AV441219 ( APZ34d07_f )

[UP]


[1][TOP]
>UniRef100_UPI00017390C5 EDA25 (embryo sac development arrest 25) n=1 Tax=Arabidopsis thaliana
            RepID=UPI00017390C5
          Length = 1043

 Score =  328 bits (840), Expect = 3e-88
 Identities = 160/160 (100%), Positives = 160/160 (100%)
 Frame = -1

Query: 643  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
            GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV
Sbjct: 884  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 943

Query: 463  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
            ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA
Sbjct: 944  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 1003

Query: 283  SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
            SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE
Sbjct: 1004 SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 1043

[2][TOP]
>UniRef100_Q9C9E2 Putative uncharacterized protein T10D10.9 n=1 Tax=Arabidopsis
            thaliana RepID=Q9C9E2_ARATH
          Length = 1056

 Score =  328 bits (840), Expect = 3e-88
 Identities = 160/160 (100%), Positives = 160/160 (100%)
 Frame = -1

Query: 643  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
            GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV
Sbjct: 897  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 956

Query: 463  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
            ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA
Sbjct: 957  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 1016

Query: 283  SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
            SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE
Sbjct: 1017 SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 1056

[3][TOP]
>UniRef100_B3TIK7 Slow walker 2 n=1 Tax=Arabidopsis thaliana RepID=B3TIK7_ARATH
          Length = 1043

 Score =  328 bits (840), Expect = 3e-88
 Identities = 160/160 (100%), Positives = 160/160 (100%)
 Frame = -1

Query: 643  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
            GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV
Sbjct: 884  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 943

Query: 463  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
            ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA
Sbjct: 944  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 1003

Query: 283  SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
            SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE
Sbjct: 1004 SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 1043

[4][TOP]
>UniRef100_UPI0001983EE8 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI0001983EE8
          Length = 1000

 Score =  140 bits (352), Expect = 1e-31
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 10/169 (5%)
 Frame = -1

Query: 643  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
            G  G + D  VE + GDESDNEEIENMLD  D +   E   +YDYDDLD VAG+DD++LV
Sbjct: 835  GSNGSD-DEQVEVDGGDESDNEEIENMLDTADPSL--ESNSDYDYDDLDQVAGDDDDDLV 891

Query: 463  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSD----GDDGRSKKKKKEKRKR- 299
             +VSDAEMD   DM   +D++D  V +D  G+  +DD D     DDG     KK K+++ 
Sbjct: 892  GNVSDAEMDIPPDMAEGEDDEDL-VGNDNNGENSEDDIDFGDASDDGNQLNSKKRKQRKS 950

Query: 298  -----KSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKAS 167
                 KSPFASLE+Y+HL++++   D K K +  S   K K +KK K++
Sbjct: 951  GGKTGKSPFASLEDYEHLLNEETPADKKPKSRKRSTEKKSKSRKKRKST 999

[5][TOP]
>UniRef100_A7P6D3 Chromosome chr9 scaffold_7, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7P6D3_VITVI
          Length = 991

 Score =  140 bits (352), Expect = 1e-31
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 10/169 (5%)
 Frame = -1

Query: 643  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
            G  G + D  VE + GDESDNEEIENMLD  D +   E   +YDYDDLD VAG+DD++LV
Sbjct: 826  GSNGSD-DEQVEVDGGDESDNEEIENMLDTADPSL--ESNSDYDYDDLDQVAGDDDDDLV 882

Query: 463  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSD----GDDGRSKKKKKEKRKR- 299
             +VSDAEMD   DM   +D++D  V +D  G+  +DD D     DDG     KK K+++ 
Sbjct: 883  GNVSDAEMDIPPDMAEGEDDEDL-VGNDNNGENSEDDIDFGDASDDGNQLNSKKRKQRKS 941

Query: 298  -----KSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKAS 167
                 KSPFASLE+Y+HL++++   D K K +  S   K K +KK K++
Sbjct: 942  GGKTGKSPFASLEDYEHLLNEETPADKKPKSRKRSTEKKSKSRKKRKST 990

[6][TOP]
>UniRef100_B9T1L2 Putative uncharacterized protein n=1 Tax=Ricinus communis
            RepID=B9T1L2_RICCO
          Length = 1033

 Score =  124 bits (311), Expect = 7e-27
 Identities = 67/148 (45%), Positives = 87/148 (58%), Gaps = 7/148 (4%)
 Frame = -1

Query: 604  EAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAEMDTDMD 425
            +  DESDNEEIEN+LD    N   E  GEYDYDDLD VA EDD++L+ DVSD EMD   D
Sbjct: 888  DGADESDNEEIENLLDSA--NLSLEADGEYDYDDLDQVANEDDDDLIGDVSDVEMDLPSD 945

Query: 424  MDLI-------DDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEEYK 266
            M          D  DD    D G  D G +D DG D R +K+K   +   SPFA+LE+Y+
Sbjct: 946  MGEAFDGIADGDKSDDVEAIDIGDADDGSNDEDGYDNRKRKRKSGGKVGASPFANLEDYE 1005

Query: 265  HLIDQDEKEDSKTKRKATSEPTKKKKKK 182
            HL+++D   + K+ +K   +  KK K +
Sbjct: 1006 HLLNEDSPTEKKSLKKRKPKSGKKWKSE 1033

[7][TOP]
>UniRef100_B9N7H1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N7H1_POPTR
          Length = 986

 Score =  118 bits (295), Expect = 5e-25
 Identities = 70/157 (44%), Positives = 94/157 (59%), Gaps = 2/157 (1%)
 Frame = -1

Query: 643  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
            GDG ++ D D +    DESDNEEI+++LD    N       EYDYDDLD V  EDD++LV
Sbjct: 835  GDGDDD-DGDDDVVGDDESDNEEIDDLLDST--NLSHGAENEYDYDDLDQVVNEDDDDLV 891

Query: 463  ADVS-DAEMDTD-MDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSP 290
             D   DA  DT+  D D I D D++ VD     DG D+D  G D R +K+K   +   SP
Sbjct: 892  DDAEVDALTDTEGEDFDTIVDSDNDAVDVGDADDGTDED--GLDQRKRKRKSRGKAGASP 949

Query: 289  FASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKK 179
            FASLEEY+H++++D     K++RK  S+  KK+K  K
Sbjct: 950  FASLEEYEHVLNEDNATKKKSERKKKSKSLKKRKSSK 986

[8][TOP]
>UniRef100_A5BUU5 Putative uncharacterized protein n=1 Tax=Vitis vinifera
            RepID=A5BUU5_VITVI
          Length = 968

 Score =  118 bits (295), Expect = 5e-25
 Identities = 72/166 (43%), Positives = 96/166 (57%), Gaps = 7/166 (4%)
 Frame = -1

Query: 643  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVA----GEDD 476
            G  G + D +VE + GDESDNEEIENMLD  D +   E   +YDYDDLD VA    GEDD
Sbjct: 822  GSNGSD-DEEVEVDGGDESDNEEIENMLDTADPSL--ESNSDYDYDDLDQVADMAEGEDD 878

Query: 475  EELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEK---R 305
            E+LV +               D+  +N+ DD   GD  DDD  G+   SKK+K+ K   +
Sbjct: 879  EDLVGN---------------DNNGENSEDDIDFGDASDDD--GNQLNSKKRKQRKSGGK 921

Query: 304  KRKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKAS 167
              KSPFASLE+Y+HL++++   D K K +  S   K K +KK K++
Sbjct: 922  TGKSPFASLEDYEHLLNEETPADKKPKSRKRSTEKKSKSRKKRKST 967

[9][TOP]
>UniRef100_Q8MP30 Uncharacterized histidine-rich protein DDB0167791 n=1
           Tax=Dictyostelium discoideum RepID=Y7791_DICDI
          Length = 233

 Score = 97.4 bits (241), Expect = 9e-19
 Identities = 40/101 (39%), Positives = 46/101 (45%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HHHHH+HHHHHH +HHH   +H HH            H  H P   HHP    H  HH H
Sbjct: 72  HHHHHHHHHHHHHHHHHHHHHHHHHPH----------HPHHHPHHHHHPHHHHHHHHHHH 121

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H      H+H HH  +    H H HH     HH+    HH
Sbjct: 122 HH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHPHH 157

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 38/99 (38%), Positives = 49/99 (49%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH 507
           ++ HHHHH+HHHHHH +HHH   +H HH   P        H    P    HP   LH + 
Sbjct: 124 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHP--------HHHPHPHPHPHPHPHLHPNP 175

Query: 508 HSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYR 624
           H H H    P  +  HHP  + +PH H H  P   HH++
Sbjct: 176 HPHPHPHPHPHPHPHHHP--NPNPHPHPHPHPHHHHHHQ 212

 Score = 86.7 bits (213), Expect = 2e-15
 Identities = 36/97 (37%), Positives = 43/97 (44%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH 507
           ++ HHHHH+HHHHHH +H H   +H HH   P        H  H     HH     H  H
Sbjct: 79  HHHHHHHHHHHHHHHHHHPHHPHHHPHHHHHP-------HHHHHHHHHHHHHHHHHHHHH 131

Query: 508 HSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHH 618
           H H H      H+H HH  +   PH H H  P    H
Sbjct: 132 HHHHHHHHHHHHHHHHHHHHHHHPHHHPHPHPHPHPH 168

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 40/108 (37%), Positives = 50/108 (46%), Gaps = 4/108 (3%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH 507
           ++ HHHHH+HHHHHH +HHH   +H HH            H  H     HHP    H   
Sbjct: 108 HHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHPHHHPHPHPHPHP 167

Query: 508 HSHIH-RPLLPQHYHQH---HPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           H H+H  P    H H H   HP +  +P+ H H  P   HH+    HH
Sbjct: 168 HPHLHPNPHPHPHPHPHPHPHPHHHPNPNPHPHPHPHPHHHH----HH 211

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 39/104 (37%), Positives = 43/104 (41%), Gaps = 7/104 (6%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH 507
           ++ HHHHH HHHHHH +HHH   +H HH            H  H     HH     H  H
Sbjct: 102 HHPHHHHHPHHHHHHHHHHHHHHHHHHHH-----------HHHHHHHHHHHHHH--HHHH 148

Query: 508 HSHIHRPLLPQHYHQH-------HPAYSQSPHCHSHHQPRIQHH 618
           H H H P    H H H       HP     PH H H  P   HH
Sbjct: 149 HHHHHHPHHHPHPHPHPHPHPHLHPNPHPHPHPHPHPHPHPHHH 192

 Score = 77.8 bits (190), Expect = 7e-13
 Identities = 37/103 (35%), Positives = 42/103 (40%), Gaps = 2/103 (1%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HH HH HHHHHH +HHH   +H HH                     HH        HH H
Sbjct: 65  HHPHHLHHHHHHHHHHHH--HHHHH---------------------HH--------HHHH 93

Query: 517 IHRPLLPQH--YHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H P  P H  +H HHP +    H H HH     HH+    HH
Sbjct: 94  HHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHH 136

[10][TOP]
>UniRef100_A4HXX6 Hypothetical repeat protein n=1 Tax=Leishmania infantum
           RepID=A4HXX6_LEIIN
          Length = 358

 Score = 94.0 bits (232), Expect = 1e-17
 Identities = 40/101 (39%), Positives = 49/101 (48%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HHHHH HHHHHH++HHH   +H HH            H  H  R  HH  R  H  H  H
Sbjct: 185 HHHHHRHHHHHHRHHHHHHRHHHHHHR----------HHHHHHRHHHHHHRHHHHHHRHH 234

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H      H+H+HH  +    H H HH+   +HH+R   HH
Sbjct: 235 HHHHRHHHHHHRHH--HHHHRHHHHHHRHHHRHHHRHHRHH 273

 Score = 92.0 bits (227), Expect = 4e-17
 Identities = 40/101 (39%), Positives = 47/101 (46%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HHHHH HHHHHH++HHH   +H HH            H  H  R  HH  R  H  H  H
Sbjct: 122 HHHHHRHHHHHHRHHHHHHRHHHHHHR----------HHHHHHRHHHHHHRHHHHHHRHH 171

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H      H+H+HH  +    H H HH  R  HH+    HH
Sbjct: 172 HHHHRHHHHHHRHHHHH----HRHHHHHHRHHHHHHRHHHH 208

 Score = 92.0 bits (227), Expect = 4e-17
 Identities = 40/101 (39%), Positives = 47/101 (46%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HHHHH HHHHHH++HHH   +H HH            H  H  R  HH  R  H  H  H
Sbjct: 157 HHHHHRHHHHHHRHHHHHHRHHHHHHR----------HHHHHHRHHHHHHRHHHHHHRHH 206

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H      H+H+HH  +    H H HH  R  HH+    HH
Sbjct: 207 HHHHRHHHHHHRHHHHH----HRHHHHHHRHHHHHHRHHHH 243

 Score = 91.7 bits (226), Expect = 5e-17
 Identities = 38/101 (37%), Positives = 46/101 (45%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HHHHH HHHHHH++HHH   +H HH            HR H     HH     H  HH H
Sbjct: 234 HHHHHRHHHHHHRHHHHHHRHHHHHHRHH--------HRHHHRHHRHHHHHHRHHHHHHH 285

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H     +H+  HH  +      H HH    +HH+R   HH
Sbjct: 286 HHHRHHHRHHRHHHRHHRHHHRHHRHHHHHHRHHHRHHRHH 326

 Score = 91.3 bits (225), Expect = 6e-17
 Identities = 38/103 (36%), Positives = 48/103 (46%)
 Frame = +1

Query: 331 YDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHH 510
           + HHHH +HHHHH  +HHH R +H HH+           H  H  R  HH  R  H  H 
Sbjct: 191 HHHHHHRHHHHHHRHHHHHHRHHHHHHR-----------HHHHHHRHHHHHHRHHHHHHR 239

Query: 511 SHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H H      H+H+HH  + +  H H H   R  HH+    HH
Sbjct: 240 HHHHHHRHHHHHHRHHHHHHRHHHRHHHRHHRHHHHHHRHHHH 282

 Score = 90.9 bits (224), Expect = 8e-17
 Identities = 39/102 (38%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HHHHH HHHHHH++HHH   +H HH            H  H  R  HH  R  H  H  H
Sbjct: 136 HHHHHRHHHHHHRHHHHHHRHHHHHHR----------HHHHHHRHHHHHHRHHHHHHRHH 185

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHS-HHQPRIQHHYRSFLHH 639
            H      H+H+HH  + +  H H  HH    +HH+    HH
Sbjct: 186 HHHHRHHHHHHRHHHHHHRHHHHHHRHHHHHHRHHHHHHRHH 227

 Score = 90.9 bits (224), Expect = 8e-17
 Identities = 39/102 (38%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HHHHH HHHHHH++HHH   +H HH            H  H  R  HH  R  H  H  H
Sbjct: 143 HHHHHRHHHHHHRHHHHHHRHHHHHHR----------HHHHHHRHHHHHHRHHHHHHRHH 192

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHS-HHQPRIQHHYRSFLHH 639
            H      H+H+HH  + +  H H  HH    +HH+    HH
Sbjct: 193 HHHHRHHHHHHRHHHHHHRHHHHHHRHHHHHHRHHHHHHRHH 234

 Score = 90.9 bits (224), Expect = 8e-17
 Identities = 39/102 (38%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HHHHH HHHHHH++HHH   +H HH            H  H  R  HH  R  H  H  H
Sbjct: 150 HHHHHRHHHHHHRHHHHHHRHHHHHHR----------HHHHHHRHHHHHHRHHHHHHRHH 199

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHS-HHQPRIQHHYRSFLHH 639
            H      H+H+HH  + +  H H  HH    +HH+    HH
Sbjct: 200 HHHHRHHHHHHRHHHHHHRHHHHHHRHHHHHHRHHHHHHRHH 241

 Score = 89.7 bits (221), Expect = 2e-16
 Identities = 39/103 (37%), Positives = 48/103 (46%)
 Frame = +1

Query: 331 YDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHH 510
           + HHHH +HHHHH  +HHH R +H HH+           H  H  R  HH  R  H  H 
Sbjct: 128 HHHHHHRHHHHHHRHHHHHHRHHHHHHR-----------HHHHHHRHHHHHHRHHHHHHR 176

Query: 511 SHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H H      H+H+HH  +    H H HH  R  HH+    HH
Sbjct: 177 HHHHHHRHHHHHHRHHHHH----HRHHHHHHRHHHHHHRHHHH 215

 Score = 89.7 bits (221), Expect = 2e-16
 Identities = 40/105 (38%), Positives = 50/105 (47%), Gaps = 1/105 (0%)
 Frame = +1

Query: 328 YYDHHHHHY-HHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLD 504
           ++ HHHHH+ HHHHHH++HHH   +H HH            H  H  R  HH  R  H  
Sbjct: 132 HHRHHHHHHRHHHHHHRHHHHHHRHHHHHHR----------HHHHHHRHHHHHHRHHHHH 181

Query: 505 HHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           H  H H      H+H+HH  +    H H HH  R  HH+    HH
Sbjct: 182 HRHHHHHHRHHHHHHRHHHHH----HRHHHHHHRHHHHHHRHHHH 222

 Score = 89.0 bits (219), Expect = 3e-16
 Identities = 39/101 (38%), Positives = 46/101 (45%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HH HH HHHHHH++HHH   +H HH            H  H  R  HH  R  H  H  H
Sbjct: 115 HHRHHRHHHHHHRHHHHHHRHHHHHHR----------HHHHHHRHHHHHHRHHHHHHRHH 164

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H      H+H+HH  +    H H HH  R  HH+    HH
Sbjct: 165 HHHHRHHHHHHRHHHHH----HRHHHHHHRHHHHHHRHHHH 201

 Score = 88.6 bits (218), Expect = 4e-16
 Identities = 41/107 (38%), Positives = 53/107 (49%), Gaps = 3/107 (2%)
 Frame = +1

Query: 328 YYDHHHHHY-HHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLD 504
           ++ HHHHH+ HHHHHH++HHH   +H HH            H  H  R  HH  R  H  
Sbjct: 202 HHRHHHHHHRHHHHHHRHHHHHHRHHHHHHR----------HHHHHHRHHHHHHRHHHHH 251

Query: 505 H-HSHIHRPLLPQHYHQHH-PAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           H H H H     +H+H+HH   +    H H HH    +HH+R   HH
Sbjct: 252 HRHHHHHHRHHHRHHHRHHRHHHHHHRHHHHHHHHHHRHHHRHHRHH 298

 Score = 87.4 bits (215), Expect = 9e-16
 Identities = 38/103 (36%), Positives = 48/103 (46%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH 507
           ++ HHH H+HHHH H +HHH R +H HH+           H  H  R  HH  R  H  H
Sbjct: 198 HHHHHHRHHHHHHRH-HHHHHRHHHHHHR-----------HHHHHHRHHHHHHRHHHHHH 245

Query: 508 HSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLH 636
             H H      H+H+HH  +    H H HH  R  HH+    H
Sbjct: 246 RHHHHHHRHHHHHHRHHHRHHHRHHRHHHHHHRHHHHHHHHHH 288

 Score = 84.3 bits (207), Expect = 8e-15
 Identities = 38/104 (36%), Positives = 51/104 (49%), Gaps = 5/104 (4%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHH-----HQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHL 501
           HHHHH HHHHHH++HH     H R +H HH+           H  H     HH     H 
Sbjct: 248 HHHHHRHHHHHHRHHHRHHHRHHRHHHHHHRHHH--------HHHHHHHRHHHRHHRHHH 299

Query: 502 DHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFL 633
            HH H HR    +H+H HH  + +    H HH+ R +HH + ++
Sbjct: 300 RHHRHHHRH--HRHHHHHHRHHHRHHRHHHHHRHRHRHHKQRYI 341

 Score = 80.9 bits (198), Expect = 9e-14
 Identities = 37/92 (40%), Positives = 47/92 (51%)
 Frame = +1

Query: 331 YDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHH 510
           +  HHHH+H HHHH +HHH R +H HH+           HR H+    HH R   H  HH
Sbjct: 269 HHRHHHHHHRHHHHHHHHHHRHHHRHHRHH---------HRHHR----HHHR---HHRHH 312

Query: 511 SHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPR 606
            H HR     H+H+HH  +    H H HH+ R
Sbjct: 313 HHHHR-----HHHRHHRHHHHHRHRHRHHKQR 339

 Score = 74.3 bits (181), Expect = 8e-12
 Identities = 34/96 (35%), Positives = 42/96 (43%)
 Frame = +1

Query: 352 YHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSHIHRPL 531
           +HH HH  +HHH R +H HH+           H  H  R  HH  R  H  H  H H   
Sbjct: 114 FHHRHHRHHHHHHRHHHHHHR-----------HHHHHHRHHHHHHRHHHHHHRHHHHHHR 162

