100_A7Q7D9 Chromosome chr18 scaffold_59, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7Q7D9_VITVI
          Length = 590

 Score =  107 bits (268), Expect = 4e-22
 Identities = 75/209 (35%), Positives = 105/209 (50%), Gaps = 42/209 (20%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMD-----TLLKM----------------RGLKVL 145
           LP   G  S L+ L LSSNN SGE+P +     TL +                 R LK+L
Sbjct: 183 LPARIGDLSKLKILILSSNNLSGEIPTNLSNIRTLSRFAANENNFNGNIPNGISRFLKIL 242

Query: 146 DLSFNEFSGELPESL---------------------TNLSASLLTLDLSSNNFSGPILPN 262
           DLS+N+ SG +P  L                      N+S+SL+ L L SN+ SG ++P+
Sbjct: 243 DLSYNKLSGSIPSDLMMQPKLQRVDLSYNLLGGSIPANMSSSLVRLRLGSNSLSG-VIPS 301

Query: 263 LCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 442
                   L  L L+NN  +G IPP L +C  L  L+L+ N L+G +P  LGSL+ L+ L
Sbjct: 302 AKLGTLLKLTYLELENNSLSGSIPPELGSCQSLALLNLAMNNLAGRLPLELGSLNHLQVL 361

Query: 443 KLWLNMLEGEIPQELMYVKTLETLILDFN 529
           KL  N L GEIP ++  +++L  L +  N
Sbjct: 362 KLQSNKLTGEIPDQITQIQSLLVLNISEN 390

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 66/196 (33%), Positives = 97/196 (49%), Gaps = 22/196 (11%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           SL   +PP  GSC  L  L L+ NN +G LP++ L  +  L+VL L  N+ +GE+P+ +T
Sbjct: 319 SLSGSIPPELGSCQSLALLNLAMNNLAGRLPLE-LGSLNHLQVLKLQSNKLTGEIPDQIT 377

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL---- 361
            +  SLL L++S N  SG I  ++ +    +L  L L  N   G IPP++S  + L    
Sbjct: 378 QIQ-SLLVLNISENLLSGGIPSSIWR--LKSLTNLNLGGNRLLGSIPPSISRFNSLLELQ 434

Query: 362 ------------------VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
                             ++L+LS N   G IP++L  LS L    L  N   GEIP  L
Sbjct: 435 LGRNQLSGHIPMMPSSLQIALNLSHNLFEGPIPNTLSRLSSLEVWDLSNNKFSGEIPIFL 494

Query: 488 MYVKTLETLILDFNDL 535
              +++  L+L  N L
Sbjct: 495 TLFRSMTQLLLSNNQL 510

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 62/161 (38%), Positives = 83/161 (51%)
 Frame = +2

Query: 53  SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 232
           S L  L L SN+ SG +P   L  +  L  L+L  N  SG +P  L +   SL  L+L+ 
Sbjct: 283 SSLVRLRLGSNSLSGVIPSAKLGTLLKLTYLELENNSLSGSIPPELGSCQ-SLALLNLAM 341

Query: 233 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 412
           NN +G +   L     N LQ L LQ+N  TG+IP  ++    L+ L++S N LSG IPSS
Sbjct: 342 NNLAGRLPLEL--GSLNHLQVLKLQSNKLTGEIPDQITQIQSLLVLNISENLLSGGIPSS 399

Query: 413 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           +  L  L +L L  N L G IP  +    +L  L L  N L
Sbjct: 400 IWRLKSLTNLNLGGNRLLGSIPPSISRFNSLLELQLGRNQL 440

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 59/156 (37%), Positives = 85/156 (54%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           SL+  S   SG LP+  + ++  L+ LDLS N  S      +T       TL+LSSN FS
Sbjct: 75  SLSDLSLTESGFLPL--VCEIVSLEALDLSNNRLSSIPDGFITACGKIGGTLNLSSNQFS 132

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G +  +L ++    L+ L L  N F G IP  + +  +LV + LS N LSG++P+ +G L
Sbjct: 133 GHVPTHLGKS--RVLEHLLLSKNFFHGGIPKVIFDYHKLVLIDLSNNQLSGSLPARIGDL 190

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           SKL+ L L  N L GEIP  L  ++TL     + N+
Sbjct: 191 SKLKILILSSNNLSGEIPTNLSNIRTLSRFAANENN 226

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 60/169 (35%), Positives = 80/169 (47%), Gaps = 43/169 (25%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP------ESL 190
           LP   GS + L+ L L SN  +GE+P D + +++ L VL++S N  SG +P      +SL
Sbjct: 348 LPLELGSLNHLQVLKLQSNKLTGEIP-DQITQIQSLLVLNISENLLSGGIPSSIWRLKSL 406

Query: 191 TNLSA-----------------SLLTLDLSSNNFSG--PILP-----------NLCQNP- 277
           TNL+                  SLL L L  N  SG  P++P           NL + P 
Sbjct: 407 TNLNLGGNRLLGSIPPSISRFNSLLELQLGRNQLSGHIPMMPSSLQIALNLSHNLFEGPI 466

Query: 278 KNTLQELY------LQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
            NTL  L       L NN F+G+IP  L+    +  L LS N LSG IP
Sbjct: 467 PNTLSRLSSLEVWDLSNNKFSGEIPIFLTLFRSMTQLLLSNNQLSGVIP 515