Query: 532 LPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
              H+H+HH  +    H H HH  R  HH+    HH
Sbjct: 163 HHHHHHRHHHHH----HRHHHHHHRHHHHHHRHHHH 194

[11][TOP]
>UniRef100_B6AJ94 Putative uncharacterized protein (Fragment) n=1 Tax=Cryptosporidium
           muris RN66 RepID=B6AJ94_9CRYT
          Length = 614

 Score = 91.3 bits (225), Expect = 6e-17
 Identities = 38/107 (35%), Positives = 48/107 (44%)
 Frame = +1

Query: 319 FSSYYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLH 498
           +  ++ HHHHHY  HHHH +HH+Q  +H HH            H  H  +  HH     +
Sbjct: 291 YQDHHHHHHHHYQDHHHHHHHHYQDHHHHHHHH----YQDHHHHHHHHYQDHHHHHHHHY 346

Query: 499 LDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            DHH H H      H+H HH       H H H+Q    HHY    HH
Sbjct: 347 QDHHHHHHHHYQDHHHHHHHHYQDHHHHHHHHYQDHHHHHYHHHHHH 393

 Score = 89.7 bits (221), Expect = 2e-16
 Identities = 41/111 (36%), Positives = 51/111 (45%), Gaps = 6/111 (5%)
 Frame = +1

Query: 328 YYDHHHHHYHH---HHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLH 498
           Y DHHHHH+HH   HHHH +HH+Q  +H HH            H  H  +  HH     +
Sbjct: 302 YQDHHHHHHHHYQDHHHHHHHHYQDHHHHHHHHYQDH----HHHHHHHYQDHHHHHHHHY 357

Query: 499 LDHHSHIHRPLLPQHYHQHH---PAYSQSPHCHSHHQPRIQHHYRSFLHHL 642
            DHH H H      H+H HH     +    H H HH     HHY+   HH+
Sbjct: 358 QDHHHHHHHHYQDHHHHHHHHYQDHHHHHYHHHHHHHHHHHHHYQGHHHHI 408

 Score = 81.3 bits (199), Expect = 7e-14
 Identities = 37/103 (35%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 328 YYDHHHHHYHH---HHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLH 498
           Y DHHHHH+HH   HHHH +HH+Q  +H HH            H  H     HH     H
Sbjct: 313 YQDHHHHHHHHYQDHHHHHHHHYQDHHHHHHHHYQ-----DHHHHHHHHYQDHHHHHHHH 367

Query: 499 LDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRS 627
              H H H      H+H H+  +    H H HH     HH  S
Sbjct: 368 YQDHHHHHHHHYQDHHHHHYHHHHHHHHHHHHHYQGHHHHITS 410

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 41/122 (33%), Positives = 53/122 (43%), Gaps = 3/122 (2%)
 Frame = +1

Query: 283 SQMEISVFFS-LSFSSYYDHHHHHY--HHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHR 453
           SQ + +V F  L  +   DHHHH +  HHHHH+Q HHH    H HH            ++
Sbjct: 249 SQTDPTVLFKKLEPTKRVDHHHHRHQDHHHHHYQDHHH----HHHH------------YQ 292

Query: 454 SHQPRALHHPRRLLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFL 633
            H     HH     + DHH H H      H+H HH       H H H+Q    HH+  + 
Sbjct: 293 DHHHHHHHH-----YQDHHHHHHHHYQDHHHHHHHHYQDHHHHHHHHYQDHHHHHHHHYQ 347

Query: 634 HH 639
            H
Sbjct: 348 DH 349

 Score = 56.6 bits (135), Expect(2) = 1e-10
 Identities = 17/31 (54%), Positives = 21/31 (67%)
 Frame = +1

Query: 319 FSSYYDHHHHHYHHHHHHQYHHHQRCYHLHH 411
           +  ++ HHHHHY  HHHH YHHH   +H HH
Sbjct: 368 YQDHHHHHHHHYQDHHHHHYHHHHHHHHHHH 398

 Score = 33.9 bits (76), Expect(2) = 1e-10
 Identities = 27/58 (46%), Positives = 31/58 (53%)
 Frame = +3

Query: 450 SLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SL   +SSSSSS   PS SS S   PSSS+ L   SSS+   SS  L  P    +S S
Sbjct: 410 SLPGPSSSSSSSLPGPSSSSSSLPGPSSSS-LPGPSSSLPGPSSSPLPGPLPGPSSTS 466

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 32/87 (36%), Positives = 39/87 (44%), Gaps = 3/87 (3%)
 Frame = +1

Query: 328 YYDHHHHHYHH---HHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLH 498
           Y DHHHHH+HH   HHHH +HH+Q  +H HH            ++ H     HH     H
Sbjct: 346 YQDHHHHHHHHYQDHHHHHHHHYQDHHHHHHHH----------YQDHHHHHYHHH----H 391

Query: 499 LDHHSHIHRPLLPQHYHQHHPAYSQSP 579
             HH H H      HY  HH   +  P
Sbjct: 392 HHHHHHHH------HYQGHHHHITSLP 412

[12][TOP]
>UniRef100_P04929 Histidine-rich glycoprotein n=1 Tax=Plasmodium lophurae
           RepID=HRPX_PLALO
          Length = 351

 Score = 89.0 bits (219), Expect = 3e-16
 Identities = 40/111 (36%), Positives = 49/111 (44%), Gaps = 2/111 (1%)
 Frame = +1

Query: 313 LSFSSYYDHHHHHYHHH--HHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPR 486
           L +  ++  HHHH+HHH  HHH +HHH   +H HH   P        H  H   A HH  
Sbjct: 166 LGYHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAP-------HHHHHHHHAPHHHH 218

Query: 487 RLLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
              H  HH H H      H+H HH  +    H H HH     HH+    HH
Sbjct: 219 HHHHGHHHHHHHH---HGHHHHHHHHHGHHHHHHHHHDAHHHHHHHHDAHH 266

 Score = 87.8 bits (216), Expect = 7e-16
 Identities = 39/106 (36%), Positives = 47/106 (44%), Gaps = 2/106 (1%)
 Frame = +1

Query: 328 YYDHHHH--HYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHL 501
           ++ HHHH  H+HHHHHH +HHH   +H HH            H  H     HH     H 
Sbjct: 206 HHHHHHHAPHHHHHHHHGHHHHHHHHHGHH------------HHHHHHHGHHHHHHHHHD 253

Query: 502 DHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            HH H H      H+H HH A+    H H HH     HH+    HH
Sbjct: 254 AHHHHHHHHDAHHHHHHHHDAHH---HHHHHHDAHHHHHHHHDAHH 296

 Score = 86.7 bits (213), Expect = 2e-15
 Identities = 38/101 (37%), Positives = 44/101 (43%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HHHHH+H  HHH +HHH   +H HH  G         H  H     HH     H  HH H
Sbjct: 196 HHHHHHHAPHHHHHHHHAPHHHHHHHHG-------HHHHHHHHHGHHHHHHHHHGHHHHH 248

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H      H+H HH A+    H H HH     HH+    HH
Sbjct: 249 HHHHDAHHHHHHHHDAHH---HHHHHHDAHHHHHHHHDAHH 286

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 38/105 (36%), Positives = 46/105 (43%), Gaps = 3/105 (2%)
 Frame = +1

Query: 334 DHHHHH---YHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLD 504
           +HHHHH   +HHHHHH  HHH    H HH            H  H   A HH     H  
Sbjct: 92  EHHHHHPHPHHHHHHHPPHHHHHLGHHHHHHHAAHHHHHEEHHHHHHAAHHHHHEEHHHH 151

Query: 505 HHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           HH+  H P    H+  +H  ++   H H HH P   HH+    HH
Sbjct: 152 HHAAHHHPWFHHHHLGYHHHHAPHHHHHHHHAPHHHHHHHHAPHH 196

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 39/102 (38%), Positives = 45/102 (44%), Gaps = 2/102 (1%)
 Frame = +1

Query: 340 HHHHYHHH--HHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHS 513
           HHHH+HHH  HHH +HHH   +H HH   P        H  H     HH     H  HH 
Sbjct: 185 HHHHHHHHAPHHHHHHHHAPHHHHHHHHAP-------HHHHHHHHGHHHHHHHHHGHHHH 237

Query: 514 HIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           H H      H+H HH A+    H H HH     HH+    HH
Sbjct: 238 HHHHHGHHHHHHHHHDAHH---HHHHHHDAHHHHHHHHDAHH 276

 Score = 85.9 bits (211), Expect = 3e-15
 Identities = 39/104 (37%), Positives = 47/104 (45%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH 507
           ++ HHHH  HHHHH ++HHH    H HH            H  H   A HHP    H  H
Sbjct: 117 HHHHHHHAAHHHHHEEHHHHHHAAHHHHHEE---------HHHHHHAAHHHP--WFH-HH 164

Query: 508 HSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           H   H    P H+H HH  ++   H H HH P   HH+    HH
Sbjct: 165 HLGYHHHHAPHHHHHHH--HAPHHHHHHHHAPHHHHHHHHAPHH 206

 Score = 85.5 bits (210), Expect = 4e-15
 Identities = 40/106 (37%), Positives = 48/106 (45%), Gaps = 2/106 (1%)
 Frame = +1

Query: 328 YYDHHHHHYHHH--HHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHL 501
           ++ HHHHH+HHH  HHH +HHH   +H HH            H  H   A HH     H 
Sbjct: 241 HHGHHHHHHHHHDAHHHHHHHHDAHHHHHHHHD------AHHHHHHHHDAHHHHHH--HH 292

Query: 502 DHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           D H H H      H+H HH A+    H H HH     HH+    HH
Sbjct: 293 DAHHHHHHHHDAHHHHHHHDAHH---HHHHHHDAHHHHHHHHDAHH 335

 Score = 85.1 bits (209), Expect = 5e-15
 Identities = 39/106 (36%), Positives = 48/106 (45%), Gaps = 2/106 (1%)
 Frame = +1

Query: 328 YYDHHHHHYHHH--HHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHL 501
           ++D HHHH+HHH  HHH +HHH   +H HH          + H  H     HH     H 
Sbjct: 251 HHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHD-------AHHHHHHHHDAHHHHHHHHD 303

Query: 502 DHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            HH H H      H+H HH A+    H H HH     HH+    HH
Sbjct: 304 AHHHHHHHDA-HHHHHHHHDAHH---HHHHHHDAHHHHHHHHDAHH 345

 Score = 84.7 bits (208), Expect = 6e-15
 Identities = 37/106 (34%), Positives = 50/106 (47%)
 Frame = +1

Query: 322 SSYYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHL 501
           ++++ HH  H+HHHH   +HHH+  +H HH +   P         H   A HH     H 
Sbjct: 124 AAHHHHHEEHHHHHHAAHHHHHEEHHHHHHAAHHHPWFHHHHLGYHHHHAPHHHHHHHHA 183

Query: 502 DHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            HH H H    P H+H HH  ++   H H HH P   HH+    HH
Sbjct: 184 PHHHH-HHHHAPHHHHHHH--HAPHHHHHHHHAPHHHHHHHHGHHH 226

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 38/110 (34%), Positives = 46/110 (41%), Gaps = 4/110 (3%)
 Frame = +1

Query: 322 SSYYDHHHHHYHHHH--HHQ--YHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRR 489
           ++++ HH  H+HHHH  HH   +HHH   YH HH            H  H   A HH   
Sbjct: 139 AAHHHHHEEHHHHHHAAHHHPWFHHHHLGYHHHHAPH---------HHHHHHHAPHHHHH 189

Query: 490 LLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
             H  HH H H      H+H HH  +    H H HH     HH     HH
Sbjct: 190 HHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHGHHHHHHHHHGHHHHHH 239

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 38/105 (36%), Positives = 43/105 (40%), Gaps = 1/105 (0%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHH-HQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLD 504
           ++ HHH  YHHHH  H +HHH    H HH     P      H  H   A HH     H  
Sbjct: 160 WFHHHHLGYHHHHAPHHHHHHHHAPHHHHHHHHAP-----HHHHHHHHAPHHHHHHHHAP 214

Query: 505 HHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           HH H H      H+H HH  +    H H HH     HH     HH
Sbjct: 215 HHHHHHHHGHHHHHHHHHGHHHHHHHHHGHHHHHHHHHDAHHHHH 259

 Score = 82.4 bits (202), Expect = 3e-14
 Identities = 40/110 (36%), Positives = 46/110 (41%), Gaps = 8/110 (7%)
 Frame = +1

Query: 334 DHHHHHY---HH---HHHH--QYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRR 489
           +HHHHH+   HH   HHHH   +HHH   +H HH   P        H  H   A HH   
Sbjct: 147 EHHHHHHAAHHHPWFHHHHLGYHHHHAPHHHHHHHHAP-------HHHHHHHHAPHHHHH 199

Query: 490 LLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
             H  HH H H      H+H HH  +    H H HH     HH     HH
Sbjct: 200 HHHAPHHHHHHHHAPHHHHHHHHGHHHHHHHHHGHHHHHHHHHGHHHHHH 249

 Score = 81.3 bits (199), Expect = 7e-14
 Identities = 40/106 (37%), Positives = 48/106 (45%), Gaps = 2/106 (1%)
 Frame = +1

Query: 328 YYDHHHHHYHHH--HHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHL 501
           ++D HHHH+HHH  HHH +HHH   +H HH            H  H   A HH     H 
Sbjct: 261 HHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDA------HHHHHHHHDAHHHHHH--HD 312

Query: 502 DHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            HH H H      H+H HH A+    H H HH     HH+    HH
Sbjct: 313 AHHHHHHHHDAHHHHHHHHDAHH---HHHHHHDAHHHHHH----HH 351

 Score = 78.2 bits (191), Expect = 6e-13
 Identities = 41/118 (34%), Positives = 52/118 (44%), Gaps = 16/118 (13%)
 Frame = +1

Query: 334 DHHHHH-------YH--HHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPR 486
           +HHHHH       +H  HHHHH   HH+  +  HH   P P      H  H     HH  
Sbjct: 60  EHHHHHPEEHHEPHHEEHHHHHPEEHHEPHHEEHHHHHPHP------HHHHHHHPPHHHH 113

Query: 487 RLLHLDHHSH-IHRPLLPQHYHQHHPA---YSQSPHCH---SHHQPRIQHHYRSFLHH 639
            L H  HH H  H     +H+H HH A   + +  H H   +HH P   HH+  + HH
Sbjct: 114 HLGHHHHHHHAAHHHHHEEHHHHHHAAHHHHHEEHHHHHHAAHHHPWFHHHHLGYHHH 171

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 36/107 (33%), Positives = 43/107 (40%), Gaps = 4/107 (3%)
 Frame = +1

Query: 331 YDHHHHHYHHHHHHQYHH--HQRCYHLHHQSGPCPCLCPSLHRS--HQPRALHHPRRLLH 498
           +  H H  HHHHH + HH  H   +H HH         P  H    H+    HHP    H
Sbjct: 53  HPEHLHEEHHHHHPEEHHEPHHEEHHHHH---------PEEHHEPHHEEHHHHHPHPHHH 103

Query: 499 LDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
             HH   H   L  H+H HH A+      H HH     HH+    HH
Sbjct: 104 HHHHPPHHHHHLGHHHHHHHAAHHHHHEEHHHHHHAAHHHHHEEHHH 150

[13][TOP]
>UniRef100_Q6YU01 Os09g0116400 protein n=1 Tax=Oryza sativa Japonica Group
            RepID=Q6YU01_ORYSJ
          Length = 1004

 Score = 87.0 bits (214), Expect = 1e-15
 Identities = 60/174 (34%), Positives = 92/174 (52%), Gaps = 15/174 (8%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D GE +  DV+ +A DESD+E  E  +  ++D       GEYDYD+LD    E++ +L+ 
Sbjct: 840  DTGELFADDVD-DASDESDDEMQELGIGSIED-------GEYDYDNLDATTFEEEGDLLR 891

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDG-RSKKKKKEKRKRKSPFA 284
              SD E+  D+  D+    D +    +G      +DSDG++  + +K+K   +   SPFA
Sbjct: 892  YDSDVELH-DISDDISSGADSDTEALEGANHSDGNDSDGEEPVQGQKRKHGAKSGASPFA 950

Query: 283  SLEEYKHLIDQDEKE-------------DSKTKRKATSEPTKK-KKKKKSKASE 164
             LE+Y+HL+D + ++             DSK KRK  S   K   +KK+SK SE
Sbjct: 951  KLEDYEHLMDGEAEKPTFKKGRKHRVTRDSKEKRKGLSSKEKSGSRKKRSKRSE 1004

[14][TOP]
>UniRef100_A3BW38 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=A3BW38_ORYSJ
          Length = 1004

 Score = 87.0 bits (214), Expect = 1e-15
 Identities = 60/174 (34%), Positives = 92/174 (52%), Gaps = 15/174 (8%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D GE +  DV+ +A DESD+E  E  +  ++D       GEYDYD+LD    E++ +L+ 
Sbjct: 840  DTGELFADDVD-DASDESDDEMQELGIGSIED-------GEYDYDNLDATTFEEEGDLLR 891

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDG-RSKKKKKEKRKRKSPFA 284
              SD E+  D+  D+    D +    +G      +DSDG++  + +K+K   +   SPFA
Sbjct: 892  YDSDVELH-DISDDISSGADSDTEALEGANHSDGNDSDGEEPVQGQKRKHGAKSGASPFA 950

Query: 283  SLEEYKHLIDQDEKE-------------DSKTKRKATSEPTKK-KKKKKSKASE 164
             LE+Y+HL+D + ++             DSK KRK  S   K   +KK+SK SE
Sbjct: 951  KLEDYEHLMDGEAEKPTFKKGRKHRVTRDSKEKRKGLSSKEKSGSRKKRSKRSE 1004

[15][TOP]
>UniRef100_A2YYI1 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
            RepID=A2YYI1_ORYSI
          Length = 1005

 Score = 87.0 bits (214), Expect = 1e-15
 Identities = 60/174 (34%), Positives = 92/174 (52%), Gaps = 15/174 (8%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D GE +  DV+ +A DESD+E  E  +  ++D       GEYDYD+LD    E++ +L+ 
Sbjct: 841  DTGELFADDVD-DASDESDDEMQELGIGSIED-------GEYDYDNLDATTFEEEGDLLR 892

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDG-RSKKKKKEKRKRKSPFA 284
              SD E+  D+  D+    D +    +G      +DSDG++  + +K+K   +   SPFA
Sbjct: 893  YDSDVELH-DISDDISSGADSDTEALEGANHSDGNDSDGEEPVQGQKRKHGAKSGASPFA 951

Query: 283  SLEEYKHLIDQDEKE-------------DSKTKRKATSEPTKK-KKKKKSKASE 164
             LE+Y+HL+D + ++             DSK KRK  S   K   +KK+SK SE
Sbjct: 952  KLEDYEHLMDGEAEKPTFKKGRKHRVTRDSKEKRKGLSSKEKSGSRKKRSKRSE 1005

[16][TOP]
>UniRef100_Q26056 Histidine-rich protein (Fragment) n=1 Tax=Plasmodium lophurae
           RepID=Q26056_PLALO
          Length = 140

 Score = 85.1 bits (209), Expect = 5e-15
 Identities = 39/100 (39%), Positives = 45/100 (45%)
 Frame = +1

Query: 340 HHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSHI 519
           HHHH+H  HHH +HHH   +H HH   P        H  H   A HH     H  HH H 
Sbjct: 1   HHHHHHAPHHHHHHHHAPHHHHHHHHAP-------HHHHHHHHAPHHHHHHHHAPHHHH- 52

Query: 520 HRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           H P    H+H HHP +      H HH P   HH+    HH
Sbjct: 53  HHPWF--HHHHHHPWFH-----HHHHHPWFHHHHHHDAHH 85

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 39/109 (35%), Positives = 46/109 (42%), Gaps = 8/109 (7%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH--- 507
           HHHHH+H  HHH +HHH   +H HH   P        H  H P   HH     H  H   
Sbjct: 10  HHHHHHHAPHHHHHHHHAPHHHHHHHHAP----HHHHHHHHAPHHHHHHPWFHHHHHHPW 65

Query: 508 -HSHIHRPLLPQHY----HQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H H H P    H+    H HH  +  + H H HH     HH+    HH
Sbjct: 66  FHHHHHHPWFHHHHHHDAHHHHHHHHDAHHHHHHHDAHHHHHHHHDAHH 114

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 41/108 (37%), Positives = 48/108 (44%), Gaps = 5/108 (4%)
 Frame = +1

Query: 331 YDHHHHHY--HHHHHH---QYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLL 495
           + HHHHH+  HHHHHH    +HHH   +H HH         P  H  H   A HH     
Sbjct: 39  HHHHHHHHAPHHHHHHPWFHHHHHHPWFHHHHHH-------PWFHHHHHHDAHHHHHH-- 89

Query: 496 HLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           H D H H H      H+H HH A+    H H HH     HH+    HH
Sbjct: 90  HHDAHHHHHHHDAHHHHHHHHDAHH---HHHHHHDAHHHHHHHHDAHH 134

 Score = 80.9 bits (198), Expect = 9e-14
 Identities = 40/111 (36%), Positives = 47/111 (42%), Gaps = 7/111 (6%)
 Frame = +1

Query: 328 YYDHHHH--HYHHHHHHQYHHHQRCYHLHHQSGPCPCL-----CPSLHRSHQPRALHHPR 486
           ++ HHHH  H+HHHHHH  HHH   +H  H     P        P  H  H     HH  
Sbjct: 20  HHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHPWFHHHHHHPWFHHHHHHPWFHHHH 79

Query: 487 RLLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
              H D H H H      H+H HH A+    H H HH     HH+    HH
Sbjct: 80  ---HHDAHHHHHHHHDAHHHHHHHDAHH---HHHHHHDAHHHHHHHHDAHH 124

 Score = 77.4 bits (189), Expect = 1e-12
 Identities = 38/106 (35%), Positives = 46/106 (43%), Gaps = 2/106 (1%)
 Frame = +1

Query: 328 YYDHHHHH--YHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHL 501
           ++ HHHHH  +HHHHHH + HH   +  HH            H  H   A HH     H 
Sbjct: 56  WFHHHHHHPWFHHHHHHPWFHHHHHHDAHH------------HHHHHHDAHHHHHH--HD 101

Query: 502 DHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            HH H H      H+H HH A+    H H HH     HH+    HH
Sbjct: 102 AHHHHHHHHDAHHHHHHHHDAHH---HHHHHHDAHHHHHH----HH 140

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 30/80 (37%), Positives = 36/80 (45%), Gaps = 2/80 (2%)
 Frame = +1

Query: 325 SYYDHHHHHY--HHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLH 498
           +++ HHHHH   HHHHHH  HHH   +H HH +          H  H     HH     H
Sbjct: 83  AHHHHHHHHDAHHHHHHHDAHHH---HHHHHDA----------HHHHH----HH-----H 120

Query: 499 LDHHSHIHRPLLPQHYHQHH 558
             HH H H      H+H HH
Sbjct: 121 DAHHHHHHHHDAHHHHHHHH 140

[17][TOP]
>UniRef100_Q4TES1 Chromosome undetermined SCAF5157, whole genome shotgun sequence.
           (Fragment) n=1 Tax=Tetraodon nigroviridis
           RepID=Q4TES1_TETNG
          Length = 135

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 41/116 (35%), Positives = 51/116 (43%), Gaps = 2/116 (1%)
 Frame = +1

Query: 253 GLSNACTLQDSQMEISVFFSLSFSSYYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPC 432
           G S  C   D +++  +   L    ++ HHHHH+HHHHHH +HHH   +H HH       
Sbjct: 34  GFSPVCKGVDLELKEGIHPPLHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------ 87

Query: 433 LCPSLHRSHQPRALHHPRRLLHLDHHSHIHRPLLPQHYHQHHP--AYSQSPHCHSH 594
                H  H     HH     H  HH H H      H+H HHP  A  Q P  H H
Sbjct: 88  -----HHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHPFQARLQRPD-HDH 133

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 38/101 (37%), Positives = 43/101 (42%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           HHHHH+HHHHHH +HHH   +H HH            H  H     HH     H  HH H
Sbjct: 55  HHHHHHHHHHHHHHHHHHHHHHHHHH-----------HHHHH----HH-----HHHHHHH 94

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H      H+H HH       H H HH     HH+    HH
Sbjct: 95  HH------HHHHHH-------HHHHHHHHHHHHHHH---HH 119

[18][TOP]
>UniRef100_UPI0000DB70F4 PREDICTED: similar to scribbler CG5580-PA, isoform A n=1 Tax=Apis
           mellifera RepID=UPI0000DB70F4
          Length = 1927

 Score = 54.3 bits (129), Expect(2) = 2e-14
 Identities = 40/82 (48%), Positives = 53/82 (64%)
 Frame = +3

Query: 378 PSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTS 557
           P+     S+SSS  S S S S S+S +S++SSSS S +T S SS S S   SS++ SS+S
Sbjct: 227 PNGCGQSSNSSSSSSSSSSSSSSSSSSSSSSSSSCSSSTSSVSSSSLSSSLSSSSSSSSS 286

Query: 558 SSIFSISSLSLSSPASNSTSLS 623
           SS  S SS S SS +S+S+S S
Sbjct: 287 SSSSSSSSSSSSSSSSSSSSSS 308

 Score = 48.9 bits (115), Expect(2) = 2e-14
 Identities = 14/22 (63%), Positives = 19/22 (86%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQR 393
           ++ H HHH+HHHHHH +HHHQ+
Sbjct: 183 HHPHPHHHHHHHHHHHHHHHQQ 204

 Score = 54.7 bits (130), Expect(2) = 9e-11
 Identities = 43/91 (47%), Positives = 56/91 (61%)
 Frame = +3

Query: 351 LSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPS 530
           L+SS    V +S      SS+  S S S S S+S +S++SSSSSS  + S SS S S  S
Sbjct: 215 LNSSNLIAVTTSPNGCGQSSNSSSSSSSSSSSSSSSSSSSSSSSSSCSSSTSSVSSSSLS 274

Query: 531 SSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 275 SSLSSSSSSSSSSSSSSSSSSSSSSSSSSSS 305

 Score = 36.2 bits (82), Expect(2) = 9e-11
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQ 375
           ++ HHHHH+HHHH  Q
Sbjct: 190 HHHHHHHHHHHHHQQQ 205

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 44/94 (46%), Positives = 60/94 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S +L +   SP     +  SSSSS  S S S S S+S +S++SS SSS ++ S SS S 
Sbjct: 216 NSSNLIAVTTSPNGCGQSSNSSSSSSSSSSSSSSSSSSSSSSSSSCSSSTSSVSSSSLSS 275

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSL 620
           S  SSS++ SS+SSS  S SS S SS +S+S+SL
Sbjct: 276 SLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSL 309

 Score = 47.8 bits (112), Expect(2) = 1e-06
 Identities = 38/90 (42%), Positives = 57/90 (63%)
 Frame = +3

Query: 354 SSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSS 533
           +SS  + + SS+ +  ++S       S S S+S +S++SSSSSS ++ S SS S S  +S
Sbjct: 208 NSSTTNGLNSSNLIAVTTSPNGCGQSSNSSSSSSSSSSSSSSSSSSSSSSSS-SCSSSTS 266

Query: 534 STALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S + SS SSS+ S SS S SS +S+S+S S
Sbjct: 267 SVSSSSLSSSLSSSSSSSSSSSSSSSSSSS 296

 Score = 28.9 bits (63), Expect(2) = 1e-06
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQ 375
           ++ HHHHH+HH    Q
Sbjct: 192 HHHHHHHHHHHQQQLQ 207

[19][TOP]
>UniRef100_C7TY65 Histidine-rich glycoprotein n=1 Tax=Schistosoma japonicum
           RepID=C7TY65_SCHJA
          Length = 236

 Score = 81.6 bits (200), Expect = 5e-14
 Identities = 40/105 (38%), Positives = 47/105 (44%), Gaps = 1/105 (0%)
 Frame = +1

Query: 328 YYDHHHHH-YHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLD 504
           ++DHHHHH YHHHH H YHHH   +H HH            HR H     HH     H  
Sbjct: 149 HFDHHHHHGYHHHHRHGYHHHHGHHHHHHH-----------HRHH---GCHHHHGYHHHH 194

Query: 505 HHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           HH H H      H+H +H  +    H H HH     HH+    HH
Sbjct: 195 HHGHHH------HHHGYHHHHHHGYHHHHHH----GHHHHHGYHH 229

 Score = 79.3 bits (194), Expect = 3e-13
 Identities = 36/109 (33%), Positives = 46/109 (42%), Gaps = 3/109 (2%)
 Frame = +1

Query: 319 FSSYYDHHHHHYHHHHHHQYHHHQRCYH---LHHQSGPCPCLCPSLHRSHQPRALHHPRR 489
           +  +Y HHHHH+  HHHH+YHHH   +H    HH  G         H  H     HH  R
Sbjct: 121 YRHHYGHHHHHHIRHHHHRYHHHHGHHHHFDHHHHHGYHHHHRHGYHHHHGHHHHHHHHR 180

Query: 490 LLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLH 636
                HH   H      H+H HH  +    H + HH     HH+  + H
Sbjct: 181 HHGCHHHHGYHHHHHHGHHHHHHGYHHHHHHGYHHHHHHGHHHHHGYHH 229

 Score = 76.6 bits (187), Expect = 2e-12
 Identities = 37/106 (34%), Positives = 46/106 (43%), Gaps = 3/106 (2%)
 Frame = +1

Query: 331 YDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHH 510
           Y H+ HHYHHHH   +HHH+R ++ HH            H  H     HH R   H  HH
Sbjct: 98  YKHYGHHYHHHHVGHHHHHRRHHYRHHYG----------HHHHHHIRHHHHRYHHHHGHH 147

Query: 511 SHI-HRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQ--HHYRSFLHH 639
            H  H      H+H  H  +    H H HH  R    HH+  + HH
Sbjct: 148 HHFDHHHHHGYHHHHRHGYHHHHGHHHHHHHHRHHGCHHHHGYHHH 193

 Score = 75.1 bits (183), Expect = 5e-12
 Identities = 41/115 (35%), Positives = 49/115 (42%), Gaps = 11/115 (9%)
 Frame = +1

Query: 328 YYDHHHHHYH---HHHH--HQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRL 492
           +Y HH+HH+H   HHHH  H Y HH   +H HH             R H  R  HH    
Sbjct: 100 HYGHHYHHHHVGHHHHHRRHHYRHHYGHHHHHH------------IRHHHHRYHHHHGHH 147

Query: 493 LHLDHH-----SHIHRPLLPQHY-HQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H DHH      H HR     H+ H HH  + +   CH HH     HH+    HH
Sbjct: 148 HHFDHHHHHGYHHHHRHGYHHHHGHHHHHHHHRHHGCHHHHGYHHHHHHGHHHHH 202

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 31/103 (30%), Positives = 44/103 (42%)
 Frame = +1

Query: 331 YDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHH 510
           Y   HHH  H+HHH+  +H+R  H  H            +  H     HH RR  +  H+
Sbjct: 77  YGRGHHHGRHYHHHRGRYHRRYKHYGHH-----------YHHHHVGHHHHHRRHHYRHHY 125

Query: 511 SHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H H   +  H+H++H  +    H   HH     HH+R   HH
Sbjct: 126 GHHHHHHIRHHHHRYHHHHGHHHHFDHHHHHGYHHHHRHGYHH 168

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 21/38 (55%), Positives = 22/38 (57%), Gaps = 2/38 (5%)
 Frame = +1

Query: 331 YDHHHHHYHHHHHHQYHHHQRCYHLHHQS--GPCPCLC 438
           + HHHH YHHHHHH YHHH    H HH      C C C
Sbjct: 198 HHHHHHGYHHHHHHGYHHHHHHGHHHHHGYHHCCHCCC 235

[20][TOP]
>UniRef100_C5WSQ0 Putative uncharacterized protein Sb01g042620 n=1 Tax=Sorghum bicolor
            RepID=C5WSQ0_SORBI
          Length = 1043

 Score = 81.3 bits (199), Expect = 7e-14
 Identities = 62/192 (32%), Positives = 91/192 (47%), Gaps = 33/192 (17%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D GE    +   +A DES ++     + D+ D   ++  GEYDYDDLD  A E++++L+ 
Sbjct: 859  DAGELLADNNADDASDESGDD-----MPDLGDGLTDD--GEYDYDDLDSNAFEEEKDLLR 911

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDD-------DGTGDGGDDDSDGD------------- 341
            D SD E+D   D     DE   N DD       D        DSDG+             
Sbjct: 912  DDSDVELDDISDDTASIDEGSENDDDISSLAALDAEALESASDSDGNLSDEEMVDAGKGG 971

Query: 340  ------DGRSKKKKKEKRKRKSPFASLEEYKHLIDQD-EKEDSKTKRKAT------SEPT 200
                   G   K K+  +   SPFASLE+Y+HL+D + +   +K K KAT       +P 
Sbjct: 972  GSYTEKKGAGMKHKRGVKSGSSPFASLEDYEHLMDGNADATTAKRKHKATGKAGGEKKPK 1031

Query: 199  KKKKKKKSKASE 164
             + +KK+S++SE
Sbjct: 1032 LRSRKKRSRSSE 1043

[21][TOP]
>UniRef100_C9JX52 Putative uncharacterized protein ENSP00000393117 (Fragment) n=1
           Tax=Homo sapiens RepID=C9JX52_HUMAN
          Length = 233

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 80/192 (41%), Positives = 97/192 (50%), Gaps = 32/192 (16%)
 Frame = +3

Query: 144 ATSLASYSDALDFFFFFFFVGSDVAFLLVFESSFSSWSIKCL------------------ 269
           ++S +S+S +   F F  F  S  +    F SSFSS+S   L                  
Sbjct: 33  SSSFSSFSSSSSSFSFSSFSSSSFSSSSSFSSSFSSFSSSSLSFSFSSFSSSSYSSSSFS 92

Query: 270 ----YSSRLANGDFRFLFSF---FFFLLRPSSPSLSSSP-----PSPVPSSSTLLSSSSS 413
               +SS   +  F F F F   FFF  R S  S SSS      PSP  SSS   SSSSS
Sbjct: 93  PYFSFSSSSFSSSFSFSFFFTPSFFFSSRSSCSSRSSSSFFSPSPSPSSSSS---SSSSS 149

Query: 414 IRSMSMSVSISASLTSATSSSSSSPATPSRS-S*SYSP-PSSSTALSSTSSSIFSISSLS 587
             S S   S S S  S++SSSS SP +PS S S S SP PSSS + SS+SSS FS SS S
Sbjct: 150 PSSASSPSSPSPSSPSSSSSSSPSPFSPSPSPSTSPSPSPSSSFSSSSSSSSSFSSSSSS 209

Query: 588 LSSPASNSTSLS 623
            SS +S+S+S S
Sbjct: 210 FSSSSSSSSSSS 221

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 61/164 (37%), Positives = 75/164 (45%), Gaps = 29/164 (17%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SSFSS S    +SS   +    F  SF  F    SS S SS   S   SSS+  SS SS 
Sbjct: 10  SSFSSSSFSSSFSSSSFSSSSSFSSSFSSFSSSSSSFSFSSFSSSSFSSSSSFSSSFSSF 69

Query: 417 RSMSMSVSISASLTSATSSSSSSP-----------------------------ATPSRSS 509
            S S+S S S+  +S+ SSSS SP                             +  SRSS
Sbjct: 70  SSSSLSFSFSSFSSSSYSSSSFSPYFSFSSSSFSSSFSFSFFFTPSFFFSSRSSCSSRSS 129

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S+  PS S + SS+SSS    S+ S SSP+ +S S S  S PS
Sbjct: 130 SSFFSPSPSPSSSSSSSSSSPSSASSPSSPSPSSPSSSSSSSPS 173

[22][TOP]
>UniRef100_B3L3T6 Putative uncharacterized protein n=1 Tax=Plasmodium knowlesi strain H
            RepID=B3L3T6_PLAKH
          Length = 2483

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 59/161 (36%), Positives = 84/161 (52%), Gaps = 11/161 (6%)
 Frame = -1

Query: 622  DSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAE 443
            D + E E G + D+E+ EN  D  +++  EEE  E+D DD D     DD +   D SD +
Sbjct: 1053 DQNEEEEEGKDEDDEDDEN--DGTEEDDAEEE-DEFDVDDNDDDDDSDDSD-NDDNSDDD 1108

Query: 442  MDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD--------GRSKKKKKEKRKRKSPF 287
             D   D D  DDE D   DDD     GDD +D DD        GR K+KKK KR +++ F
Sbjct: 1109 NDDGSD-DSDDDEADGETDDDDLPSDGDDQADEDDEDQAYHKGGRKKRKKKGKRGKENQF 1167

Query: 286  ASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKK---KKKSK 173
              +EE +  I +++++ +     + S   KKKK   KKK+K
Sbjct: 1168 MDVEESEGEISREDEKHNCHYNHSNSHYDKKKKLYLKKKNK 1208

[23][TOP]
>UniRef100_A7T6H4 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A7T6H4_NEMVE
          Length = 82

 Score = 77.8 bits (190), Expect = 7e-13
 Identities = 35/100 (35%), Positives = 44/100 (44%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH 507
           +Y HHHHH++H H H   HHQ+ YH HH +          H  H     HH     H  H
Sbjct: 2   HYHHHHHHHYHSHCHHNLHHQKHYHYHHHNN---------HYHHH----HHHHSFCHHHH 48

Query: 508 HSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRS 627
           H H        H+H HH  +S   H H HH     HH+ +
Sbjct: 49  HHH-------NHHHHHHYHHSHRHHHHHHHNHCYHHHHHN 81

 Score = 67.8 bits (164), Expect = 8e-10
 Identities = 39/104 (37%), Positives = 44/104 (42%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH 507
           Y+ HHHHHYH H HH  HH Q+ YH HH            H +H     HH     H  H
Sbjct: 3   YHHHHHHHYHSHCHHNLHH-QKHYHYHH------------HNNHY----HH-----HHHH 40

Query: 508 HSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           HS  H      H+H HH       H H HH     H +R   HH
Sbjct: 41  HSFCH------HHHHHHN------HHHHHH---YHHSHRHHHHH 69

 Score = 67.8 bits (164), Expect = 8e-10
 Identities = 35/96 (36%), Positives = 44/96 (45%)
 Frame = +1

Query: 310 SLSFSSYYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRR 489
           +L    +Y +HHH+ H+HHHH  HHH  C+H HH            H +H     HH   
Sbjct: 18  NLHHQKHYHYHHHNNHYHHHH--HHHSFCHHHHH------------HHNHH----HH--- 56

Query: 490 LLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHH 597
             H  HHSH H      H+H HH       HC+ HH
Sbjct: 57  --HHYHHSHRH------HHHHHH------NHCYHHH 78

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
 Frame = +1

Query: 322 SSYYDHHHHHY----HHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRR 489
           +++Y HHHHH+    HHHHHH +HHH   +H HH            HR H     HH   
Sbjct: 31  NNHYHHHHHHHSFCHHHHHHHNHHHH---HHYHHS-----------HRHHHH---HHHNH 73

Query: 490 LLHLDHHSH 516
             H  HH+H
Sbjct: 74  CYHHHHHNH 82

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 28/80 (35%), Positives = 36/80 (45%), Gaps = 4/80 (5%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQ----YHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLL 495
           +Y HH++HYHHHHHH     +HHH   +H HH            H  H  R  HH     
Sbjct: 26  HYHHHNNHYHHHHHHHSFCHHHHHHHNHHHHH------------HYHHSHRHHHH----- 68

Query: 496 HLDHHSHIHRPLLPQHYHQH 555
              HH+H +      H+H H
Sbjct: 69  --HHHNHCYH----HHHHNH 82

 Score = 58.9 bits (141), Expect = 4e-07
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 6/40 (15%)
 Frame = +1

Query: 316 SFSSYYDHHHHHYHHHH------HHQYHHHQRCYHLHHQS 417
           SF  ++ HHH+H+HHHH      HH +HHH  CYH HH +
Sbjct: 42  SFCHHHHHHHNHHHHHHYHHSHRHHHHHHHNHCYHHHHHN 81

[24][TOP]
>UniRef100_Q6VBJ3 Epa4p n=1 Tax=Candida glabrata RepID=Q6VBJ3_CANGA
          Length = 1416

 Score = 77.4 bits (189), Expect = 9e-13
 Identities = 55/95 (57%), Positives = 67/95 (70%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  SP PSSS+  SSSSS  S S S S S+S +S++SSSSSSP +PS SS S 
Sbjct: 382 SSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSP-SPSSSSSSS 440

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S  SP+S+S+S S
Sbjct: 441 SSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSS 475

 Score = 77.4 bits (189), Expect = 9e-13
 Identities = 55/99 (55%), Positives = 68/99 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS PSP  SSS+  SSSSS  S S S S S+S +S++SSSS SP++ S SS S 
Sbjct: 384 SSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSS 443

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSP 635
           S  SSS++ SS+SSS  S SS S SS +S+S+S S  SP
Sbjct: 444 SSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSP 482