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 60/182 (32%), Positives = 84/182 (46%), Gaps = 25/182 (13%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLL---KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 229
           LE+L LS+N  S  +P   +    K+ G   L+LS N+FSG +P  L   S  L  L LS
Sbjct: 96  LEALDLSNNRLSS-IPDGFITACGKIGG--TLNLSSNQFSGHVPTHLGK-SRVLEHLLLS 151

Query: 230 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 409
            N F G I   +    K  L +L   NN  +G +P  + + S+L  L LS N LSG IP+
Sbjct: 152 KNFFHGGIPKVIFDYHKLVLIDL--SNNQLSGSLPARIGDLSKLKILILSSNNLSGEIPT 209

Query: 410 SLGSLSK----------------------LRDLKLWLNMLEGEIPQELMYVKTLETLILD 523
           +L ++                        L+ L L  N L G IP +LM    L+ + L 
Sbjct: 210 NLSNIRTLSRFAANENNFNGNIPNGISRFLKILDLSYNKLSGSIPSDLMMQPKLQRVDLS 269

Query: 524 FN 529
           +N
Sbjct: 270 YN 271

[172][TOP]
>UniRef100_A5B5R9 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5B5R9_VITVI
          Length = 1205

 Score =  107 bits (268), Expect = 4e-22
 Identities = 72/174 (41%), Positives = 96/174 (55%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L   +P    S S L +++LS+NN SG LPMD       LK L+LS N  SG++P  L 
Sbjct: 158 NLTSSIPATIFSISSLLNISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGKIPTGLG 217

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
                L  + L+ N+F+G I PN   N    LQ L L+NN  TG+IP  LS+C EL  L 
Sbjct: 218 QC-IKLQVISLAYNDFTGSI-PNGIGNLVE-LQRLSLRNNSLTGEIPSNLSHCRELRVLS 274

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            SFN  +G IP ++GSL  L +L L  N L G IP+E+  +  L  L L  N +
Sbjct: 275 SSFNQFTGGIPQAIGSLCNLEELYLAFNKLTGGIPREIGNLSNLNILQLGSNGI 328

 Score =  107 bits (267), Expect = 5e-22
 Identities = 66/169 (39%), Positives = 95/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS   LE L L+ N  +G +P + +  +  L +L L  N  SG +P  + N+S S
Sbjct: 284 IPQAIGSLCNLEELYLAFNKLTGGIPRE-IGNLSNLNILQLGSNGISGPIPAEIFNIS-S 341

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +D ++N+ SG +   +C++  N LQ LYL  N  +G++P TLS C EL+ L LSFN 
Sbjct: 342 LQVIDFTNNSLSGSLPMGICKHLPN-LQGLYLAQNHLSGQLPTTLSLCGELLFLSLSFNK 400

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
             G+IP  +G+LSKL  + L  N L G IP     +K L+ L L  N L
Sbjct: 401 FRGSIPREIGNLSKLEHIDLRSNSLVGSIPTSFGNLKALKFLNLGINFL 449

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 72/221 (32%), Positives = 106/221 (47%), Gaps = 48/221 (21%)
 Frame = +2

Query: 11  LSLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 190
           + LE  + P  G+ S L SL LS+N F   LP D + K + L+ L+L  N+  G +PE++
Sbjct: 61  MGLEGTIAPQVGNLSFLVSLDLSNNYFHDSLPKD-IGKCKELQQLNLFNNKLVGGIPEAI 119

Query: 191 TNLS-----------------------------------------------ASLLTLDLS 229
            NLS                                               +SLL + LS
Sbjct: 120 CNLSKLEELYLGNNQLIGEIPKKMNXLQNLKVLSFPMNNLTSSIPATIFSISSLLNISLS 179

Query: 230 SNNFSGPILPNLC-QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 406
           +NN SG +  ++C  NPK  L+EL L +N  +GKIP  L  C +L  + L++N  +G+IP
Sbjct: 180 NNNLSGSLPMDMCYANPK--LKELNLSSNHLSGKIPTGLGQCIKLQVISLAYNDFTGSIP 237

Query: 407 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
           + +G+L +L+ L L  N L GEIP  L + + L  L   FN
Sbjct: 238 NGIGNLVELQRLSLRNNSLTGEIPSNLSHCRELRVLSSSFN 278

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 57/170 (33%), Positives = 93/170 (54%), Gaps = 1/170 (0%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    + S L+ +  ++N+ SG LPM     +  L+ L L+ N  SG+LP +L+ L  
Sbjct: 331 PIPAEIFNISSLQVIDFTNNSLSGSLPMGICKHLPNLQGLYLAQNHLSGQLPTTLS-LCG 389

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            LL L LS N F G I   +    K  L+ + L++N   G IP +  N   L  L+L  N
Sbjct: 390 ELLFLSLSFNKFRGSIPREIGNLSK--LEHIDLRSNSLVGSIPTSFGNLKALKFLNLGIN 447

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-MYVKTLETLILDFND 532
           +L+GT+P ++ ++S+L++L L  N L G +P  +  ++  LE L +  N+
Sbjct: 448 FLTGTVPEAIFNISELQNLALVQNHLSGSLPSSIGTWLPDLEGLYIGANE 497