 Score = 74.3 bits (181), Expect = 8e-12
 Identities = 56/108 (51%), Positives = 69/108 (63%), Gaps = 6/108 (5%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSP------ATP 497
           PS    SSS  SP PSSS+  SSSSS  S S S S S+S +S++SSSSSSP      ++ 
Sbjct: 325 PSQDINSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSS 384

Query: 498 SRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S SS S SP  SS++ SS+SSS  S SS S SS +S+S+S S  S PS
Sbjct: 385 SSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPS 432

 Score = 73.2 bits (178), Expect = 2e-11
 Identities = 56/104 (53%), Positives = 69/104 (66%), Gaps = 3/104 (2%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIR---SMSMSVSISASLTSATSSSSSSPATPSRSS 509
           SS S SSS PSP  SSS+  SSSSS     S S S S S+S +S++SSSSSS ++ S SS
Sbjct: 366 SSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 425

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S S PS S++ SS+SSS  S SS S SS +S+S+S S  SP S
Sbjct: 426 SSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSS 469

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 54/101 (53%), Positives = 66/101 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS  S   SSS+  SSSSS  S S S S S+S + + SSSSSS ++ S SS S 
Sbjct: 335 SSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSS-SP 393

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           SP SSS++ SS+SSS  S SS S SS +S+S+S S    PS
Sbjct: 394 SPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPS 434

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 53/99 (53%), Positives = 65/99 (65%), Gaps = 4/99 (4%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  +PS SS S 
Sbjct: 343 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSSS 402

Query: 519 SPPSSSTALSSTSSSIFSISSLSLS----SPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S    SP+S+S+S S
Sbjct: 403 SSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSS 441

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 52/99 (52%), Positives = 64/99 (64%), Gaps = 3/99 (3%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSS---SSSSPATPSRS 506
           PS  S SSS  S   SSS   SSSSS  S S S S S+S +S++SS   SSSS ++PS S
Sbjct: 375 PSPSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPS 434

Query: 507 S*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S S  SSS++ SS+SSS  S SS S SSP+ +S+S S
Sbjct: 435 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSS 473

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/100 (51%), Positives = 63/100 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS  S   SSS+  SSSSS  S S S S S+S + + SSSSSS ++ S SS S 
Sbjct: 391 SSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSS 450

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPP 638
           S  SSS++ SS+SS   S SS S SS +S+S S+   S P
Sbjct: 451 SSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSPSIQPSSKP 490

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+   SSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 357 SSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSS 416

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS   S SS S SS +S+S+S S
Sbjct: 417 SSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSS 451

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/94 (50%), Positives = 58/94 (61%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS S SSS  S   SSS+  SSSSS  S S S S  +  +S++SSSSSS ++ S SS S
Sbjct: 395 PSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSS 454

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S  SSS++  S SSS  S SS S SSP+   +S
Sbjct: 455 SSSSSSSSSSPSPSSSSSSSSSSSSSSPSIQPSS 488

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS    S S S S+S +S++ S SSS ++ S SS S 
Sbjct: 350 SSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSS 409

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 410 SSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSS 444

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS S  S S S S S+S +S + SSSSS ++ S SS S 
Sbjct: 352 SSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSS 411

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S  S S SS +S+S+S S
Sbjct: 412 SSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSS 446

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S SSS  S S S S S+   S++SSSSSS ++ S SS S 
Sbjct: 356 SSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSS 415

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS    SS S SS +S+S+S S
Sbjct: 416 SSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSS 450

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 49/98 (50%), Positives = 62/98 (63%), Gaps = 3/98 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPA---TPSRSS 509
           SS S SSS  S   SSS+  SSSSS  S S S    +S +S++SSSSSS +   + S SS
Sbjct: 342 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSS 401

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S S  SSS++ SS+SSS  S SS S SSP+ +S+S S
Sbjct: 402 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSS 439

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 47/95 (49%), Positives = 58/95 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S S S  S S S S S+S  S +SSSSSS ++ S SS S 
Sbjct: 354 SSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSS 413

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS     S S SS +S+S+S S
Sbjct: 414 SSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSS 448

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 43/86 (50%), Positives = 54/86 (62%)
 Frame = +3

Query: 366 PSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTAL 545
           P P PS     SSSSS    S S S S+S +S++SSSSSS ++ S SS   S  SSS + 
Sbjct: 321 PLPTPSQDINSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSS---SSSSSSPSP 377

Query: 546 SSTSSSIFSISSLSLSSPASNSTSLS 623
           SS+SSS  S SS S  SP+S+S+S S
Sbjct: 378 SSSSSSSSSSSSSSSPSPSSSSSSSS 403

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 44/91 (48%), Positives = 54/91 (59%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS      S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 404 SSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 463

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNS 611
           SP  SS++ SS+SSS  S S    S P   S
Sbjct: 464 SPSPSSSSSSSSSSSSSSPSIQPSSKPVDPS 494

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 42/95 (44%), Positives = 58/95 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS PSP  SSS+  SSSSS      S S S+S +S++SSSSSSP+  S SS S 
Sbjct: 422 SSSSSSSSSPSPSSSSSSSSSSSSS------SSSSSSSSSSSSSSSSSSPSPSSSSSSSS 475

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS ++  +S  +      S + P++N +S++
Sbjct: 476 SSSSSSPSIQPSSKPV----DPSPADPSNNPSSVN 506

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 50/104 (48%), Positives = 60/104 (57%), Gaps = 3/104 (2%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS S   S S S S S+S +S++SSSSSS    S SS S 
Sbjct: 409 SSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSS---SSSSSSSP 465

Query: 519 SPPSSSTALSSTSSSIFSISSLSL---SSPASNSTSLS*FSPPS 641
           SP SSS++ SS+SSS  SI   S     SPA  S + S  +P S
Sbjct: 466 SPSSSSSSSSSSSSSSPSIQPSSKPVDPSPADPSNNPSSVNPSS 509

[25][TOP]
>UniRef100_C5MEE4 Putative uncharacterized protein n=1 Tax=Candida tropicalis
           MYA-3404 RepID=C5MEE4_CANTT
          Length = 720

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 2/110 (1%)
 Frame = +1

Query: 316 SFSSYYDH--HHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRR 489
           SF++ +D+  HHHH+HHHHHH   H Q  + +HH+  P P   P  H  ++P     P  
Sbjct: 457 SFTNEWDNQEHHHHHHHHHHHDEPHDQHQHDVHHEPSPPPQPAPEQH--YEP-----PPP 509

Query: 490 LLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           + H ++H H   P   + YH HH  + +  H H  +    +HH+    HH
Sbjct: 510 VYHEEYHHH-EEPHHEEEYH-HHQHHEEEHHHHEEYHHNDEHHHHDESHH 557

[26][TOP]
>UniRef100_Q6VBJ4 Epa5p n=1 Tax=Candida glabrata RepID=Q6VBJ4_CANGA
          Length = 1218

 Score = 76.6 bits (187), Expect = 2e-12
 Identities = 56/95 (58%), Positives = 68/95 (71%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  SP PSSS+  SSSSS  S S S S S+S +S++SSSSSSP +PSRSS S 
Sbjct: 385 SSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSP-SPSRSS-SS 442

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S  SP+S+S+S S
Sbjct: 443 SSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSS 477

 Score = 73.2 bits (178), Expect = 2e-11
 Identities = 54/101 (53%), Positives = 66/101 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS  S   SSS+  SSSSS  S S S S S+S + + SSSSSS ++ S SS S 
Sbjct: 335 SSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSS 394

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           SP  SS++ SS+SSS  S SS S SS +S+S+S S  S PS
Sbjct: 395 SPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPS 435

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 53/100 (53%), Positives = 66/100 (66%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           SPS SSS  S   SSS+  SSSSS  S S S S S+S + ++SSSSSS ++ S SS S S
Sbjct: 338 SPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSPS 397

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           P SSS++ SS+SSS  S SS S SS +S+S+S S    PS
Sbjct: 398 PSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPS 437

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 50/92 (54%), Positives = 63/92 (68%)
 Frame = +3

Query: 348 SLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPP 527
           S SSS PSP  SSS+  SSSSS  S S S S S+S +S++SSSS SP++ S SS S S  
Sbjct: 331 SSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSS 390

Query: 528 SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SSS++ S +SSS  S SS S SS +S+S+S S
Sbjct: 391 SSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSS 422

 Score = 70.9 bits (172), Expect = 9e-11
 Identities = 55/102 (53%), Positives = 68/102 (66%), Gaps = 3/102 (2%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS PSP  SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 366 SSSSSSSSSPSPSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSS 425

Query: 519 SPPSSSTALS---STSSSIFSISSLSLSSPASNSTSLS*FSP 635
           S  SSS++ S   S+SSS  S SS S SS +S+S+S S  SP
Sbjct: 426 SSSSSSSSPSPSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSP 467

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 53/96 (55%), Positives = 66/96 (68%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 406 SSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSRSSSSSSSSSSSSSSSSSSSSSSSSSSS 465

Query: 519 SP-PSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SP PSSS++ SS+SSS  S SS S  SP+S+S+S S
Sbjct: 466 SPSPSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSS 501

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 55/102 (53%), Positives = 67/102 (65%), Gaps = 1/102 (0%)
 Frame = +3

Query: 339 SSPSLSSSP-PSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           SS S SSSP PS   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S
Sbjct: 367 SSSSSSSSPSPSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSS 426

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S  SSS + S +SSS  S SS S SS +S+S+S S  S PS
Sbjct: 427 SSSSSSSPSPSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSPS 468

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 55/102 (53%), Positives = 68/102 (66%), Gaps = 1/102 (0%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 408 SSSSSSSSSSSSSSSSSSSSSSSSSSPSPSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSP 467

Query: 519 SPPSSSTALSSTSSSIFSISSLSLS-SPASNSTSLS*FSPPS 641
           SP SSS++ SS+SSS  S SS S S S +S+S+S S  S PS
Sbjct: 468 SPSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSPS 509

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 52/95 (54%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSSP+  S SS S 
Sbjct: 347 SSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSPSPSSSSSSSS 406

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S S S S
Sbjct: 407 SSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSRSSS 441

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 52/102 (50%), Positives = 65/102 (63%), Gaps = 6/102 (5%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSI------SASLTSATSSSSSSPATP 497
           PSS S SSS  S   SSS+  SSSSS  S S S S       S+S +S++SSSSSS ++ 
Sbjct: 398 PSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSRSSSSSSSSSSSSSSSSSSS 457

Query: 498 SRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S SS S S PS S++ SS+SSS  S SS S SSP+ +S+S S
Sbjct: 458 SSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSPSPSSSSSS 499

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS SP++ S SS S 
Sbjct: 349 SSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSS 408

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S   S S+S S
Sbjct: 409 SSSSSSSSSSSSSSSSSSSSSSSSSPSPSRSSSSS 443

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/100 (51%), Positives = 62/100 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   S SSS  S S S S S+S +S++SSSSSS  +PS SS S 
Sbjct: 417 SSSSSSSSSSSSSSSSSPSPSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSS 476

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPP 638
           S  SSS++ SS+SS   S SS S SS +S+S S+   S P
Sbjct: 477 SSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSPSIQPSSKP 516

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 51/101 (50%), Positives = 63/101 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS  S   SSS+  SSSSS  S S S S S+S + + S SSSS ++ S SS S 
Sbjct: 394 SSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSRSSSSSSSSSSSSSSS 453

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+S S  S SS S SS +S+S+S S    PS
Sbjct: 454 SSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSPSPS 494

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 50/95 (52%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +    SS S 
Sbjct: 345 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSPSPSSSSSS 404

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S S S S
Sbjct: 405 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSRS 439

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 50/99 (50%), Positives = 62/99 (62%), Gaps = 4/99 (4%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S     S S+S +S++SSSSSS  +PS SS S 
Sbjct: 346 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSPSPSSSSSSS 405

Query: 519 SPPSSSTALSSTSSSIFSISSLSLS----SPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S    SP+ +S+S S
Sbjct: 406 SSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSRSSSSSS 444

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 48/96 (50%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSA-----TSSSSSSPATPSR 503
           SS S SSS PSP  SSS+  SSSSS  S S S S S+S +S+     +SSSSSS ++ S 
Sbjct: 425 SSSSSSSSSPSPSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSS 484

Query: 504 SS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNS 611
           SS S SP  SS++ SS+SSS  S S    S P   S
Sbjct: 485 SSSSSSPSPSSSSSSSSSSSSSSPSIQPSSKPVDPS 520

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 42/86 (48%), Positives = 54/86 (62%)
 Frame = +3

Query: 366 PSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTAL 545
           P P PS     SSSSS    S S S S+S +S++SSSSSS ++ S SS S S   S ++ 
Sbjct: 321 PLPTPSQDINSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSS 380

Query: 546 SSTSSSIFSISSLSLSSPASNSTSLS 623
           SS+SSS  S SS S  SP+S+S+S S
Sbjct: 381 SSSSSSSSSSSSSSSPSPSSSSSSSS 406

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 51/105 (48%), Positives = 61/105 (58%), Gaps = 3/105 (2%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PS    SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS    S SS S
Sbjct: 434 PSPSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSS---SSSSSSS 490

Query: 516 YSPPSSSTALSSTSSSIFSISSLSL---SSPASNSTSLS*FSPPS 641
            SP SSS++ SS+SSS  SI   S     SPA  S + S  +P S
Sbjct: 491 PSPSSSSSSSSSSSSSSPSIQPSSKPVDPSPADPSNNPSSVNPSS 535

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 47/97 (48%), Positives = 59/97 (60%), Gaps = 2/97 (2%)
 Frame = +3

Query: 339 SSPSLSSSPPSP-VPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPA-TPSRSS* 512
           SS S SSS PSP   SSS+  SSSSS  S S S S S+S +S++SSSSSSP+  PS    
Sbjct: 458 SSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSPSIQPSSKPV 517

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SP   S   SS + S  + SS++ SSP+  S S+S
Sbjct: 518 DPSPADPSNNPSSVNPSSVNPSSIN-SSPSIISPSVS 553

[27][TOP]
>UniRef100_O96138 Nucleolar preribosomal assembly protein, putative n=1
           Tax=Plasmodium falciparum 3D7 RepID=O96138_PLAF7
          Length = 442

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 62/204 (30%), Positives = 95/204 (46%), Gaps = 49/204 (24%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDES----DNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDD 476
           G G E+ D DV+ +  DE     D +E  +M D+ +D  +++E  + D DD D     DD
Sbjct: 230 GGGQEDDDEDVDMDDDDEDVDMDDEDEDVDMDDEDEDVDMDDEDEDVDMDDEDEDVDMDD 289

Query: 475 EELVADVSDAEMDTDM--------DMDLID-DEDDNNVDDDGTGDGGD-----DDSDGDD 338
           E+   D+ D + D DM        D+D+ D D+DD +VD D  GD  D     DD+D DD
Sbjct: 290 EDEDVDMDDEDEDVDMDDVDDDDEDVDMDDVDDDDEDVDMDDVGDDDDEGGIYDDNDEDD 349

Query: 337 --------------------GRSKKKKKEKRKRKSPFASLEEYKHL-------IDQDEKE 239
                                + KKKK+++++ K  +   E  K+L       +D DE E
Sbjct: 350 YDNYNDNDKDSVEESTSISNDKKKKKKRKRKEYKKEYVDNEHIKNLQANGKLAMDDDEIE 409

Query: 238 DS----KTKRKATSEPTKKKKKKK 179
           +     + K+K+ S+  K K  KK
Sbjct: 410 EMNHNFRRKKKSNSKKEKGKYCKK 433

[28][TOP]
>UniRef100_Q762A3 BRI1-KD interacting protein 111 (Fragment) n=1 Tax=Oryza sativa
           Japonica Group RepID=Q762A3_ORYSJ
          Length = 148

 Score = 75.5 bits (184), Expect = 4e-12
 Identities = 48/137 (35%), Positives = 73/137 (53%), Gaps = 15/137 (10%)
 Frame = -1

Query: 529 EGGEYDYDDLDGVAGEDDEELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDS 350
           E GEYDYD+LD    E++ +L+   SD E+  D+  D+    D +    +G      +DS
Sbjct: 13  EDGEYDYDNLDATTFEEEGDLLRYDSDVELH-DISDDISSGADSDTEALEGANHSDGNDS 71

Query: 349 DGDDG-RSKKKKKEKRKRKSPFASLEEYKHLIDQDEKE-------------DSKTKRKAT 212
           DG++  + +K+K   +   SPFA LE+Y+HL+D + ++             DSK KRK  
Sbjct: 72  DGEEPVQGQKRKHGAKSGASPFAKLEDYEHLMDGEAEKPTFKKGRKHRVTRDSKEKRKGL 131

Query: 211 SEPTKK-KKKKKSKASE 164
           S   K   +KK+SK SE
Sbjct: 132 SSKEKSGSRKKRSKRSE 148

[29][TOP]
>UniRef100_C4YAM4 Putative uncharacterized protein n=1 Tax=Clavispora lusitaniae ATCC
           42720 RepID=C4YAM4_CLAL4
          Length = 288

 Score = 75.1 bits (183), Expect = 5e-12
 Identities = 64/139 (46%), Positives = 79/139 (56%)
 Frame = +3

Query: 213 VAFLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSST 392
           V  L VF SS SS S     SS  ++       S        SS S SSS  S   SSS+
Sbjct: 135 VVLLCVFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 194

Query: 393 LLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFS 572
             SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S
Sbjct: 195 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 254

Query: 573 ISSLSLSSPASNSTSLS*F 629
            SS S SS +S+S S+S F
Sbjct: 255 SSSSSSSSSSSSSFSISVF 273

 Score = 70.1 bits (170), Expect = 2e-10
 Identities = 55/117 (47%), Positives = 71/117 (60%)
 Frame = +3

Query: 273 SSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISAS 452
           S  L  G +  + S     +  SS S SSS  S   SSS+  SSSSS  S S S S S+S
Sbjct: 121 SDGLVVGCWLLVVSVVLLCVFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 180

Query: 453 LTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 181 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 237

[30][TOP]
>UniRef100_C2Y0K2 Putative uncharacterized protein n=1 Tax=Bacillus cereus AH603
           RepID=C2Y0K2_BACCE
          Length = 377

 Score = 75.1 bits (183), Expect = 5e-12
 Identities = 46/121 (38%), Positives = 58/121 (47%), Gaps = 17/121 (14%)
 Frame = +1

Query: 328 YYDHHHHHYHHHH--HHQYH-HHQR--CYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRL 492
           +++HH HH HH H  HHQ+H HHQ+   +H HHQ  P   L  + H  HQ    HH    
Sbjct: 169 HHEHHGHHGHHQHHGHHQHHGHHQQQVHHHGHHQIHPQAVLYQTHHHGHQGHHQHHGHH- 227

Query: 493 LHLDHHSHIHRPLLPQHY--HQHHPAYSQSPHCHSHHQ--PRI--------QHHYRSFLH 636
            H  HH H       QH+  HQHH  + Q  H   HHQ  P+         QHH++   H
Sbjct: 228 QHQGHHQHQGH---HQHHGQHQHHGHHQQQVHHQGHHQIHPQAVLYQTHQGQHHHQGQHH 284

Query: 637 H 639
           H
Sbjct: 285 H 285

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 36/114 (31%), Positives = 50/114 (43%), Gaps = 10/114 (8%)
 Frame = +1

Query: 328 YYDHHHHHYHH-HHHHQYHHHQRCYHLHH-QSGPCPCLCPSLHRSHQPRALH-------H 480
           +++HH HH  H HH H  HH Q  +H HH   G         H  H  + +H       H
Sbjct: 145 HHEHHGHHGQHVHHEHHGHHGQHVHHEHHGHHGHHQHHGHHQHHGHHQQQVHHHGHHQIH 204

Query: 481 PRRLLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQH-HYRSFLHH 639
           P+ +L+  HH H H+     H H  H  + Q    H HH     H H++  +HH
Sbjct: 205 PQAVLYQTHH-HGHQGHHQHHGHHQHQGHHQHQGHHQHHGQHQHHGHHQQQVHH 257

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 38/109 (34%), Positives = 45/109 (41%), Gaps = 8/109 (7%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           H HH  H HH H  HH Q   H+HH+           H  H  + +HH     H  HH H
Sbjct: 137 HGHHGQHVHHEHHGHHGQ---HVHHE-----------HHGHHGQHVHHE----HHGHHGH 178

Query: 517 IHRPLLPQH--YHQHHPAYSQSPHCHSHHQPRIQ------HHYRSFLHH 639
                  QH  +HQHH  + Q  H H HHQ   Q      HH+    HH
Sbjct: 179 ------HQHHGHHQHHGHHQQQVHHHGHHQIHPQAVLYQTHHHGHQGHH 221

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 40/121 (33%), Positives = 51/121 (42%), Gaps = 7/121 (5%)
 Frame = +1

Query: 298 SVFFSLSFSSYYDHHHHHYHHHH--HHQY-----HHHQRCYHLHHQSGPCPCLCPSLHRS 456
           +V +      +  HH HH HH H  HHQ+     HH Q  +H HHQ          +H  
Sbjct: 207 AVLYQTHHHGHQGHHQHHGHHQHQGHHQHQGHHQHHGQHQHHGHHQQ--------QVH-- 256

Query: 457 HQPRALHHPRRLLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLH 636
           HQ     HP+ +L+  H    H      H  QHH    Q  H   HHQ   QHH++   H
Sbjct: 257 HQGHHQIHPQAVLYQTHQGQHHHQGQHHHQGQHH---HQGQH---HHQG--QHHHQGQQH 308

Query: 637 H 639
           H
Sbjct: 309 H 309

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 33/102 (32%), Positives = 41/102 (40%), Gaps = 2/102 (1%)
 Frame = +1

Query: 340 HHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSHI 519
           HH H+  H HH +H  Q  +  HHQ  P   L  +    H  +  HH     H   H H 
Sbjct: 238 HHQHHGQHQHHGHHQQQVHHQGHHQIHPQAVLYQTHQGQHHHQGQHH-----HQGQHHH- 291

Query: 520 HRPLLPQHYH--QHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
                 QH+H  QHH    Q      HHQ   Q H++   HH
Sbjct: 292 ----QGQHHHQGQHHHQGQQHHQGQQHHQG--QQHHQGQQHH 327

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 37/103 (35%), Positives = 44/103 (42%), Gaps = 10/103 (9%)
 Frame = +1

Query: 337 HHHHHYHHHHH--HQYH-HHQRCYHL--HHQSGPCPCLCPSLHRSHQPRALHHPRRLLHL 501
           HH H  HH HH  HQ+H HHQ+  H   HHQ  P   L  +    H  +  HH +   H 
Sbjct: 232 HHQHQGHHQHHGQHQHHGHHQQQVHHQGHHQIHPQAVLYQTHQGQHHHQGQHHHQGQHHH 291

Query: 502 D---HHSHIHRPLLPQHYH--QHHPAYSQSPHCHSHHQPRIQH 615
               HH   H     QH+   QHH    Q      HHQ + QH
Sbjct: 292 QGQHHHQGQHHHQGQQHHQGQQHHQG-QQHHQGQQHHQGQQQH 333

[31][TOP]
>UniRef100_Q7RPC8 Putative uncharacterized protein PY01531 n=1 Tax=Plasmodium yoelii
           yoelii RepID=Q7RPC8_PLAYO
          Length = 391

 Score = 74.7 bits (182), Expect = 6e-12
 Identities = 55/181 (30%), Positives = 84/181 (46%), Gaps = 12/181 (6%)
 Frame = -1

Query: 610 EFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAEMDTD 431
           E E  +E D E+     ++ DD+  EE+  E + +D D    ++DE+   D  D + D D
Sbjct: 218 EMEEVEEEDEED-----ENEDDDDEEEDDDEEEDEDEDDEEEDEDEDEDDDEDDDDEDDD 272

Query: 430 MDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKK--KEKRKRKSPFA--------- 284
            + D  DDEDD+  DDD   D  DDD + DDG  ++KK  K+ +K+K  +          
Sbjct: 273 DEEDDYDDEDDDGEDDDD--DEEDDDGEDDDGEEEEKKIMKKGKKKKKKYVKEYVDNEYI 330

Query: 283 -SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE*EARLVACYARLLMLSIII 107
             L+E   + D DE ED             K+ KK++  S        C   +L+L I +
Sbjct: 331 KKLQEEGQISDGDETED-------VDNNFSKRAKKRNNGSNILPHQFICLTNILLLHIFL 383

Query: 106 I 104
           I
Sbjct: 384 I 384

[32][TOP]
>UniRef100_UPI0001760070 PREDICTED: hypothetical protein, partial n=1 Tax=Danio rerio
           RepID=UPI0001760070
          Length = 370

 Score = 74.3 bits (181), Expect = 8e-12
 Identities = 54/104 (51%), Positives = 68/104 (65%)
 Frame = +3

Query: 330 LRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS 509
           L  SSPS SS   S  PSSS+L SS SS+ S S S S S+S +S++SSSSS  ++ S SS
Sbjct: 88  LSSSSPSSSSLSSSSSPSSSSLSSSPSSLSSSSSSPSSSSSSSSSSSSSSSPLSSSSSSS 147

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S S  S S++ SS+SSS  S SS SLSS +S+ +S S  S PS
Sbjct: 148 SSSSSSSLSSSSSSSSSSSLSSSSSSLSSSSSSLSSSSSSSSPS 191

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 55/97 (56%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVS-ISASLTSATSSSSSSPATPSRSS*S 515
           SSPS SS   S  PSSS+L SSS S  S+S S S  S+SL+S+ SS SSS ++PS SS S
Sbjct: 70  SSPSSSSLSSSSSPSSSSLSSSSPSSSSLSSSSSPSSSSLSSSPSSLSSSSSSPSSSSSS 129

Query: 516 YSPPSSSTA-LSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ LSS+SSS  S SS SLSS +S+S+S S
Sbjct: 130 SSSSSSSSSPLSSSSSSSSSSSSSSLSSSSSSSSSSS 166

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 73/180 (40%), Positives = 97/180 (53%), Gaps = 7/180 (3%)
 Frame = +3

Query: 120 NIRSLA*QATSLASYSDALDFFFFFFFVGSDVAFLLVFESSFSSWSIKCLYSSRLANGDF 299
           ++ S +  ++SL+S S +L          S  +  L   SS SS S     SS  ++   
Sbjct: 193 SLSSSSSSSSSLSSPSSSLSSSSSSLSSSSSSSSSLSSSSSSSSLSSSSSSSSSSSSS-- 250

Query: 300 RFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSS-------SSSIRSMSMSVSISASLT 458
             L S    L   SSPS SSS PS  PS S+  SS       SSS  S S S+S S+S +
Sbjct: 251 --LSSSSSSLSSSSSPSSSSSSPSSSPSLSSSSSSSPSPSPPSSSSSSSSPSLSSSSSSS 308

Query: 459 SATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPP 638
           S++SSSSSS ++PS SS      SSS++LSS+SSS  S  SLS SS +S+S+S S  S P
Sbjct: 309 SSSSSSSSSSSSPSLSS-----SSSSSSLSSSSSSSSSPPSLSSSSSSSSSSSSSSSSYP 363

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 64/141 (45%), Positives = 78/141 (55%), Gaps = 12/141 (8%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSS--------PPSPVPSSST 392
           SS SS S     SS  ++       S        SSPSLSSS          S  PSSS+
Sbjct: 28  SSSSSLSSSSSLSSSSSSSSSSLSSSSSSLSSSSSSPSLSSSSSPSSSSLSSSSSPSSSS 87

Query: 393 LLSSSSSIRSMSMSVSISASLTSAT----SSSSSSPATPSRSS*SYSPPSSSTALSSTSS 560
           L SSS S  S+S S S S+S  S++    SSSSSSP++ S SS S S  SS  + SS+SS
Sbjct: 88  LSSSSPSSSSLSSSSSPSSSSLSSSPSSLSSSSSSPSSSSSSSSSSSSSSSPLSSSSSSS 147

Query: 561 SIFSISSLSLSSPASNSTSLS 623
           S  S SSLS SS +S+S+SLS
Sbjct: 148 SSSSSSSLSSSSSSSSSSSLS 168

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 54/95 (56%), Positives = 68/95 (71%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSP  SSS  S   SSS+L SSSSS  S S+S S S+SL+S++SS SSS ++ S SS   
Sbjct: 137 SSPLSSSSSSSSSSSSSSLSSSSSSSSSSSLSSS-SSSLSSSSSSLSSSSSSSSPSSSLS 195

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++LSS SSS+ S SS SLSS +S+S+SLS
Sbjct: 196 SSSSSSSSLSSPSSSLSSSSS-SLSSSSSSSSSLS 229

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 59/112 (52%), Positives = 72/112 (64%), Gaps = 11/112 (9%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLT-----SATSSSSSSPATPSR 503
           SS SLSSS  S   SSS+L SSSSS+ S S   S S+S +     S++SSSS SP+ PS 
Sbjct: 233 SSSSLSSSSSSSSSSSSSLSSSSSSLSSSSSPSSSSSSPSSSPSLSSSSSSSPSPSPPSS 292

Query: 504 SS*SYSP--PSSSTALSSTSSSIFSISSLSLSSPAS----NSTSLS*FSPPS 641
           SS S SP   SSS++ SS+SSS  S SS SLSS +S    +S+S S  SPPS
Sbjct: 293 SSSSSSPSLSSSSSSSSSSSSSSSSSSSPSLSSSSSSSSLSSSSSSSSSPPS 344

 Score = 70.1 bits (170), Expect = 2e-10
 Identities = 66/136 (48%), Positives = 82/136 (60%), Gaps = 1/136 (0%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S   L SS  ++       S     L  S  SLSSS  SP  SSS+  SSSSS 
Sbjct: 78  SSSSSPSSSSLSSSSPSSSSLSSSSSPSSSSLSSSPSSLSSSSSSPSSSSSSSSSSSSSS 137

Query: 417 RSMSMSVSISASLTSAT-SSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLS 593
             +S S S S+S +S++ SSSSSS ++ S SS S S  SSS++LSS+SSS  S  S SLS
Sbjct: 138 SPLSSSSSSSSSSSSSSLSSSSSSSSSSSLSSSSSSLSSSSSSLSSSSSS--SSPSSSLS 195

Query: 594 SPASNSTSLS*FSPPS 641
           S +S+S+SLS  SP S
Sbjct: 196 SSSSSSSSLS--SPSS 209

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 54/96 (56%), Positives = 68/96 (70%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSS-SSSSPATPSRSS*S 515
           SS SLSSS  S   SSS+L SSSSS+ S S S+S S+S +S +SS SSSS ++ S SS S
Sbjct: 151 SSSSLSSSSSSS--SSSSLSSSSSSLSSSSSSLSSSSSSSSPSSSLSSSSSSSSSLSSPS 208

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++LSS+SSS  S+SS S SS  S+S+S S
Sbjct: 209 SSLSSSSSSLSSSSSSSSSLSSSSSSSSLSSSSSSS 244

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 55/104 (52%), Positives = 71/104 (68%), Gaps = 4/104 (3%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRS-S*SY 518
           S S SSS  S   SSS+ LSSSSS+ S S S+S S+SL+S++SSSSSS ++ S S S S 
Sbjct: 2   SSSSSSSLSSSSLSSSSSLSSSSSLSSSSSSLSSSSSLSSSSSSSSSSLSSSSSSLSSSS 61

Query: 519 SPPSSSTALSSTSSSIFSI---SSLSLSSPASNSTSLS*FSPPS 641
           S PS S++ S +SSS+ S    SS SLSS + +S+SLS  S PS
Sbjct: 62  SSPSLSSSSSPSSSSLSSSSSPSSSSLSSSSPSSSSLSSSSSPS 105

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 53/102 (51%), Positives = 63/102 (61%)
 Frame = +3

Query: 330 LRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS 509
           L  SS SLSSS  S  PSSS   SSSSS    S S S+S+S +S +SSSSSS +  S SS
Sbjct: 174 LSSSSSSLSSSSSSSSPSSSLSSSSSSSSSLSSPSSSLSSSSSSLSSSSSSSSSLSSSSS 233

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSP 635
            S    SSS++ SS+SS   S SSLS SS  S+S+S    SP
Sbjct: 234 SSSLSSSSSSSSSSSSSLSSSSSSLSSSSSPSSSSSSPSSSP 275

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 56/112 (50%), Positives = 71/112 (63%), Gaps = 16/112 (14%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVS-ISASLTSATSSSSSSPATPSRSS* 512
           PSS SLSSSP S   SSS+  SSSSS  S S S S +S+S +S++SSSSSS ++ S SS 
Sbjct: 104 PSSSSLSSSPSSLSSSSSSPSSSSSSSSSSSSSSSPLSSSSSSSSSSSSSSLSSSSSSSS 163

Query: 513 SYSPPSSSTALSSTSSSIFSISSLS---------------LSSPASNSTSLS 623
           S S  SSS++LSS+SSS+ S SS S               LSSP+S+ +S S
Sbjct: 164 SSSLSSSSSSLSSSSSSLSSSSSSSSPSSSLSSSSSSSSSLSSPSSSLSSSS 215

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 61/138 (44%), Positives = 77/138 (55%), Gaps = 3/138 (2%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S   L SS   +       S        S  S SSS  S + SSS+ LSSSSS 
Sbjct: 4   SSSSSLSSSSLSSSSSLSSSSSLSSSSSSLSSSSSLSSSSSSSSSSLSSSSSSLSSSSSS 63

Query: 417 RSMSMSVSISASLTSATSSSSSS---PATPSRSS*SYSPPSSSTALSSTSSSIFSISSLS 587
            S+S S S S+S  S++SS SSS    ++PS SS S S   SS++LSS+ SS+ S SS  
Sbjct: 64  PSLSSSSSPSSSSLSSSSSPSSSSLSSSSPSSSSLSSSSSPSSSSLSSSPSSLSSSSSSP 123

Query: 588 LSSPASNSTSLS*FSPPS 641
            SS +S+S+S S  SP S
Sbjct: 124 SSSSSSSSSSSSSSSPLS 141

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+L SSSSS+ S S S S S+SL+S++SSSSS  +  S  S S 
Sbjct: 156 SSSSSSSSSSSLSSSSSSLSSSSSSLSSSSSSSSPSSSLSSSSSSSSSLSSPSSSLSSSS 215

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+ SS  S SSLS SS +S+S+S S
Sbjct: 216 SSLSSSSSSSSSLSSSSSSSSLSSSSSSSSSSSSS 250

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 55/104 (52%), Positives = 69/104 (66%)
 Frame = +3

Query: 330 LRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS 509
           L  SS SLSSS  S + SSS+  S SSS+ S S S S  +S +S+ SSSSSS ++ S SS
Sbjct: 167 LSSSSSSLSSS-SSSLSSSSSSSSPSSSLSSSSSSSSSLSSPSSSLSSSSSSLSSSSSSS 225

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S S  SSS++LSS+SSS    SS S SS +S+S+SLS  S PS
Sbjct: 226 SSLSSSSSSSSLSSSSSS----SSSSSSSLSSSSSSLSSSSSPS 265

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 55/100 (55%), Positives = 70/100 (70%), Gaps = 5/100 (5%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSS-SSSPATPSRSS*S 515
           SSPS SSS  S   SSS+ LSSSSS  S S S S+S+S +S++SSS SSS ++ S SS S
Sbjct: 121 SSPSSSSSSSSSSSSSSSPLSSSSSSSSSSSSSSLSSSSSSSSSSSLSSSSSSLSSSSSS 180

Query: 516 YSPPSSSTA----LSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++    LSS+SSS  S+SS S SS +S+S+SLS
Sbjct: 181 LSSSSSSSSPSSSLSSSSSSSSSLSSPS-SSLSSSSSSLS 219

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 54/101 (53%), Positives = 68/101 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSSP S + SSS   SSSSS+ S S S+S S+S  S++SSSSSS ++ S SS S 
Sbjct: 182 SSSSSSSSPSSSLSSSS---SSSSSLSSPSSSLSSSSSSLSSSSSSSSSLSSSSSSS-SL 237

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+S S  S S  S SSP+S+S+S S  S PS
Sbjct: 238 SSSSSSSSSSSSSLSSSSSSLSSSSSPSSSSSSPS--SSPS 276

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 52/96 (54%), Positives = 65/96 (67%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+L S SSS+ S S S+S S+S +S+ SSSSSS +  S SS   
Sbjct: 186 SSSSPSSSLSSSSSSSSSLSSPSSSLSSSSSSLSSSSSSSSSLSSSSSSSSLSSSSS--- 242

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPA-SNSTSLS 623
           S  SSS++LSS+SSS+ S SS S SS + S+S SLS
Sbjct: 243 SSSSSSSSLSSSSSSLSSSSSPSSSSSSPSSSPSLS 278

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 54/102 (52%), Positives = 68/102 (66%), Gaps = 1/102 (0%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S + S S+ LSSSSS  S+S S S S+SL+S++SSSS S ++ S SS S 
Sbjct: 192 SSLSSSSSSSSSLSSPSSSLSSSSS--SLSSSSSSSSSLSSSSSSSSLSSSSSSSSSSSS 249

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*F-SPPS 641
           S  SSS++LSS+SS   S SS S S   S+S+S S   SPPS
Sbjct: 250 SLSSSSSSLSSSSSPSSSSSSPSSSPSLSSSSSSSPSPSPPS 291

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 3/98 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSS---SPATPSRSS 509
           SS S SSS  S   SSS+  SSSSS+ S S S+S S+S  S++SSSSS   S ++ S SS
Sbjct: 142 SSSSSSSSSSSSSLSSSSSSSSSSSLSSSSSSLSSSSSSLSSSSSSSSPSSSLSSSSSSS 201

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S S PSSS + SS+S S  S SS SLSS +S+S+SLS
Sbjct: 202 SSLSSPSSSLSSSSSSLSSSSSSSSSLSS-SSSSSSLS 238

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 47/84 (55%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +3

Query: 396 LSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSI 575
           LSSSSS    S S+S S+SL+S++S SSSS +  S SS S S  SSS++LSS+SSS+ S 
Sbjct: 1   LSSSSSSSLSSSSLSSSSSLSSSSSLSSSSSSLSSSSSLSSSSSSSSSSLSSSSSSLSSS 60

Query: 576 SSL-SLSSPAS-NSTSLS*FSPPS 641
           SS  SLSS +S +S+SLS  S PS
Sbjct: 61  SSSPSLSSSSSPSSSSLSSSSSPS 84

[33][TOP]
>UniRef100_A5K7G8 Putative uncharacterized protein n=1 Tax=Plasmodium vivax
           RepID=A5K7G8_PLAVI
          Length = 1642

 Score = 74.3 bits (181), Expect = 8e-12
 Identities = 60/185 (32%), Positives = 87/185 (47%), Gaps = 32/185 (17%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIEN--MLDDVDDNAVEEEGGEYDYD------DLDGVAGEDD 476
           E+ +   EF+ GDE+D EE ++    +D DD+  EE+  E DY+      D +    EDD
Sbjct: 200 EDEEDGGEFDVGDENDEEEDDDDDEEEDEDDDGAEEDDEEDDYEEDEFDVDEENYDEEDD 259

Query: 475 EELVADVSDAEMDTDMDMDLIDDEDDNNVDDD-------------------GTGDGGDDD 353
           E+   D  + E D D D +  DDED+++ +DD                   G  D  DD+
Sbjct: 260 EDEEDDEVEGEPDDDADEEENDDEDEDDEEDDDDDDDEEEDEPEDETDEEEGDDDEPDDE 319

Query: 352 SDGDDGRSK---KKKKEKRKRKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKK--K 188
           +D DD   K   KK+K+K KR       E   HL  +D+++D       T    KKK   
Sbjct: 320 TDDDDDDHKRGCKKRKKKTKRGKKHPCKEGEIHL--EDDRQDYPCNLSNTHYDKKKKLYL 377

Query: 187 KKKSK 173
           KKK+K
Sbjct: 378 KKKNK 382

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 42/171 (24%), Positives = 80/171 (46%), Gaps = 17/171 (9%)
 Frame = -1

Query: 634 GENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADV 455
           GE+ + + E +  +E + EE E   ++ ++   EE+GGE+D  D +    +DD++   D 
Sbjct: 169 GEDDEEEEEEDDEEEEEEEEEEEEEEEDEEEEDEEDGGEFDVGDENDEEEDDDDDEEEDE 228

Query: 454 SD------------AEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKE 311
            D             E + D+D +  D+EDD + +DD      DDD+D ++   + +  E
Sbjct: 229 DDDGAEEDDEEDDYEEDEFDVDEENYDEEDDEDEEDDEVEGEPDDDADEEENDDEDEDDE 288

Query: 310 KRKRKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTK-----KKKKKKSK 173
           +          +E +   D++E +D +   +   +        KK+KKK+K
Sbjct: 289 EDDDDDDDEEEDEPEDETDEEEGDDDEPDDETDDDDDDHKRGCKKRKKKTK 339

[34][TOP]
>UniRef100_A7TDP3 Putative uncharacterized protein n=1 Tax=Vanderwaltozyma polyspora
           DSM 70294 RepID=A7TDP3_VANPO
          Length = 624