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 60/161 (37%), Positives = 87/161 (54%), Gaps = 5/161 (3%)
 Frame = +2

Query: 5   LFLSLEL-----PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS 169
           LFLSL        +P   G+ S LE + L SN+  G +P  +   ++ LK L+L  N  +
Sbjct: 392 LFLSLSFNKFRGSIPREIGNLSKLEHIDLRSNSLVGSIPT-SFGNLKALKFLNLGINFLT 450

Query: 170 GELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN 349
           G +PE++ N+S  L  L L  N+ SG  LP+        L+ LY+  N F+G IP ++SN
Sbjct: 451 GTVPEAIFNIS-ELQNLALVQNHLSGS-LPSSIGTWLPDLEGLYIGANEFSGTIPMSISN 508

Query: 350 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 472
            S+L  L LS N  +G +P  L +L+KL+ L L  N L  E
Sbjct: 509 MSKLTVLSLSDNSFTGNVPKDLCNLTKLKFLNLAHNQLTDE 549

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 62/156 (39%), Positives = 78/156 (50%)
 Frame = +2

Query: 32   PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 211
            P  FG    L  L L SN  +  +P  +L  +R L VL+LS N  +G LP  + N+  S+
Sbjct: 679  PSCFGDLLALRELFLDSNALAFNIPT-SLWSLRDLLVLNLSSNFLTGNLPPEVGNMK-SI 736

Query: 212  LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL 391
             TLDLS N  SG I   +       L  L L  N   G I     +   L SL LS N L
Sbjct: 737  TTLDLSKNLVSGYIPSRM--GKLQYLITLSLSQNRLQGPIXVEFGDLVSLESLDLSHNNL 794

Query: 392  SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
            SGTIP SL +L  L+ L +  N L+GEIP    +VK
Sbjct: 795  SGTIPKSLEALIYLKYLNVSFNKLQGEIPNGGPFVK 830

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 68/185 (36%), Positives = 91/185 (49%), Gaps = 26/185 (14%)
 Frame = +2

Query: 59  LESLALSSNNFSGELPMDTLLKMRG-LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN 235
           L+ L L+ N+ SG+LP  T L + G L  L LSFN+F G +P  + NLS  L  +DL SN
Sbjct: 367 LQGLYLAQNHLSGQLP--TTLSLCGELLFLSLSFNKFRGSIPREIGNLS-KLEHIDLRSN 423

Query: 236 NFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG------ 397
           +  G I P    N K  L+ L L  N  TG +P  + N SEL +L L  N+LSG      
Sbjct: 424 SLVGSI-PTSFGNLK-ALKFLNLGINFLTGTVPEAIFNISELQNLALVQNHLSGSLPSSI 481

Query: 398 -------------------TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 520
                              TIP S+ ++SKL  L L  N   G +P++L  +  L+ L L
Sbjct: 482 GTWLPDLEGLYIGANEFSGTIPMSISNMSKLTVLSLSDNSFTGNVPKDLCNLTKLKFLNL 541

Query: 521 DFNDL 535
             N L
Sbjct: 542 AHNQL 546

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 60/169 (35%), Positives = 83/169 (49%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +P   G    L+ L ++ N   G +P D L  ++ L  L LS N+ SG  P    +L A 
Sbjct: 630  IPTTLGRLQKLQRLHIAGNRIRGSIPND-LCHLKNLGYLGLSSNKLSGSTPSCFGDLLA- 687

Query: 209  LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
            L  L L SN  +  I  +L       L  L L +N  TG +PP + N   + +L LS N 
Sbjct: 688  LRELFLDSNALAFNIPTSLWS--LRDLLVLNLSSNFLTGNLPPEVGNMKSITTLDLSKNL 745

Query: 389  LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            +SG IPS +G L  L  L L  N L+G I  E   + +LE+L L  N+L
Sbjct: 746  VSGYIPSRMGKLQYLITLSLSQNRLQGPIXVEFGDLVSLESLDLSHNNL 794

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 60/199 (30%), Positives = 82/199 (41%), Gaps = 30/199 (15%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMD------------------------------TL 118
            +P    + S L  L+LS N+F+G +P D                              +L
Sbjct: 502  IPMSISNMSKLTVLSLSDNSFTGNVPKDLCNLTKLKFLNLAHNQLTDEHLASGVGFLTSL 561

Query: 119  LKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL 298
               + L+ L + +N   G LP SL NL  +L +    +  F G I P    N  N +  L
Sbjct: 562  TNCKFLRYLWIGYNPLKGTLPNSLGNLPIALESFTAYACQFRGTI-PTGIGNLTNLIW-L 619

Query: 299  YLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
             L  N  TG IP TL    +L  LH++ N + G+IP+ L  L  L  L L  N L G  P
Sbjct: 620  DLGANDLTGSIPTTLGRLQKLQRLHIAGNRIRGSIPNDLCHLKNLGYLGLSSNKLSGSTP 679

Query: 479  QELMYVKTLETLILDFNDL 535
                 +  L  L LD N L
Sbjct: 680  SCFGDLLALRELFLDSNAL 698

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 34/90 (37%), Positives = 46/90 (51%)
 Frame = +2