 Score = 74.3 bits (181), Expect = 8e-12
 Identities = 58/153 (37%), Positives = 76/153 (49%)
 Frame = -1

Query: 622 DSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAE 443
           DS  + +  D+ D+E      DD DD+  +E+  EYD DD D    EDDE    D  D E
Sbjct: 221 DSKCDDDDDDDDDDE------DDEDDDEDDEDDDEYDEDDEDDEDDEDDE----DDEDDE 270

Query: 442 MDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEEYKH 263
            D D D D  DDEDD + DDD      DDD D D+G   KKKK  RK      +L+E K+
Sbjct: 271 DDED-DEDDEDDEDDEDDDDDD-----DDDGDDDEGDYYKKKKSSRK------ALDESKY 318

Query: 262 LIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
                 K+  + +  + S+  + KKK   K SE
Sbjct: 319 ------KKKGRNQEISNSKFDRLKKKITKKTSE 345

[35][TOP]
>UniRef100_B3L0W6 MAK16-related protein, putative n=1 Tax=Plasmodium knowlesi strain
           H RepID=B3L0W6_PLAKH
          Length = 386

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 57/156 (36%), Positives = 81/156 (51%), Gaps = 10/156 (6%)
 Frame = -1

Query: 619 SDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDL----DGVAGEDDEELVADVS 452
           SD E E  +E + EE E   DD D++  E++G ++D DD     D    EDD+E   D+ 
Sbjct: 227 SDEEGEE-EEEEEEEAEEAEDDEDNDDDEDDGDDHDDDDEGSGDDEDEEEDDDEDEDDLE 285

Query: 451 DAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKR---KSPFAS 281
           D E D D D D  D+E+D   +D+  GD  +DD     GR  KKK++  K         +
Sbjct: 286 DEEEDDDED-DYDDEEEDEEEEDEEEGDVDEDDE--PRGRKTKKKQKFAKEYVDGEHIRT 342

Query: 280 LEEYKHLIDQDEKED---SKTKRKATSEPTKKKKKK 182
           L+E   L D+DE E+   + TK++ T    KK KKK
Sbjct: 343 LQEEGKLFDEDEVEEFDGNFTKKRNTKAGGKKDKKK 378

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 43/150 (28%), Positives = 77/150 (51%), Gaps = 10/150 (6%)
 Frame = -1

Query: 592 ESDNEEIENMLDDVDD----------NAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAE 443
           ++ + E+  + D+V+D            VE+E  + +Y D +G   E++EE   +  +AE
Sbjct: 189 KNKDSELAKLFDEVEDAQDMKMKKKKKKVEQEEEKDEYSDEEGEEEEEEEE---EAEEAE 245

Query: 442 MDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEEYKH 263
            D D D D  DD DD++ DD+G+GD  D++ D D+     + +E+   +  +   EE   
Sbjct: 246 DDEDNDDDE-DDGDDHDDDDEGSGDDEDEEEDDDEDEDDLEDEEEDDDEDDYDDEEE--- 301

Query: 262 LIDQDEKEDSKTKRKATSEPTKKKKKKKSK 173
             D++E+++ +       EP  +K KKK K
Sbjct: 302 --DEEEEDEEEGDVDEDDEPRGRKTKKKQK 329

[36][TOP]
>UniRef100_A3Q6P1 AAA ATPase containing von Willebrand factor type A (VWA)
           domain-like n=1 Tax=Mycobacterium sp. JLS
           RepID=A3Q6P1_MYCSJ
          Length = 360

 Score = 73.2 bits (178), Expect = 2e-11
 Identities = 43/167 (25%), Positives = 88/167 (52%), Gaps = 9/167 (5%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  ++ D D + +  D+ D+++ ++  DD DD+  +++  + D DD D    +DD++   
Sbjct: 191 DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD 250

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD---------GRSKKKKKEK 308
           D  D + D D D D  DD+DD++ DDD   D  DDD D DD             +++ ++
Sbjct: 251 DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDFAIQGQIEENADAERQFQE 310

Query: 307 RKRKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKAS 167
            +R+   A+ +E +   +Q+E E  + +++A  +  +++ ++   A+
Sbjct: 311 EQREQQEAAQQEAEQQREQEEAEQQREQQEAEQQREQQEAERDQTAT 357

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 33/87 (37%), Positives = 51/87 (58%)
 Frame = -1

Query: 598 GDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAEMDTDMDMD 419
           GD+ D+++ ++  DD DD+  +++  + D DD D    +DD++   D  D + D D D D
Sbjct: 182 GDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD---DDDDDDDDDDDDDD 238

Query: 418 LIDDEDDNNVDDDGTGDGGDDDSDGDD 338
             DD+DD++ DDD   D  DDD D DD
Sbjct: 239 DDDDDDDDDDDDDDDDDDDDDDDDDDD 265

[37][TOP]
>UniRef100_Q4XGP3 Pc-fam-3 protein putative (Fragment) n=1 Tax=Plasmodium chabaudi
           RepID=Q4XGP3_PLACH
          Length = 160

 Score = 73.2 bits (178), Expect = 2e-11
 Identities = 38/115 (33%), Positives = 47/115 (40%), Gaps = 5/115 (4%)
 Frame = +1

Query: 310 SLSFSSYYDHHHHHYHH----HHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALH 477
           S S   ++DHH HH HH    HHHH  HH    +H HH           LH +H     H
Sbjct: 46  SASSHGHHDHHEHHLHHAHGEHHHHGEHHEHHGHHEHH-----------LHHAHGEHHHH 94

Query: 478 HPRRLLHLDHHSHIHRPLLPQHYH-QHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
                 H  H  H+H      H+H +HH  +    H H HH     HH+    HH
Sbjct: 95  GEHHEHHGHHEHHLHHAHGEHHHHGEHHEHHGHHEH-HLHHAHGEHHHHGEHHHH 148

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 30/95 (31%), Positives = 36/95 (37%), Gaps = 4/95 (4%)
 Frame = +1

Query: 328 YYDHHHHHYHH----HHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLL 495
           ++ HH HH HH    HHHH  HH    +H HH           LH +H     H      
Sbjct: 76  HHGHHEHHLHHAHGEHHHHGEHHEHHGHHEHH-----------LHHAHGEHHHHGEHHEH 124

Query: 496 HLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQ 600
           H  H  H+H      H+H  H       H   HHQ
Sbjct: 125 HGHHEHHLHHAHGEHHHHGEH-----HHHGEHHHQ 154

[38][TOP]
>UniRef100_Q3MJK8 Cement protein 3B variant 2 n=1 Tax=Phragmatopoma californica
           RepID=Q3MJK8_PHRCA
          Length = 306

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 61/136 (44%), Positives = 80/136 (58%), Gaps = 1/136 (0%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS+SS S    YSS  ++    +  S   +    SS S SSS  S   SSS+  SS SS 
Sbjct: 139 SSYSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSS 198

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALS-STSSSIFSISSLSLS 593
            S S S S S+S  S++SSSSSS ++ S SS SYS  SSS++ S S+SSS +S SS S S
Sbjct: 199 SSSSCSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSS 258

Query: 594 SPASNSTSLS*FSPPS 641
             +S+S+S S +S  S
Sbjct: 259 YSSSSSSSSSSYSSSS 274

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 66/166 (39%), Positives = 88/166 (53%)
 Frame = +3

Query: 144 ATSLASYSDALDFFFFFFFVGSDVAFLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFF 323
           ++S +SYS +     +     S  +      SS+SS S    YSS  ++       S   
Sbjct: 48  SSSSSSYSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSSYSSSSSSS----YSSSSS 103

Query: 324 FLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSR 503
                SS S SSS  S   SSS+  S SSS  S S S S S+S +S +SSSSSS ++ S 
Sbjct: 104 SSSSSSSYSSSSSSSSSYSSSSSSSSYSSSSSSSSSSYSSSSSSSSYSSSSSSSSSSYSS 163

Query: 504 SS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           SS SYS  SSS + SS+SSS +S SS S SS +S+S+S   +S  S
Sbjct: 164 SSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSCSYSSSS 209

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 61/135 (45%), Positives = 77/135 (57%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS+SS S    YSS  ++                SS S SSS  S   SSS+  SSSSS 
Sbjct: 119 SSYSSSSSSSSYSSSSSS----------------SSSSYSSSSSSSSYSSSSS-SSSSSY 161

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S  S++SSSSSS ++ S SS SYS  SSS+   S+SSS +S SS S SS
Sbjct: 162 SSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSCSYSSSSSSYSSSSSSSSS 221

Query: 597 PASNSTSLS*FSPPS 641
            +S+S+S S +S  S
Sbjct: 222 YSSSSSSSSSYSSSS 236

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 59/137 (43%), Positives = 77/137 (56%), Gaps = 3/137 (2%)
 Frame = +3

Query: 240 SFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIR 419
           S SS+S     SS  ++       S+       S  S SSS  S   SSS+  SSSSS  
Sbjct: 29  SSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSS 88

Query: 420 SMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTAL---SSTSSSIFSISSLSL 590
           S S S S S S +S++SSSSSS ++ S SS SYS  SSS++    SS+SSS +S SS S 
Sbjct: 89  SYSSSSSSSYSSSSSSSSSSSSYSSSSSSSSSYSSSSSSSSYSSSSSSSSSSYSSSSSSS 148

Query: 591 SSPASNSTSLS*FSPPS 641
           S  +S+S+S S +S  S
Sbjct: 149 SYSSSSSSSSSSYSSSS 165

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 52/97 (53%), Positives = 64/97 (65%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS S SSS      SSS+  SSSSS  S S S S S+S +S +SSSSSS ++ S SS 
Sbjct: 27  RYSSSSYSSS-----SSSSSSYSSSSS--SSSSSYSSSSSSSSYSSSSSSSSSSYSSSSS 79

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SYS  SSS++ SS+SSS +S SS S SS +S S+S S
Sbjct: 80  SYSSSSSSSSYSSSSSSSYSSSSSSSSSSSSYSSSSS 116

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 59/137 (43%), Positives = 75/137 (54%)
 Frame = +3

Query: 231 FESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSS 410
           + SS SS S     SS  ++       S  +     SS S SSS  S   SSS+  SSSS
Sbjct: 81  YSSSSSSSSYSSSSSSSYSSSSSSSSSSSSYSSSSSSSSSYSSSSSSSSYSSSSS-SSSS 139

Query: 411 SIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSL 590
           S  S S S S S+S +S++SS SSS ++ S SS SYS  SSS++  S+SSS  S  S S 
Sbjct: 140 SYSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSS 199

Query: 591 SSPASNSTSLS*FSPPS 641
           SS  S S+S S +S  S
Sbjct: 200 SSSCSYSSSSSSYSSSS 216

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 60/160 (37%), Positives = 82/160 (51%)
 Frame = +3

Query: 144 ATSLASYSDALDFFFFFFFVGSDVAFLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFF 323
           ++S +SYS +     +     S  +      SS+SS S     SS  ++       S   
Sbjct: 135 SSSSSSYSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSS 194

Query: 324 FLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSR 503
           +    SS    SS  S   SSS+  SS SS  S S S S S+S +S++ SSSSS  + S 
Sbjct: 195 YSSSSSSSCSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSS 254

Query: 504 SS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SS SYS  SSS++ S +SSS  S SS S SS +S+S+S S
Sbjct: 255 SSSSYSSSSSSSSSSYSSSSSSSSSSYSSSSSSSSSSSYS 294

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 51/95 (53%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSS  ++ S SS SY
Sbjct: 213 SSSSSSSSSYSSSSSSSSSYSSSSS--SSSSSYSSSSSSYSSSSSSSSYSSSSSSSSSSY 270

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 271 SSSSSSSS-SSYSSSSSSSSSSSYSSSSSSSSSYS 304

[39][TOP]
>UniRef100_C2REL8 Putative uncharacterized protein n=1 Tax=Bacillus cereus m1550
           RepID=C2REL8_BACCE
          Length = 323

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 42/129 (32%), Positives = 51/129 (39%), Gaps = 23/129 (17%)
 Frame = +1

Query: 319 FSSYYDHHHHHYHH----HHHHQ-------YHHHQRCYHLHHQSGPCPCLCPSLHRSHQP 465
           F   + HHHH  HH    HHHHQ       +HHHQ  +  HH  G         H  HQ 
Sbjct: 128 FYGQHGHHHHQGHHGHHGHHHHQGQHDHHGHHHHQGQHGHHHHQGQ--------HGHHQQ 179

Query: 466 RALHHPRRLLH------------LDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRI 609
           +  HH    +H             DHH H H     QH H HH  +      H HHQ ++
Sbjct: 180 QVHHHGHHHIHPQAVLYQTHQGQHDHHGHHHHQ--GQHGHHHHQGHHGH---HGHHQQQV 234

Query: 610 QHHYRSFLH 636
            HH    +H
Sbjct: 235 HHHGHHHIH 243

[40][TOP]
>UniRef100_UPI00016E1500 UPI00016E1500 related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E1500
          Length = 895

 Score = 72.4 bits (176), Expect = 3e-11
 Identities = 61/132 (46%), Positives = 76/132 (57%)
 Frame = +3

Query: 228  VFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSS 407
            +  SS SS SI    SS  ++       S        SS S SSS  S   SSS+  SSS
Sbjct: 642  ISSSSSSSSSISSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 701

Query: 408  SSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLS 587
            SSI S S S S S+S +S++SSSSSS ++ S SS S S  SSST+ SS+SSS  S S  S
Sbjct: 702  SSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSS 761

Query: 588  LSSPASNSTSLS 623
             SS +S+S+S S
Sbjct: 762  SSSSSSSSSSSS 773

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+ +SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 633 SSSSSSSSSISSSSSSSSSISSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 692

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 693 SSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSS 727

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 50/95 (52%), Positives = 67/95 (70%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS++ SSSSS  S+S S S ++S +S++SSSSSS ++ S SS S 
Sbjct: 624 SSNSCSSSSSSSSSSSSSISSSSSSSSSISSSSSSNSSSSSSSSSSSSSSSSSSSSS-SS 682

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS+S SS +S+S+S S
Sbjct: 683 SSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSS 717

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 53/101 (52%), Positives = 67/101 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+ +SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 685 SSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS-SS 743

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+SSS  S SS S SS +S+S+S S  S  S
Sbjct: 744 STSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSISSSS 784

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S+SSS  S   SSS+  SSSSSI S S S S  +S +S+ SSSSSS ++ S SS S 
Sbjct: 617 SSSSISSSSNSCSSSSSSSSSSSSSISSSSSSSSSISSSSSSNSSSSSSSSSSSSSSSSS 676

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 677 SSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSS 711

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 50/95 (52%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+++SSSSS ++ S SS S 
Sbjct: 702 SSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSS 761

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  SISS S SS +++S+S S
Sbjct: 762 SSSSSSSSSSSSSSSSSSISSSSSSSSSNSSSSSS 796

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 50/95 (52%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S ++++SSSSSS ++ S SS S 
Sbjct: 705 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSS 764

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSSI S SS S S+ +S+S+S S
Sbjct: 765 SSSSSSSSSSSSSSSISSSSSSSSSNSSSSSSSSS 799

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 58/129 (44%), Positives = 74/129 (57%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S  C  SS  ++                SS S SSS  S + SSS+  SSSSS 
Sbjct: 619 SSISSSSNSCSSSSSSSSSS-------------SSSISSSSSSSSSISSSSSSNSSSSSS 665

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++SSSSSS ++ S SS S S  S S++ SS+SSS  S SS S SS
Sbjct: 666 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSS 725

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 726 SSSSSSSSS 734

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 53/101 (52%), Positives = 65/101 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S + SSS   SSSSS  S S S SIS+S +S++S SSSS +  S SS S 
Sbjct: 609 SSSSSSSSSSSSISSSSNSCSSSSSSSSSSSS-SISSSSSSSSSISSSSSSNSSSSSSSS 667

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+SSS  S SS S SS +S+S+S S  S  S
Sbjct: 668 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSS 708

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSS+  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 721  SSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSI 780

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 781  SSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSS 815

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 691 SSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSS 750

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S S+S S
Sbjct: 751 SSSSSSSSCSSSSSSSSSSSSSSSSSSSSISSSSS 785

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S + SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ + SS S 
Sbjct: 692 SSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSS 751

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS + +S+S S
Sbjct: 752 SSSSSSSCSSSSSSSSSSSSSSSSSSSSISSSSSS 786

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SSSSSS  + S SS S 
Sbjct: 709 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSS 768

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 769 SSSSSSSSSSSISSSSSSSSSNSSSSSSSSSSSSS 803

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S + S+S +S++SSSS S ++ S SS S 
Sbjct: 712 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSS 771

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+++SS+SSS  S SS S SS +S+S+S S
Sbjct: 772 SSSSSSSSISSSSSSSSSNSSSSSSSSSSSSSSSS 806

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 51/95 (53%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 693 SSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSS 752

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS  S+S+S S
Sbjct: 753 SSSSSSCSSSSSSSSSSSSSSSSSSSSISSSSSSS 787

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S+SSS  S   SSS+  SSSSS  S S S S S+S +S++SS+SSS ++ S SS S 
Sbjct: 700 SSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSC 759

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS+S SS +S+S S S
Sbjct: 760 SSSSSSSS-SSSSSSSSSSSSISSSSSSSSSNSSS 793

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 49/101 (48%), Positives = 65/101 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S S S   S+S +S++SSSSSS ++ S SS S 
Sbjct: 726  SSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSISSSSS 785

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S  S+S++ SS+SSS  S SS S SS +S+S+S+     P+
Sbjct: 786  SSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSIDTIKAPA 826

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SS+SS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 723  SSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSISS 782

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 783  SSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 817

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS++ SSS+S  S S S S S+S  S++SSSSSS ++ S S+ S 
Sbjct: 603 NSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSSSSSISSSSSSNSSS 662

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 663 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 697

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 707 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSS 766

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S S  S SS S SS +S+S+S S
Sbjct: 767 SSSSSSSSSSSSSISSSSSSSSSNSSSSSSSSSSS 801

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S S S S S+S + ++SSSSSS ++ S SS S 
Sbjct: 719  SSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSS 778

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 779  SISSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 813

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS      SSS+  SSSSS  S S S S S+S +S++SSSSSS +T S SS S 
Sbjct: 694 SSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSS 753

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS ++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 754 SSSSSCSSSSSSSSSSSSSSSSSSSSISSSSSSSS 788

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  + S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 718  SSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSSS 777

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS++SS  S SS S SS +S+S+S S
Sbjct: 778  SSISSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSS 812

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSSS ++ S SS S 
Sbjct: 720  SSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSS 779

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
               SSS++ S++SSS  S SS S SS +S+S+S S
Sbjct: 780  ISSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 814

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S + S S+S +S++SS SSS ++ S SS S 
Sbjct: 714 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSS 773

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 774 SSSSSSISSSSSSSSSNSSSSSSSSSSSSSSSSSS 808

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 717  SSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSS 776

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S   SS++ SS+S+S  S SS S SS +S+S+S S
Sbjct: 777  SSSISSSSSSSSSNSSSSSSSSSSSSSSSSSSSSS 811

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S SSSS ++ S SS S 
Sbjct: 715 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSS 774

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS ++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 775 SSSSSISSSSSSSSSNSSSSSSSSSSSSSSSSSSS 809

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SS+SS  S + S S S+S +S++SSSS S ++ S SS S 
Sbjct: 574 SSNNSSSSSSSSSSSSSSSSSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSS 633

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+++SS+SSS  SISS S S+ +S+S+S S
Sbjct: 634 SSSSSSSSISSSSSSSSSISSSSSSNSSSSSSSSS 668

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  S SSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 600 SSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSSSSSISSSSSSN 659

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 660 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 694

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 51/97 (52%), Positives = 64/97 (65%), Gaps = 2/97 (2%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 695 SSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSS 754

Query: 519 SPP--SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S    SSS++ SS+SSS  S SS S+SS +S+S+S S
Sbjct: 755 SSSSCSSSSSSSSSSSSSSSSSSSSISSSSSSSSSNS 791

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S+S++S+++S SSS ++ S SS S 
Sbjct: 583 SSSSSSSSSSSSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSI 642

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S SS S SS +S+S+S S
Sbjct: 643 SSSSSSSSSISSSSSSNSSSSSSSSSSSSSSSSSS 677

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  +   SSS+  SSSSS  S+S S +  +S +S++SSSSSS ++ S SS S 
Sbjct: 593 SSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSSSSSI 652

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 653 SSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSS 687

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           ++ S SSS  S   SSS+ +SSSS+  S S S S S+S + ++SSSSSS  + S SS S 
Sbjct: 602 NNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSSSSSISSSSSSNSS 661

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 662 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 696