Query: 266 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445
           C  P   +  + L N G  G I P + N S LVSL LS NY   ++P  +G   +L+ L 
Sbjct: 46  CNAPHQRVSXINLSNMGLEGTIAPQVGNLSFLVSLDLSNNYFHDSLPKDIGKCKELQQLN 105

Query: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+ N L G IP+ +  +  LE L L  N L
Sbjct: 106 LFNNKLVGGIPEAICNLSKLEELYLGNNQL 135

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 38/106 (35%), Positives = 57/106 (53%)
 Frame = +2

Query: 218 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 397
           ++LS+    G I P +     + L  L L NN F   +P  +  C EL  L+L  N L G
Sbjct: 56  INLSNMGLEGTIAPQV--GNLSFLVSLDLSNNYFHDSLPKDIGKCKELQQLNLFNNKLVG 113

Query: 398 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            IP ++ +LSKL +L L  N L GEIP+++  ++ L+ L    N+L
Sbjct: 114 GIPEAICNLSKLEELYLGNNQLIGEIPKKMNXLQNLKVLSFPMNNL 159

[173][TOP]
>UniRef100_UPI000198443A PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI000198443A
          Length = 1107

 Score =  107 bits (267), Expect = 5e-22
 Identities = 70/174 (40%), Positives = 95/174 (54%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L  P+PP  G+   L +L L +N  SG +P +  L +R L VL+LS N  SG +P S+ 
Sbjct: 216 NLSGPIPPSIGNLRNLTTLYLHTNKLSGSIPHEIGL-LRSLNVLELSTNNLSGPIPPSIG 274

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL  +L TL L  N  SG I   +      +L +L L  N  +G IPP++ N   L +L+
Sbjct: 275 NLR-NLTTLYLYENKLSGSIPHEI--GSLRSLNDLVLSTNNLSGPIPPSIGNLRNLTTLY 331

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N LSG+IP  +GSL  L DL L  N L G IP  +  ++ L TL L  N L
Sbjct: 332 LYENKLSGSIPHEIGSLRSLNDLVLSTNNLSGPIPPSIGNLRNLTTLYLYENKL 385

 Score =  107 bits (266), Expect = 7e-22
 Identities = 72/192 (37%), Positives = 102/192 (53%), Gaps = 23/192 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS   L  L LS+NN SG +P  ++  +R L  L L  N+ SG +P  + +L+ S
Sbjct: 53  IPHEIGSLRSLNDLELSTNNLSGFIP-PSIGNLRNLTTLYLYENKLSGSIPHEIGSLT-S 110

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKN-----------------------TLQELYLQNNGF 319
           L  L+LS+NN SGPILP++  N +N                       +L +L L  N  
Sbjct: 111 LNDLELSTNNLSGPILPSI-GNLRNLTTLYLHTNKLSGSIPHEIGLLRSLNDLELSTNNL 169

Query: 320 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 499
           +G IPP++ N   L +L+L  N LSG+IP  +GSL+ L DL+L  N L G IP  +  ++
Sbjct: 170 SGPIPPSIGNLRNLTTLYLDENKLSGSIPHEIGSLTSLNDLELSTNNLSGPIPPSIGNLR 229

Query: 500 TLETLILDFNDL 535
            L TL L  N L
Sbjct: 230 NLTTLYLHTNKL 241

 Score =  105 bits (261), Expect = 3e-21
 Identities = 69/169 (40%), Positives = 96/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS + L  L LS+NN SG + + ++  +R L  L L  N+ SG +P  +  L  S
Sbjct: 101 IPHEIGSLTSLNDLELSTNNLSGPI-LPSIGNLRNLTTLYLHTNKLSGSIPHEI-GLLRS 158

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L+LS+NN SGPI P++  N +N L  LYL  N  +G IP  + + + L  L LS N 
Sbjct: 159 LNDLELSTNNLSGPIPPSI-GNLRN-LTTLYLDENKLSGSIPHEIGSLTSLNDLELSTNN 216

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSG IP S+G+L  L  L L  N L G IP E+  +++L  L L  N+L
Sbjct: 217 LSGPIPPSIGNLRNLTTLYLHTNKLSGSIPHEIGLLRSLNVLELSTNNL 265

 Score =  101 bits (251), Expect = 4e-20
 Identities = 68/173 (39%), Positives = 93/173 (53%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L  P+PP  G+   L +L L  N  SG +P + +  +R L  L LS N  SG +P S+ 
Sbjct: 264 NLSGPIPPSIGNLRNLTTLYLYENKLSGSIPHE-IGSLRSLNDLVLSTNNLSGPIPPSIG 322

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL  +L TL L  N  SG I   +      +L +L L  N  +G IPP++ N   L +L+
Sbjct: 323 NLR-NLTTLYLYENKLSGSIPHEI--GSLRSLNDLVLSTNNLSGPIPPSIGNLRNLTTLY 379

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 532
           L  N LSG IP  +G LS L  L L  N L G IPQE+  +  L++L LD N+
Sbjct: 380 LYENKLSGFIPQEIGLLSNLTHLLLHYNQLNGPIPQEIDNLIHLKSLHLDENN 432

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 66/174 (37%), Positives = 92/174 (52%)
 Frame = +2

Query: 14  SLELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT 193
           +L  P+ P  G+   L +L L +N  SG +P +  L +R L  L+LS N  SG +P S+ 
Sbjct: 120 NLSGPILPSIGNLRNLTTLYLHTNKLSGSIPHEIGL-LRSLNDLELSTNNLSGPIPPSIG 178

Query: 194 NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           NL  +L TL L  N  SG I   +      +L +L L  N  +G IPP++ N   L +L+
Sbjct: 179 NLR-NLTTLYLDENKLSGSIPHEI--GSLTSLNDLELSTNNLSGPIPPSIGNLRNLTTLY 235

Query: 374 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L  N LSG+IP  +G L  L  L+L  N L G IP  +  ++ L TL L  N L
Sbjct: 236 LHTNKLSGSIPHEIGLLRSLNVLELSTNNLSGPIPPSIGNLRNLTTLYLYENKL 289

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 69/165 (41%), Positives = 91/165 (55%)
 Frame = +2

Query: 41  FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 220
           +G C  L SL +S NN SG +P   L +   L  LDLS N   G++P  L  L+ S+  L
Sbjct: 513 WGQCRSLTSLNISHNNLSGIIPPQ-LGEAIQLHQLDLSSNHLLGKIPRELGRLT-SMFNL 570

Query: 221 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 400
            LS+N  SG I P    N  N L+ L L +N  +G IP  L   S+L  L+LS N    +
Sbjct: 571 LLSNNQLSGNI-PWEVGNLFN-LEHLILASNNLSGSIPKQLGMLSKLSFLNLSKNEFVES 628

Query: 401 IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           IP  +G+L  L+ L L  NML G+IPQEL  ++ LE L L  N+L
Sbjct: 629 IPDEIGNLHSLQSLDLSQNMLNGKIPQELGELQRLEALNLSHNEL 673

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 59/170 (34%), Positives = 82/170 (48%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 205
           P+P    +   L+SL L  NNF+G LP    L    L+      N F+G +P SL N + 
Sbjct: 412 PIPQEIDNLIHLKSLHLDENNFTGHLPQQMCLG-GALENFTAMGNNFTGPIPMSLRNCT- 469

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
           SL  + L+ N   G I       P   L  + L +N   G++      C  L SL++S N
Sbjct: 470 SLFRVRLNRNQLKGNITEGFGVYPN--LNFMDLSSNNLYGELSQKWGQCRSLTSLNISHN 527

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            LSG IP  LG   +L  L L  N L G+IP+EL  + ++  L+L  N L
Sbjct: 528 NLSGIIPPQLGEAIQLHQLDLSSNHLLGKIPRELGRLTSMFNLLLSNNQL 577

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 60/172 (34%), Positives = 84/172 (48%), Gaps = 22/172 (12%)
 Frame = +2

Query: 29   LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
            +PP  G    L  L LSSN+  G++P + L ++  +  L LS N+ SG +P  + NL  +
Sbjct: 533  IPPQLGEAIQLHQLDLSSNHLLGKIPRE-LGRLTSMFNLLLSNNQLSGNIPWEVGNLF-N 590

Query: 209  LLTLDLSSNNFSGPI-----------LPNLCQNP-----------KNTLQELYLQNNGFT 322
            L  L L+SNN SG I             NL +N             ++LQ L L  N   
Sbjct: 591  LEHLILASNNLSGSIPKQLGMLSKLSFLNLSKNEFVESIPDEIGNLHSLQSLDLSQNMLN 650

Query: 323  GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 478
            GKIP  L     L +L+LS N LSG+IPS+   +  L  + +  N LEG +P
Sbjct: 651  GKIPQELGELQRLEALNLSHNELSGSIPSTFADMLSLTSVDISSNQLEGPLP 702

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 33/84 (39%), Positives = 44/84 (52%)
 Frame = +2

Query: 284 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNML 463
           ++  L L  N   G IP  + +   L  L LS N LSG IP S+G+L  L  L L+ N L
Sbjct: 38  SVSSLNLHRNKLFGSIPHEIGSLRSLNDLELSTNNLSGFIPPSIGNLRNLTTLYLYENKL 97

Query: 464 EGEIPQELMYVKTLETLILDFNDL 535
            G IP E+  + +L  L L  N+L
Sbjct: 98  SGSIPHEIGSLTSLNDLELSTNNL 121

[174][TOP]
>UniRef100_UPI0000E12883 Os06g0587000 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E12883
          Length = 1002

 Score =  107 bits (267), Expect = 5e-22
 Identities = 70/169 (41%), Positives = 96/169 (56%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P  FG+   LE + L+SN  +G++P  +L     L  ++L  N  +G +P+SL N S+S
Sbjct: 188 IPYAFGNLPKLEKVVLASNRLTGDIPA-SLGSSLSLTYVNLESNALTGSIPQSLLN-SSS 245

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  L L+ N  +G I   L  +  +TL ++YL  N F G IP   +    L  L+L  N 
Sbjct: 246 LKVLVLTRNTLTGEIPKPLFTS--STLTDIYLDENNFVGSIPHVTATPLPLQYLYLGGNK 303

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSGTIPSSLG+LS L DL L  N L G IP  L ++ TLE L L+ N L
Sbjct: 304 LSGTIPSSLGNLSSLLDLSLTRNNLTGSIPDSLGHIPTLELLNLNVNKL 352