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SS+S   S S S S S+S++S++SSSSS  ++ S +S S 
Sbjct: 604 SSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSSSSSISSSSSSNSSSS 663

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 664 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 698

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS   SSS  S   SSS+  SSSSS  S S S S S+S +S++S+SSSS ++ S SS   
Sbjct: 701 SSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCS 760

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S  S S SS +SNS+S S
Sbjct: 761 SSSSSSSSSSSSSSSSSSSISSSSSSSSSNSSSSS 795

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSS+S  S S S S S+  +S++SSSSSS ++ S SS   
Sbjct: 722  SSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSIS 781

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 782  SSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 816

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  S+SSS  S S S S  +S +S++SSSSSS ++ S S  S 
Sbjct: 724  SSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSISSS 783

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 784  SSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSS 818

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  S S S S S+S +S++S SSSS +  S SS S 
Sbjct: 577 NSSSSSSSSSSSSSSSSSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSS 636

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS ++ SS+SSSI S SS + SS +S+S+S S
Sbjct: 637 SSSSSISSSSSSSSSISSSSSSNSSSSSSSSSSSS 671

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  SSSSS  S S+S S ++  +S++SSSSSS +  S SS S 
Sbjct: 591 SSSSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSSSS 650

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 651 SISSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 685

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S + S S S+S +S++ SSSSS ++ S SS S 
Sbjct: 716  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSS 775

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S S++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 776  SSSSISSSSSSSSSNSSSSSSSSSSSSSSSSSSSS 810

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 49/95 (51%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S S S S +S + SSSSS ++ S SS S 
Sbjct: 585 SSSSSSSSSSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISS 644

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SS+  S SS S SS +S+S+S S
Sbjct: 645 SSSSSSSISSSSSSNSSSSSSSSSSSSSSSSSSSS 679

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S S++  S   SSS+  SSSSSI S S S S S+S +S++SSS SS ++ S S  S 
Sbjct: 596 NSSSSSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSSSSSISSS 655

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 656 SSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 690

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 48/100 (48%), Positives = 61/100 (61%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   S+S+  SSSSS  S   S S S+S +S++SSSSSS  + S SS S 
Sbjct: 730  SSSSSSSSSSSSSSSTSSSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSISSSSSSSSS 789

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPP 638
            +  SSS++ SS+SSS  S SS S SS +S  T  +   PP
Sbjct: 790  NSSSSSSSSSSSSSSSSSSSSSSSSSSSSIDTIKAPARPP 829

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 45/96 (46%), Positives = 64/96 (66%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PS  + SS+  S   SSS+  SSSSS  + S S + S+S +S++SSSSSS ++ S SS S
Sbjct: 568 PSRGNSSSNNSSSSSSSSSSSSSSSSSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSNS 627

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+S S  S SS S+SS +S+++S S
Sbjct: 628 CSSSSSSSSSSSSSISSSSSSSSSISSSSSSNSSSS 663

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS  S S   S S S +S++SSSSSS ++ S SS S 
Sbjct: 590 SSSSSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSSS 649

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 650 SSISSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSS 684

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   +SS+  SSSSS  S S S+S S++  S++SSSSSS ++   SS S 
Sbjct: 589 SSSSSSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSS 648

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ S++SSS  S SS S SS +S+S+S S
Sbjct: 649 SSSISSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 683

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 48/95 (50%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S   S S S S +S++SSSSSS  + S SS S 
Sbjct: 592 SSSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSSSSS 651

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 652 ISSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 686

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 44/94 (46%), Positives = 61/94 (64%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           +PS  +S  +   SSS+  SSSSS  S S S S S + +S++SSSSSS ++ S  S S +
Sbjct: 567 APSRGNSSSNNSSSSSSSSSSSSSSSSSSNSSSSSNNSSSSSSSSSSSSSSSSSISSSSN 626

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 627 SCSSSSSSSSSSSSSISSSSSSSSSISSSSSSNS 660

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 45/104 (43%), Positives = 62/104 (59%), Gaps = 8/104 (7%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS S +S P    P  +    +SSS  S S S S S+S +S++SS+SSS +  S SS S
Sbjct: 551 PSSSS-TSEPTGEEPQRAPSRGNSSSNNSSSSSSSSSSSSSSSSSSNSSSSSNNSSSSSS 609

Query: 516 YSPPSSSTALS--------STSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ S        S+SSS  S SS S+SS +S+S+S+S
Sbjct: 610 SSSSSSSSSSSISSSSNSCSSSSSSSSSSSSSISSSSSSSSSIS 653

[41][TOP]
>UniRef100_B3NB27 GG10803 n=1 Tax=Drosophila erecta RepID=B3NB27_DROER
          Length = 2281

 Score = 72.4 bits (176), Expect = 3e-11
 Identities = 53/173 (30%), Positives = 80/173 (46%), Gaps = 14/173 (8%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENML----DDVDDNAVEEEGGEYDYDDLDGVAG---E 482
            +G E+ D D   + GD+ D+EE +N      DD DDN  ++E G+ D D+ D   G   E
Sbjct: 1091 NGDEDDDEDNNEDNGDDEDDEEGDNNGNDEDDDEDDNNDDDENGDDDDDENDEENGDDDE 1150

Query: 481  DDEELVADVSDAEMDTDMDMD-------LIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKK 323
            DDEE   +  D E D D D D         DDE+DNN +DD   +  +D+ D +D   + 
Sbjct: 1151 DDEENNEEDEDEEEDNDDDEDDGDGDNEEEDDEEDNNDEDDEEDNNDEDEDDEEDNDDED 1210

Query: 322  KKKEKRKRKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
            +  E+   +      EE  +  D D++ED+        E   K    + +  E
Sbjct: 1211 EDDEENNNEDD----EEDNNEDDDDDEEDNNEDEDDDEEDNNKDDNDEDENDE 1259

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 46/166 (27%), Positives = 77/166 (46%), Gaps = 7/166 (4%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D  EN + + + +  DE +NEE E+  +D DD+  + +G   + DD +    EDDEE   
Sbjct: 1137 DDDENDEENGDDDEDDEENNEEDEDEEEDNDDDEDDGDGDNEEEDDEEDNNDEDDEEDNN 1196

Query: 460  DV-------SDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRK 302
            D        +D E + D + +  DDE+DNN DDD   +  ++D D D+  + K   ++ +
Sbjct: 1197 DEDEDDEEDNDDEDEDDEENNNEDDEEDNNEDDDDDEEDNNEDEDDDEEDNNKDDNDEDE 1256

Query: 301  RKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
                    E+     + DE ED     K  +E   + +    K +E
Sbjct: 1257 NDEENDEDEDDNDEDEDDEDEDENDDNKTDTEDEDEDEDGDDKDAE 1302

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 50/168 (29%), Positives = 76/168 (45%), Gaps = 9/168 (5%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGD----ESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGE--- 482
            D  E  D+D + + GD    E D+EE  N  DD +DN  E+E  E D DD D    E   
Sbjct: 1159 DEDEEEDNDDDEDDGDGDNEEEDDEEDNNDEDDEEDNNDEDEDDEEDNDDEDEDDEENNN 1218

Query: 481  --DDEELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEK 308
              D+E+   D  D E D + D D  D+ED+N  D+D   +  ++D D DD    +  +++
Sbjct: 1219 EDDEEDNNEDDDDDEEDNNEDED-DDEEDNNKDDNDEDENDEENDEDEDDNDEDEDDEDE 1277

Query: 307  RKRKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
             +        E      D+DE ED   K    ++ T +   +  +  E
Sbjct: 1278 DENDDNKTDTE------DEDEDEDGDDKDAEDTDATGEDDNENDEEEE 1319

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 42/136 (30%), Positives = 62/136 (45%), Gaps = 4/136 (2%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVD--DNAVEEEGGEYDYDDLDGVAGEDDEEL 467
            D  +N D D + E  +  D+EE  N  DD D  DN  +E+  E D +  D    E+DEE 
Sbjct: 1202 DEEDNDDEDEDDEENNNEDDEEDNNEDDDDDEEDNNEDEDDDEEDNNKDDNDEDENDEEN 1261

Query: 466  VADVSDAEMDTDMDMDLIDDEDDNNVD--DDGTGDGGDDDSDGDDGRSKKKKKEKRKRKS 293
              D  D + D D + +  D+ DDN  D  D+   + GDD    D   + +   E  + + 
Sbjct: 1262 DEDEDDNDEDEDDEDE--DENDDNKTDTEDEDEDEDGDDKDAEDTDATGEDDNENDEEEE 1319

Query: 292  PFASLEEYKHLIDQDE 245
               S  +Y+H    DE
Sbjct: 1320 DIKSKPKYRHTAKDDE 1335

[42][TOP]
>UniRef100_UPI0000141A8E tetra-peptide repeat homeobox-like (TPRXL) on chromosome 3 n=1
           Tax=Homo sapiens RepID=UPI0000141A8E
          Length = 252

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 53/101 (52%), Positives = 64/101 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS  SP  SSS+  SS SS  S S S S S S +S++SSSS S ++ S SS S 
Sbjct: 81  SSPSSSSSTSSPSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSS 140

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SS ++ SS+ SS  S SS S SSP+S+S S S  SP S
Sbjct: 141 SSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSS 181

 Score = 70.1 bits (170), Expect = 2e-10
 Identities = 53/96 (55%), Positives = 65/96 (67%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS S SSS  S  PSSS+  SS SS  S S S S  +S  S++SSSSSSP++ S SS S
Sbjct: 69  PSSSSPSSSHSSSSPSSSSSTSSPSS--SSSSSSSSPSSSNSSSSSSSSSPSSSSSSS-S 125

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            SP SSS++ SS+SSS  S  S S SSP+S+S+S S
Sbjct: 126 SSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSS 161

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 52/101 (51%), Positives = 63/101 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS PS   SSS+  SSS S  S S S S S+S +S +SSSSSS ++PS SS S 
Sbjct: 94  SSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSP 153

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+S S  S SS   S  +SNS+  S  S PS
Sbjct: 154 SSSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSPSSSSSSPS 194

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 53/102 (51%), Positives = 65/102 (63%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS   SSSP S   +SS   SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S
Sbjct: 74  PSSSHSSSSPSSSSSTSSPSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSS-SPSSSS 132

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            SP SSS++ SS+ SS  S  S S SS +S+S+S S  SP S
Sbjct: 133 SSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSS 174

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/93 (53%), Positives = 61/93 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS PS   SSS+  SSSSS  S S   S  +S +S+ SS SSS ++PS SS S 
Sbjct: 144 SSPSSSSSSPS---SSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSPSSSSSSPSSSSSSP 200

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           SP SSS + SS+S+S  S SS S SSP+S+  S
Sbjct: 201 SPRSSSPSSSSSSTSSPSSSSPSSSSPSSSCPS 233

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 55/107 (51%), Positives = 69/107 (64%), Gaps = 6/107 (5%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLL---SSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS 509
           SSPS SSS  S  PSSS+     SSSSS  S S S S  +S +S++SSSSSSP++ S SS
Sbjct: 115 SSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSS 174

Query: 510 *SYSPPSSSTALSSTSSSIFSISSL---SLSSPASNSTSLS*FSPPS 641
              SP SS+++ SS+SSS  S SS      SSP+S+S+S S  SP S
Sbjct: 175 SGSSPSSSNSSPSSSSSSPSSSSSSPSPRSSSPSSSSSSTS--SPSS 219

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 54/120 (45%), Positives = 69/120 (57%), Gaps = 4/120 (3%)
 Frame = +3

Query: 276 SRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASL 455
           SR ++   R + S         S S SSS PS  PSSS+  SS SS    S S + S S 
Sbjct: 35  SRSSSSSSRSILSSSILSSSIPSSSSSSSSPSSSPSSSSPSSSHSSSSPSSSSSTSSPSS 94

Query: 456 TSATSSSSSSPATPSRSS*SYSPPSSSTAL----SSTSSSIFSISSLSLSSPASNSTSLS 623
           +S++SSSS S +  S SS S SP SSS++     SS+SSS  S SS S SSP+S+S+S S
Sbjct: 95  SSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPS 154

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 3/98 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSS--SSSSPATPSRSS* 512
           SSPS SSS  S  PSSS   SSSSS    S S S S+S +S++SS  SSSS ++ S SS 
Sbjct: 90  SSPSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSS 149

Query: 513 SYSPPSSSTALSSTSSSIFSIS-SLSLSSPASNSTSLS 623
           S SP SSS++ SS+SSS  S S S S SSP+S+++S S
Sbjct: 150 SSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSPS 187

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/102 (49%), Positives = 63/102 (61%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS + SSS  S  PSSS+  SSSS   S S   S S+S +S+ SSSSSSP++ S SS S
Sbjct: 103 PSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSS 162

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S   SS++ SS+ SS  S +S   SS +S S+S S  SP S
Sbjct: 163 SSSSPSSSSPSSSGSSPSSSNSSPSSSSSSPSSSSSSPSPRS 204

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 59/131 (45%), Positives = 78/131 (59%), Gaps = 6/131 (4%)
 Frame = +3

Query: 249 SWSIKCLYSSRLA------NGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSS 410
           S S KC   SR+A      +G  R   S    +L  SS  LSSS    +PSSS+  SS S
Sbjct: 13  SGSTKCRCGSRIAGPNALGSGGSRSSSSSSRSIL--SSSILSSS----IPSSSSSSSSPS 66

Query: 411 SIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSL 590
           S  S S   S  +S + ++SSS+SSP++ S SS S SP SS+++ SS+SSS  S SS S 
Sbjct: 67  SSPSSSSPSSSHSSSSPSSSSSTSSPSSSSSSS-SSSPSSSNSSSSSSSSSPSSSSSSSS 125

Query: 591 SSPASNSTSLS 623
           SSP+S+S+S S
Sbjct: 126 SSPSSSSSSPS 136

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 55/106 (51%), Positives = 66/106 (62%), Gaps = 5/106 (4%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLL-SSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRS--- 506
           SSPS SSS PS   SSS+   SSSSS  S S S S S+S + ++SS SSS ++PS S   
Sbjct: 126 SSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSNSS 185

Query: 507 -S*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S S S PSSS++  S  SS  S SS S SSP+S+S S S  SP S
Sbjct: 186 PSSSSSSPSSSSSSPSPRSSSPSSSSSSTSSPSSSSPSSS--SPSS 229

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +3

Query: 399 SSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSS-TALSSTSSSIFSI 575
           SSSSS RS+  S  +S+S+ S++SSSSS  ++PS SS S S  SSS ++ SSTSS   S 
Sbjct: 37  SSSSSSRSILSSSILSSSIPSSSSSSSSPSSSPSSSSPSSSHSSSSPSSSSSTSSPSSSS 96

Query: 576 SSLSLSSPASNSTSLS*FSPPS 641
           SS S S  +SNS+S S  S PS
Sbjct: 97  SSSSSSPSSSNSSSSSSSSSPS 118

[43][TOP]
>UniRef100_B7H796 VrrB n=1 Tax=Bacillus cereus B4264 RepID=B7H796_BACC4
          Length = 322

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 41/125 (32%), Positives = 51/125 (40%), Gaps = 22/125 (17%)
 Frame = +1

Query: 328 YYDHHHH---HYHHHHHHQ-------YHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALH 477
           ++ HHHH   H HH HHHQ       +HHHQ  +  HH  G         H  HQ +  H
Sbjct: 131 HHGHHHHQGHHGHHGHHHQGQHDHHGHHHHQGQHGHHHHQGQ--------HGHHQQQVHH 182

Query: 478 HPRRLLH------------LDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHY 621
           H    +H             DHH H H     QH H HH  +      H HHQ ++ HH 
Sbjct: 183 HGHHHIHPQAVLYQTHQGQHDHHGHHHHQ--GQHGHHHHQGHHGH---HGHHQQQVHHHG 237

Query: 622 RSFLH 636
              +H
Sbjct: 238 HHHIH 242

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 31/102 (30%), Positives = 40/102 (39%), Gaps = 3/102 (2%)
 Frame = +1

Query: 319 FSSYYDHHHHHYHHHHHHQY-HHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLL 495
           + ++   H HH HHHH  Q+ HHH + +H HH               H  + +HH     
Sbjct: 195 YQTHQGQHDHHGHHHHQGQHGHHHHQGHHGHH--------------GHHQQQVHH----- 235

Query: 496 HLDHHSHIHRPLLPQH--YHQHHPAYSQSPHCHSHHQPRIQH 615
           H  HH H    L   H  +H HH       H    HQ   QH
Sbjct: 236 HGHHHIHPQAVLYQTHQGHHGHHGHQGHQGHQGQQHQQHQQH 277

[44][TOP]
>UniRef100_Q9KI89 Putative VrrB (Fragment) n=1 Tax=Bacillus cereus RepID=Q9KI89_BACCE
          Length = 296

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 36/95 (37%), Positives = 42/95 (44%), Gaps = 5/95 (5%)
 Frame = +1

Query: 328 YYDHHHHHYHHHH-----HHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRL 492
           +++HHHHH HHHH     HH +HHHQ     HH  G         H  HQ    HH    
Sbjct: 113 HHEHHHHHGHHHHQGHHGHHGHHHHQGHQGHHHHQG------HHGHHHHQGHQGHHH--- 163

Query: 493 LHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHH 597
            H  HH H        H+HQ H  + Q  H H HH
Sbjct: 164 -HQGHHGH--------HHHQGHQGHQQQVHHHGHH 189

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 39/111 (35%), Positives = 45/111 (40%), Gaps = 17/111 (15%)
 Frame = +1

Query: 337 HHHHHYHH-HHHHQ----YHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHL 501
           HHHH  HH HHHHQ    +HHHQ  +  HH  G         H+ HQ +  HH    +H 
Sbjct: 143 HHHHQGHHGHHHHQGHQGHHHHQGHHGHHHHQG---------HQGHQQQVHHHGHHHIHP 193

Query: 502 D------------HHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHH 618
                        HH H H+     H   HH    Q  H H  HQ   QHH
Sbjct: 194 QAVLYQTYQGQHGHHGHHHQGQYHGHQGHHHHQGHQGQHGHHGHQG--QHH 242

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 35/102 (34%), Positives = 42/102 (41%), Gaps = 2/102 (1%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSH 516
           H HHH+H HHHHQ HH    +H HHQ           H+ H     HH     H  HH H
Sbjct: 114 HEHHHHHGHHHHQGHHGHHGHH-HHQG----------HQGH-----HH-----HQGHHGH 152

Query: 517 IHRPLLPQHYHQHHPAYSQSPHCHSH--HQPRIQHHYRSFLH 636
            H        H HH  +    H   H  HQ ++ HH    +H
Sbjct: 153 HHHQ--GHQGHHHHQGHHGHHHHQGHQGHQQQVHHHGHHHIH 192

[45][TOP]
>UniRef100_UPI00004E770F PREDICTED: similar to TPRXL protein n=1 Tax=Pan troglodytes
           RepID=UPI00004E770F
          Length = 215

 Score = 71.6 bits (174), Expect = 5e-11
 Identities = 56/104 (53%), Positives = 68/104 (65%), Gaps = 2/104 (1%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSI--SASLTSATSSSSSSPATPSRSS 509
           PSS S SSSP S  PSSS+  SS SS  S S S     S+S +S++SSSSSSP++ S SS
Sbjct: 70  PSSSSSSSSPSSSSPSSSSSSSSPSSSSSSSSSPRSGNSSSSSSSSSSSSSSPSSSSPSS 129

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S S  SSS+  SS+SSS  S SS S SSP+S+ +S S  S PS
Sbjct: 130 -SSSSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSSSPS 172

 Score = 71.6 bits (174), Expect = 5e-11
 Identities = 56/102 (54%), Positives = 69/102 (67%), Gaps = 1/102 (0%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS  SP  SS    SSSSS RS + S S S+S +S++S SSSSP++ S SS S 
Sbjct: 82  SSPSSSSSSSSPSSSS----SSSSSPRSGNSSSSSSSSSSSSSSPSSSSPSSSSSSSSSS 137

Query: 519 SPPSSSTALSSTSSSIFSIS-SLSLSSPASNSTSLS*FSPPS 641
           SP SSS++ SS+SSS  S S S S SSP+S+S+  S  S PS
Sbjct: 138 SPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSSSPSSSSSSPS 179

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 59/108 (54%), Positives = 68/108 (62%), Gaps = 6/108 (5%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPV----PSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSR 503
           PSS S SSSP S      PSSS+  SSSSS  S S S S S+S  S  SSSSSS ++ S 
Sbjct: 61  PSSSSSSSSPSSSSSSSSPSSSSP-SSSSSSSSPSSSSSSSSSPRSGNSSSSSSSSSSSS 119