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 65/169 (38%), Positives = 94/169 (55%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   GS   L  + L SN  +G +P  +LL    LKVL L+ N  +GE+P+ L   S++
Sbjct: 212 IPASLGSSLSLTYVNLESNALTGSIPQ-SLLNSSSLKVLVLTRNTLTGEIPKPLFT-SST 269

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  + L  NNF G I P++   P   LQ LYL  N  +G IP +L N S L+ L L+ N 
Sbjct: 270 LTDIYLDENNFVGSI-PHVTATPL-PLQYLYLGGNKLSGTIPSSLGNLSSLLDLSLTRNN 327

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G+IP SLG +  L  L L +N L G +P  +  + +L++L +  N L
Sbjct: 328 LTGSIPDSLGHIPTLELLNLNVNKLTGHVPSSIFNLSSLKSLAMANNSL 376

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 63/170 (37%), Positives = 94/170 (55%), Gaps = 1/170 (0%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRG-LKVLDLSFNEFSGELPESLTNLSA 205
           + P   + + L  L LS+N+F+G +P  ++L + G L  L+LS N   G +P  L++ S 
Sbjct: 92  ISPCIANLTSLTMLQLSNNSFNGSIP--SVLGLLGQLNNLNLSMNSLEGNIPSELSSCS- 148

Query: 206 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 385
            L  LDLS+N   G I  +L Q   N L++++L  N   G+IP    N  +L  + L+ N
Sbjct: 149 QLEILDLSNNFIQGEIPASLSQC--NRLKKIHLSKNKLQGRIPYAFGNLPKLEKVVLASN 206

Query: 386 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            L+G IP+SLGS   L  + L  N L G IPQ L+   +L+ L+L  N L
Sbjct: 207 RLTGDIPASLGSSLSLTYVNLESNALTGSIPQSLLNSSSLKVLVLTRNTL 256

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 68/195 (34%), Positives = 102/195 (52%), Gaps = 26/195 (13%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+ S L  L+L+ NN +G +P D+L  +  L++L+L+ N+ +G +P S+ NLS S
Sbjct: 308 IPSSLGNLSSLLDLSLTRNNLTGSIP-DSLGHIPTLELLNLNVNKLTGHVPSSIFNLS-S 365

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L +L +++N+ +G +  NL     N ++ L L NN F G IPPTL N S L SL+L  N 
Sbjct: 366 LKSLAMANNSLTGELPSNLGYTLPN-IKTLILSNNRFKGPIPPTLVNASNLKSLYLRNNS 424

Query: 389 LSGTIP--------------------------SSLGSLSKLRDLKLWLNMLEGEIPQELM 490
           L+G IP                          SSL + SKL  L +  N L+G IP  + 
Sbjct: 425 LTGLIPFFGSLLNLEEVMLSYNKLEAADWSFISSLSNCSKLTKLLIDGNNLKGNIPPAIG 484

Query: 491 YVKTLETLILDFNDL 535
            +  L  L +  N+L
Sbjct: 485 NLNNLVVLAMAQNNL 499

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 64/191 (33%), Positives = 96/191 (50%), Gaps = 24/191 (12%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P    + S L+SLA+++N+ +GELP +    +  +K L LS N F G +P +L N S +
Sbjct: 356 VPSSIFNLSSLKSLAMANNSLTGELPSNLGYTLPNIKTLILSNNRFKGPIPPTLVNAS-N 414

Query: 209 LLTLDLSSNNFSGPI-----LPNLCQ-------------------NPKNTLQELYLQNNG 316
           L +L L +N+ +G I     L NL +                   +  + L +L +  N 
Sbjct: 415 LKSLYLRNNSLTGLIPFFGSLLNLEEVMLSYNKLEAADWSFISSLSNCSKLTKLLIDGNN 474

Query: 317 FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV 496
             G IPP + N + LV L ++ N LSG IP ++G+L KL DLK     L G IP  L   
Sbjct: 475 LKGNIPPAIGNLNNLVVLAMAQNNLSGQIPDTIGNLVKLTDLK-----LSGNIPSSLGKC 529

Query: 497 KTLETLILDFN 529
             LE+L +  N
Sbjct: 530 VALESLEMQSN 540

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 57/157 (36%), Positives = 83/157 (52%)
 Frame = +2

Query: 65  SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 244
           ++ L+S   SG +    +  +  L +L LS N F+G +P S+  L   L  L+LS N+  
Sbjct: 80  AIDLASEGISGSIS-PCIANLTSLTMLQLSNNSFNGSIP-SVLGLLGQLNNLNLSMNSLE 137

Query: 245 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 424
           G I   L  +  + L+ L L NN   G+IP +LS C+ L  +HLS N L G IP + G+L
Sbjct: 138 GNIPSEL--SSCSQLEILDLSNNFIQGEIPASLSQCNRLKKIHLSKNKLQGRIPYAFGNL 195

Query: 425 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            KL  + L  N L G+IP  L    +L  + L+ N L
Sbjct: 196 PKLEKVVLASNRLTGDIPASLGSSLSLTYVNLESNAL 232

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 50/136 (36%), Positives = 72/136 (52%)
 Frame = +2

Query: 128 RGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ 307
           R +  +DL+    SG +   + NL+ SL  L LS+N+F+G I   L       L  L L 
Sbjct: 76  RRVTAIDLASEGISGSISPCIANLT-SLTMLQLSNNSFNGSIPSVL--GLLGQLNNLNLS 132

Query: 308 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 487
            N   G IP  LS+CS+L  L LS N++ G IP+SL   ++L+ + L  N L+G IP   
Sbjct: 133 MNSLEGNIPSELSSCSQLEILDLSNNFIQGEIPASLSQCNRLKKIHLSKNKLQGRIPYAF 192

Query: 488 MYVKTLETLILDFNDL 535
             +  LE ++L  N L
Sbjct: 193 GNLPKLEKVVLASNRL 208

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 57/194 (29%), Positives = 87/194 (44%), Gaps = 25/194 (12%)
 Frame = +2

Query: 26  PLPPFFGSCSLLESLALSSNNFSGELPM--------DTLLKMRGLKVLDLSF-------- 157
           P+PP   + S L+SL L +N+ +G +P         + +L    L+  D SF        
Sbjct: 404 PIPPTLVNASNLKSLYLRNNSLTGLIPFFGSLLNLEEVMLSYNKLEAADWSFISSLSNCS 463

Query: 158 ---------NEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN 310
                    N   G +P ++ NL+ +L+ L ++ NN SG I   +    K T  +L    
Sbjct: 464 KLTKLLIDGNNLKGNIPPAIGNLN-NLVVLAMAQNNLSGQIPDTIGNLVKLTDLKL---- 518

Query: 311 NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM 490
              +G IP +L  C  L SL +  N L G+IP S   L  + ++ +  N L G+IP  L 
Sbjct: 519 ---SGNIPSSLGKCVALESLEMQSNLLVGSIPKSFEKLVGIWNMDISQNNLTGKIPDFLS 575

Query: 491 YVKTLETLILDFND 532
               L  L L FN+
Sbjct: 576 NFSLLYDLNLSFNN 589

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 48/132 (36%), Positives = 71/132 (53%), Gaps = 5/132 (3%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP  G+ + L  LA++ NN SG++P DT+  +  +K+ DL   + SG +P SL    A 
Sbjct: 479 IPPAIGNLNNLVVLAMAQNNLSGQIP-DTIGNL--VKLTDL---KLSGNIPSSLGKCVA- 531

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNT-----LQELYLQNNGFTGKIPPTLSNCSELVSLH 373
           L +L++ SN   G I       PK+      +  + +  N  TGKIP  LSN S L  L+
Sbjct: 532 LESLEMQSNLLVGSI-------PKSFEKLVGIWNMDISQNNLTGKIPDFLSNFSLLYDLN 584

Query: 374 LSFNYLSGTIPS 409
           LSFN   G +P+
Sbjct: 585 LSFNNFEGEVPA 596

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 36/89 (40%), Positives = 48/89 (53%), Gaps = 1/89 (1%)
 Frame = +2

Query: 266 CQNPK-NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 442
           C  P    +  + L + G +G I P ++N + L  L LS N  +G+IPS LG L +L +L
Sbjct: 70  CSTPSPRRVTAIDLASEGISGSISPCIANLTSLTMLQLSNNSFNGSIPSVLGLLGQLNNL 129

Query: 443 KLWLNMLEGEIPQELMYVKTLETLILDFN 529
            L +N LEG IP EL     LE L L  N
Sbjct: 130 NLSMNSLEGNIPSELSSCSQLEILDLSNN 158

[175][TOP]
>UniRef100_Q652D9 Putative Receptor-like protein kinase n=1 Tax=Oryza sativa Japonica
           Group RepID=Q652D9_ORYSJ
          Length = 1115

 Score =  107 bits (267), Expect = 5e-22
 Identities = 68/173 (39%), Positives = 95/173 (54%)
 Frame = +2

Query: 17  LELPLPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN 196
           L+ PLPP  G C+ L  L L+    SG LP DT+ ++  ++ + +     SG +P S+ N
Sbjct: 217 LKGPLPPEIGGCANLTMLGLAETGMSGSLP-DTIGQLSRIQTIAIYTTLLSGRIPASIGN 275

Query: 197 LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL 376
            +  L +L L  N+ SGPI P L +  K  LQ L L  N   G IPP L  C +L  + L
Sbjct: 276 CT-ELTSLYLYQNSLSGPIPPQLGRLAK--LQTLLLWQNQLVGAIPPELGRCRQLTLIDL 332

Query: 377 SFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           S N L+G+IP++LG L  L+ L+L  N L G IP EL    +L  + +D N L
Sbjct: 333 SLNSLTGSIPATLGDLPNLQQLQLSTNQLTGAIPPELSNCTSLTDVEVDNNQL 385

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 65/191 (34%), Positives = 92/191 (48%), Gaps = 22/191 (11%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP     S LESL+L+SN+  G +P D +  +  L  L L  NE SG +P S+ NL   
Sbjct: 148 IPPELCRLSKLESLSLNSNSLRGAIP-DDIGNLTALAYLTLYDNELSGAIPASIGNLKRL 206

Query: 209 LLTLDLSSNNFSGPILPNL--CQN--------------------PKNTLQELYLQNNGFT 322
            +     +    GP+ P +  C N                      + +Q + +     +
Sbjct: 207 QVLRAGGNQGLKGPLPPEIGGCANLTMLGLAETGMSGSLPDTIGQLSRIQTIAIYTTLLS 266

Query: 323 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 502
           G+IP ++ NC+EL SL+L  N LSG IP  LG L+KL+ L LW N L G IP EL   + 
Sbjct: 267 GRIPASIGNCTELTSLYLYQNSLSGPIPPQLGRLAKLQTLLLWQNQLVGAIPPELGRCRQ 326

Query: 503 LETLILDFNDL 535
           L  + L  N L
Sbjct: 327 LTLIDLSLNSL 337

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 69/203 (33%), Positives = 94/203 (46%), Gaps = 26/203 (12%)
 Frame = +2

Query: 5    LFLSLEL--PLPPFFGSCSLLESLALSSNNFSGELPMD---------------------- 112
            L +S EL  P+PP  G C  L  L LS N  SG +P +                      
Sbjct: 451  LLISNELSGPIPPEIGGCGNLYRLRLSVNRLSGTIPAEIGGLKSLNFLDISDNHLVGAVP 510

Query: 113  -TLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTL 289
              +     L+ LDL  N  SG LPE+L     SL  +D+S N  +G +  ++   P+  L
Sbjct: 511  SAISGCSSLEFLDLHSNALSGSLPETLPR---SLQLIDVSDNQLAGALSSSIGLMPE--L 565

Query: 290  QELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLR-DLKLWLNMLE 466
             +LYL  N   G IPP + +C +L  L L  N  SG IP  +G+L  L   L L  N L 
Sbjct: 566  TKLYLGKNRLAGGIPPEIGSCQKLQLLDLGDNAFSGVIPPEIGTLPSLEISLNLSCNRLS 625

Query: 467  GEIPQELMYVKTLETLILDFNDL 535
            GEIP +   ++ L +L L  N+L
Sbjct: 626  GEIPSQFAGLEKLGSLDLSHNEL 648

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 59/169 (34%), Positives = 83/169 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P   G+C+ L SL L  N+ SG +P   L ++  L+ L L  N+  G +P  L      
Sbjct: 269 IPASIGNCTELTSLYLYQNSLSGPIPPQ-LGRLAKLQTLLLWQNQLVGAIPPELGRCR-Q 326

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS N+ +G I   L   P   LQ+L L  N  TG IPP LSNC+ L  + +  N 
Sbjct: 327 LTLIDLSLNSLTGSIPATLGDLPN--LQQLQLSTNQLTGAIPPELSNCTSLTDVEVDNNQ 384

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           L+G I      L  L     W N L G +P  L    +L+ + L +N+L
Sbjct: 385 LTGAIAVDFPRLRNLTLFYAWRNRLTGGVPASLAECPSLQAVDLSYNNL 433

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 68/170 (40%), Positives = 89/170 (52%), Gaps = 3/170 (1%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +P     CS LE L L SN  SG LP +TL   R L+++D+S N+ +G L  S+  L   
Sbjct: 509 VPSAISGCSSLEFLDLHSNALSGSLP-ETL--PRSLQLIDVSDNQLAGALSSSI-GLMPE 564

Query: 209 LLTLDLSSNNFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL-VSLHLS 379
           L  L L  N  +G I P +  CQ     LQ L L +N F+G IPP +     L +SL+LS
Sbjct: 565 LTKLYLGKNRLAGGIPPEIGSCQK----LQLLDLGDNAFSGVIPPEIGTLPSLEISLNLS 620

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 529
            N LSG IPS    L KL  L L  N L G +   L  ++ L TL + +N
Sbjct: 621 CNRLSGEIPSQFAGLEKLGSLDLSHNELSGGL-DSLAALQNLVTLNISYN 669

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 58/169 (34%), Positives = 84/169 (49%)
 Frame = +2

Query: 29  LPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS 208
           +PP   +C+ L  + + +N  +G + +D   ++R L +     N  +G +P SL     S
Sbjct: 365 IPPELSNCTSLTDVEVDNNQLTGAIAVD-FPRLRNLTLFYAWRNRLTGGVPASLAECP-S 422

Query: 209 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 388
           L  +DLS NN +G I   L       L +L L +N  +G IPP +  C  L  L LS N 
Sbjct: 423 LQAVDLSYNNLTGVIPKQLFA--LQNLTKLLLISNELSGPIPPEIGGCGNLYRLRLSVNR 480

Query: 389 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
           LSGTIP+ +G L  L  L +  N L G +P  +    +LE L L  N L
Sbjct: 481 LSGTIPAEIGGLKSLNFLDISDNHLVGAVPSAISGCSSLEFLDLHSNAL 529

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 38/112 (33%), Positives = 56/112 (50%)
 Frame = +2

Query: 200 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 379
           +  ++ + ++S +  GP+          +L+ L L     TG+IPP L    EL +L +S
Sbjct: 81  TGDVVGVTVTSVDLQGPLPAASLLPLARSLRTLVLSGTNLTGEIPPELGEYGELATLDVS 140

Query: 380 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 535
            N L+G IP  L  LSKL  L L  N L G IP ++  +  L  L L  N+L
Sbjct: 141 KNQLTGAIPPELCRLSKLESLSLNSNSLRGAIPDDIGNLTALAYLTLYDNEL 192

[176][TOP]
>UniRef100_Q2L3C7 Clavata-like kinase n=1 Tax=Brachypodium sylvaticum
           RepID=Q2L3C7_BRASY
          Le