Query: 504 SS*SYSPPSSSTALSSTS--SSIFSISSLSLSSPASNSTSLS*FSPPS 641
           SS S S PSSS++ SS+S  SS  S SS S SSP+S+S S S  SP S
Sbjct: 120 SSPSSSSPSSSSSSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSS 167

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 53/106 (50%), Positives = 65/106 (61%), Gaps = 3/106 (2%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSS---SSSIRSMSMSVSISASLTSATSSSSSSPATPSR 503
           R SS S  S   S + SSS L SS   SSS  S   S S S+S +S++ SSSSS ++PS 
Sbjct: 36  RSSSSSSRSILSSSILSSSILSSSIPSSSSSSSSPSSSSSSSSPSSSSPSSSSSSSSPSS 95

Query: 504 SS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           SS S S P S  + SS+SSS  S SS S SSP+S+S+S S  SP S
Sbjct: 96  SSSSSSSPRSGNSSSSSSSSSSSSSSPSSSSPSSSSSSSSSSSPSS 141

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 51/102 (50%), Positives = 63/102 (61%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS S SSS P    SSS+  SSSSS  S S S S  +S +S++SSSS S ++ S SS S
Sbjct: 93  PSSSSSSSSSPRSGNSSSS--SSSSSSSSSSPSSSSPSSSSSSSSSSSPSSSSSSSSSSS 150

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            SP SSS + S +S S  S  S S SSP+ +S+S S  SP S
Sbjct: 151 SSPSSSSPSSSGSSPSSSSSPSSSSSSPSPSSSSPSSSSPSS 192

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 64/142 (45%), Positives = 79/142 (55%), Gaps = 11/142 (7%)
 Frame = +3

Query: 249 SWSIKCLYSSRLA------NGDFRFLFSFFFFLLRPS---SPSLSSSPPSPVPSSS--TL 395
           S S KC   SR+A      +G  R   S    +L  S   S  LSSS PS   SSS  + 
Sbjct: 13  SGSTKCRCGSRIAGPNALGSGGSRSSSSSSRSILSSSILSSSILSSSIPSSSSSSSSPSS 72

Query: 396 LSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSI 575
            SSSSS  S S S S S+S  S++SSSSSSP + + SS S S  SSS++ SS+S S  S 
Sbjct: 73  SSSSSSPSSSSPSSSSSSSSPSSSSSSSSSPRSGNSSSSSSSSSSSSSSPSSSSPSSSSS 132

Query: 576 SSLSLSSPASNSTSLS*FSPPS 641
           SS S S  +S+S+S S  S PS
Sbjct: 133 SSSSSSPSSSSSSSSSSSSSPS 154

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/94 (50%), Positives = 59/94 (62%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           P S + SSS  S   SSS+  SSS S  S S S S  +S +S++SSSSSSP++ S SS  
Sbjct: 103 PRSGNSSSSSSSSSSSSSSPSSSSPSSSSSSSSSSSPSSSSSSSSSSSSSPSSSSPSSSG 162

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            SP SSS+  SS+SS   S SS S SSP+S+  S
Sbjct: 163 SSPSSSSSPSSSSSSPSPSSSSPSSSSPSSSRPS 196

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 46/89 (51%), Positives = 57/89 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S  PSSS+  SSSSS  S S S S S+S +S++S SSSSP++   S  S 
Sbjct: 109 SSSSSSSSSSSSSPSSSSPSSSSSSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSS 168

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
           S PSSS++  S SSS  S SS S S P++
Sbjct: 169 SSPSSSSSSPSPSSSSPSSSSPSSSRPSA 197

[46][TOP]
>UniRef100_B9QPF4 DNA mismatch repair protein, putative n=1 Tax=Toxoplasma gondii VEG
           RepID=B9QPF4_TOXGO
          Length = 1314

 Score = 71.6 bits (174), Expect = 5e-11
 Identities = 54/98 (55%), Positives = 67/98 (68%), Gaps = 3/98 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPV-PSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           SSPS SSSP S   PSSS+  SSSSS  S S S S S+  +S++ SSSSSP++ S  S S
Sbjct: 40  SSPSSSSSPSSSSSPSSSSSPSSSSSSSSSSSSPSSSSPSSSSSPSSSSSPSSSSSPSSS 99

Query: 516 YSPPSSSTALSSTS--SSIFSISSLSLSSPASNSTSLS 623
            SP SSS++ SS+S  SS  S SS S SSP+S+S+S S
Sbjct: 100 SSPSSSSSSSSSSSPSSSSSSSSSSSSSSPSSSSSSSS 137

 Score = 71.6 bits (174), Expect = 5e-11
 Identities = 57/106 (53%), Positives = 71/106 (66%), Gaps = 5/106 (4%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATS-SSSSSPATPSRSS*S 515
           SSPS SSSP S   SSS+  S SSS  S S S S S+S +S++S SSSSSP++ S SS S
Sbjct: 52  SSPSSSSSPSSSSSSSSSSSSPSSSSPSSSSSPSSSSSPSSSSSPSSSSSPSSSSSSSSS 111

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPAS----NSTSLS*FSPPS 641
            SP SSS++ SS+SSS  S SS S SS +S    +S+SL+  SP S
Sbjct: 112 SSPSSSSSSSSSSSSSSPSSSSSSSSSSSSSSCTSSSSLASTSPSS 157

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 51/96 (53%), Positives = 62/96 (64%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS S SSS  SP  SSS+  SSSSS  S S S S S+S +S TSSSS +  +PS     
Sbjct: 102 PSSSSSSSSSSSPSSSSSSSSSSSSSSPSSSSSSSSSSSSSSCTSSSSLASTSPS----- 156

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            SP SSS++ SS+SSS  S SSL+ +SP S S+S S
Sbjct: 157 -SPSSSSSSSSSSSSSCTSSSSLASTSPCSPSSSSS 191

 Score = 70.1 bits (170), Expect = 2e-10
 Identities = 56/106 (52%), Positives = 68/106 (64%), Gaps = 4/106 (3%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPV----PSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSR 503
           PSS S SSS  SP     PSSS+  SSSSS  S S S S S+S +S++ SSSSSP++ S 
Sbjct: 30  PSSSSSSSSSSSPSSSSSPSSSSSPSSSSSPSSSSSSSSSSSSPSSSSPSSSSSPSSSSS 89

Query: 504 SS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S S SP SSS+  SS+SSS    SS S SS +S+S+S S  SP S
Sbjct: 90  PSSSSSPSSSSSPSSSSSSS----SSSSPSSSSSSSSSSSSSSPSS 131

 Score = 70.1 bits (170), Expect = 2e-10
 Identities = 52/99 (52%), Positives = 66/99 (66%), Gaps = 4/99 (4%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSSP S  PSSS+  SSSSS  S S   S S+  +S++SSSSSSP++ S SS S 
Sbjct: 65  SSSSSSSSPSSSSPSSSSSPSSSSSPSSSSSPSSSSSPSSSSSSSSSSSPSSSSSSSSSS 124

Query: 519 S----PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S      SSS++ SS+SSS  S SSL+ +SP+S S+S S
Sbjct: 125 SSSSPSSSSSSSSSSSSSSCTSSSSLASTSPSSPSSSSS 163

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 52/96 (54%), Positives = 65/96 (67%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPV-PSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           SSPS SSSP S   PSSS+  SSSSS  S S S S S+  +S++SSSSSS ++PS SS S
Sbjct: 76  SSPSSSSSPSSSSSPSSSSSPSSSSSPSSSSSSSSSSSPSSSSSSSSSSSSSSPSSSSSS 135

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+S +  S SS S SS +S+S+S S
Sbjct: 136 SSSSSSSSCTSSSSLASTSPSSPSSSSSSSSSSSSS 171

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 53/100 (53%), Positives = 64/100 (64%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           SPS SSSP S   SSS+   SSSS  S S S S S+S +S++SSSSSS      SS S S
Sbjct: 23  SPSSSSSPSSSSSSSSSSSPSSSSSPSSSSSPSSSSSPSSSSSSSSSS------SSPSSS 76

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            PSSS++ SS+SS   S S  S SSP+S+S+S S  SP S
Sbjct: 77  SPSSSSSPSSSSSPSSSSSPSSSSSPSSSSSSSSSSSPSS 116

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/96 (52%), Positives = 65/96 (67%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSS-IRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           SSPS SS   S  PSSS+  SSSSS   S S S S S+S +S+ SSSSSS ++ S SS S
Sbjct: 71  SSPSSSSPSSSSSPSSSSSPSSSSSPSSSSSPSSSSSSSSSSSPSSSSSSSSSSSSSSPS 130

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+ +S  S++S S SSP+S+S+S S
Sbjct: 131 SSSSSSSSSSSSSCTSSSSLASTSPSSPSSSSSSSS 166

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSSP S    SS+   SSSS  S S S S S+S +S++SSSS S ++ S SS S 
Sbjct: 82  SSPSSSSSPSSSSSPSSSSSPSSSSSSSSSSSPSSSSSSSSSSSSSSPSSSSSSSSSSSS 141

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++L+STS S  S SS S SS +S+ TS S
Sbjct: 142 SSCTSSSSLASTSPSSPSSSSSSSSSSSSSCTSSS 176

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 56/121 (46%), Positives = 71/121 (58%), Gaps = 20/121 (16%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSS-SIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           SS S SSS PS   SSS+  SSSS S  S S S S S+S TS++S +S+SP++PS SS S
Sbjct: 105 SSSSSSSSSPSSSSSSSSSSSSSSPSSSSSSSSSSSSSSCTSSSSLASTSPSSPSSSSSS 164

Query: 516 -------------------YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPP 638
                               SP SSS++ SS+SSS  S SSL+ +SP S S+SL+  S P
Sbjct: 165 SSSSSSSCTSSSSLASTSPCSPSSSSSSSSSSSSSCTSSSSLASTSPCSPSSSLA--SSP 222

Query: 639 S 641
           S
Sbjct: 223 S 223

[47][TOP]
>UniRef100_B4NHA6 GK14198 n=1 Tax=Drosophila willistoni RepID=B4NHA6_DROWI
          Length = 931

 Score = 71.6 bits (174), Expect = 5e-11
 Identities = 53/185 (28%), Positives = 94/185 (50%), Gaps = 25/185 (13%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEE-------IENMLDDVDDNAVEEEGGEYDYDDLDGVAG 485
           GDG +N++ D     G  +D++E       I +  +D+D + V+ E  E D D  DG A 
Sbjct: 205 GDGKKNHEDDDLDGDGVHNDDDEDLDGDGTINHEDEDLDGDGVKNEKDE-DLDG-DGKAN 262

Query: 484 EDDEELVADVSDAEMDTDMDMDLIDDEDDNNVDDDG------TGDGGDDDSDGDDGRSKK 323
           E+D++L  D    E D+D+D D I +E DN+VD DG      + + GDDD D DD    K
Sbjct: 263 EEDDDLDGDGVPNEKDSDLDGDGILNEHDNDVDGDGVPNEHDSEENGDDDDDDDDEEEVK 322

Query: 322 KKKEKRKRKSPFAS------------LEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKK 179
           K+ ++    +P               +EE + + ++  + +++ + +A +EP    ++++
Sbjct: 323 KRSKREVDAAPVLDVVPPPSPADEFPVEEEEAVKEESVEVEAEPEAEAEAEPEPVAEEEQ 382

Query: 178 SKASE 164
            +A E
Sbjct: 383 PEAEE 387

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 37/112 (33%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = -1

Query: 643 GDGGENY-DSDVEFEAGDESDNEEIEN--MLDDVDDNAVEEEGGEYDYDDLDG--VAGED 479
           GDG +N  D D++ +     ++E+I+    ++  DD+   +    ++ DDLDG  V  E+
Sbjct: 140 GDGVQNSKDEDIDGDGVPNHEDEDIDGDGKVNHEDDDLDGDGTPNHEDDDLDGDGVPNEE 199

Query: 478 DEELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKK 323
           DE+L  D      D D+D D + ++DD ++D DGT +  D+D DGD  +++K
Sbjct: 200 DEDLDGDGKKNHEDDDLDGDGVHNDDDEDLDGDGTINHEDEDLDGDGVKNEK 251

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 51/164 (31%), Positives = 77/164 (46%), Gaps = 7/164 (4%)
 Frame = -1

Query: 643 GDGGENY-DSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDG--VAGEDDE 473
           GDG  N+ D D++   GD   NEE E++  D   N        ++ DDLDG  V  +DDE
Sbjct: 179 GDGTPNHEDDDLD---GDGVPNEEDEDLDGDGKKN--------HEDDDLDGDGVHNDDDE 227

Query: 472 ELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKS 293
           +L  D +    D D+D D + +E D ++D DG  +  DDD DGD         EK     
Sbjct: 228 DLDGDGTINHEDEDLDGDGVKNEKDEDLDGDGKANEEDDDLDGDG-----VPNEKDSDLD 282

Query: 292 PFASLEEYKHLIDQD----EKEDSKTKRKATSEPTKKKKKKKSK 173
               L E+ + +D D    E +  +       +  +++ KK+SK
Sbjct: 283 GDGILNEHDNDVDGDGVPNEHDSEENGDDDDDDDDEEEVKKRSK 326

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 28/85 (32%), Positives = 50/85 (58%)
 Frame = -1

Query: 595 DESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAEMDTDMDMDL 416
           D+ D++E     +D+D + + ++  E D  D DG+  + D+++  D    + D D+D D 
Sbjct: 72  DDDDDDEDAKSANDLDGDGIPDD--EDDDIDGDGIPNDKDDDIDGDGIPNDEDDDIDGDG 129

Query: 415 IDDEDDNNVDDDGTGDGGDDDSDGD 341
           I +EDD+++D DG  +  D+D DGD
Sbjct: 130 IPNEDDDDIDGDGVQNSKDEDIDGD 154

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 30/90 (33%), Positives = 51/90 (56%)
 Frame = -1

Query: 592 ESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAEMDTDMDMDLI 413
           +SD    +N  DD DD+  E+     D D  DG+  ++D+++  D    + D D+D D I
Sbjct: 59  QSDQPRRDNDDDDDDDDDDEDAKSANDLDG-DGIPDDEDDDIDGDGIPNDKDDDIDGDGI 117

Query: 412 DDEDDNNVDDDGTGDGGDDDSDGDDGRSKK 323
            +++D+++D DG  +  DDD DGD  ++ K
Sbjct: 118 PNDEDDDIDGDGIPNEDDDDIDGDGVQNSK 147

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 3/97 (3%)
 Frame = -1

Query: 622 DSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDL---DGVAGEDDEELVADVS 452
           D D +    DE D+ + + + +D DD+ ++ +G   D DD    DG+  EDD+++  D  
Sbjct: 85  DLDGDGIPDDEDDDIDGDGIPNDKDDD-IDGDGIPNDEDDDIDGDGIPNEDDDDIDGDGV 143

Query: 451 DAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGD 341
               D D+D D + + +D ++D DG  +  DDD DGD
Sbjct: 144 QNSKDEDIDGDGVPNHEDEDIDGDGKVNHEDDDLDGD 180

[48][TOP]
>UniRef100_UPI0001926682 PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata
           RepID=UPI0001926682
          Length = 869

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 52/95 (54%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S SIS+S +S++SSSSSS ++ S SS S 
Sbjct: 126 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSS 185

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 220

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 52/95 (54%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSSS ++ S SS S 
Sbjct: 85  SSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSSSS 144

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSSI S SS S SS +S+S+S S
Sbjct: 145 SSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSS 179

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 50/95 (52%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS+  SSSSS  S S S S S+S++S++SSSSSS ++ S SS S 
Sbjct: 122 SNDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSS 181

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 182 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 50/93 (53%), Positives = 63/93 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSSI S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 135 SSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 194

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S SS S SS  S+S++
Sbjct: 195 SSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSN 227

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 50/95 (52%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S+S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 130 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSS 189

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+  S
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSS 224

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 50/95 (52%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S+S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 191

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+ +S S
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSS 226

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 111 SSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSS 170

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 171 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 205

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++S+ SSS ++ S SS S 
Sbjct: 79  SSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSSSSSSS 138

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS+S SS +S+S+S S
Sbjct: 139 SSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSS 173

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS S  S S + S S+S +S++SSSSSS ++ S SS S 
Sbjct: 92  SSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSSSSSSSSSSS 151

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+++SS+SSS  S SS S SS +S+S+S S
Sbjct: 152 SSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSS 186

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S+S S+S +S++SSSSSS ++ S SS S 
Sbjct: 128 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSS-SSSSSSSSSSSSSSSSSSSSS 186

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 221

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S S+  SSSSS RS S S S  +S +S++SSSSSS ++ S SS S 
Sbjct: 89  SSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSSSSSSSS 148

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 149 SSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSS 183

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 106 SSSSSSSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSS 165

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 166 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 200

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/94 (53%), Positives = 62/94 (65%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           S S SSS  S   SSS+  SSSSS  S S S S S S +S++SSSSSS ++ S SS S S
Sbjct: 125 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSS 184

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 185 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 57/129 (44%), Positives = 73/129 (56%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S  C  SS  ++              R SS S S+   S   SSS+  SSSSS 
Sbjct: 95  SSSSSSSSSCSSSSSSSSSS------------RSSSSSSSNDSSSSSSSSSSSSSSSSSS 142

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++ SSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS
Sbjct: 143 SSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 202

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 203 SSSSSSSSS 211

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S  SS  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 119 SSSSNDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSS 178

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 179 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS   SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSSS ++ S SS S 
Sbjct: 121 SSNDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSS 180

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 181 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 193

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + +S+S S
Sbjct: 194 SSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSNS 228

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS   S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 136 SSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 195

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S++
Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSNSIA 230

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 51/95 (53%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS  + S SS S 
Sbjct: 74  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSS 133

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSS 168

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS    S S S S+S +S++SSS+ S ++ S SS S 
Sbjct: 77  SSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSSSSS 136

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S+SS +S+S+S S
Sbjct: 137 SSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSS 171

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S + S  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 118 SSSSSNDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSS 177

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 178 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 212

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S   S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 190

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 191 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSS 225

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  S S S S S+S + ++SSSSSS ++ S SS S 
Sbjct: 120 SSSNDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSS 179

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 180 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/96 (50%), Positives = 62/96 (64%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           P+  + SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSSS  + S SS +
Sbjct: 64  PAGSNGSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSN 123

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 124 DSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 159

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS+  SSSSS  S S S S S+S +S++ SSSSS +  S SS S 
Sbjct: 72  SNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSS 131

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + +S+S S
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSS 166

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS SS  S S   S S+S +S++SSSSSS ++ S SS S 
Sbjct: 93  SSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSSSSSSSSSSSS 152

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 153 SSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSS 187

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 46/90 (51%), Positives = 59/90 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS++ SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 142 SSSSSSSSSSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 201

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASN 608
           S  SSS++ SS+SSS  S S  S S+  +N
Sbjct: 202 SSSSSSSSSSSSSSSSSSSSGSSSSNSIAN 231

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S S+S  S   SSS+  SSSSS  S S S S S+  +S++SSSSS  ++ S S+ S 
Sbjct: 67  SNGSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSS 126

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S+S
Sbjct: 127 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSIS 161

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S SSS  S S S S S+S ++ +SSSSSS ++ S SS S 
Sbjct: 83  SSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSS 142

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  SISS S SS +S+S+S S
Sbjct: 143 SSSSSSSSSSSSSSS-SSISSSSSSSSSSSSSSSS 176

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S    SS+  SSSSS  S S S + S+S +S++SSSSSS ++ S SS S 
Sbjct: 90  SSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSSSSSSSSS 149

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S +SSS  S SS S SS +S+S+S S
Sbjct: 150 SSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSS 184

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  S S S S S+S +S++SS SSS ++ + SS S 
Sbjct: 70  SSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSS 129

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+ +S S
Sbjct: 130 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSS 164

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 49/95 (51%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  S S   S S+S +S+ SSSSSS    S SS S 
Sbjct: 73  NSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSS 132

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 133 SSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSSSS 167

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS      SSS+  S SSS  S + S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 94  SSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 153

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 154 SSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSS 188

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS   S S S   S+S +S++SSSSSS ++ S SS S 
Sbjct: 91  SSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSSSSSSSSSS 150

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S SS S SS +S+S+S S
Sbjct: 151 SSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSS 185

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S   S+S +S++S SSSS ++   SS S 
Sbjct: 71  SSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSSSSSS 130

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S S+S S
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSSS 165

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 48/98 (48%), Positives = 60/98 (61%)
 Frame = +3

Query: 348 SLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPP 527
           S  SS  S   SSS+  SSSSS  S S S S S+S + ++SSSSSS +  S SS S    
Sbjct: 67  SNGSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSRSSSSSSSNDSS 126

Query: 528 SSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           SSS++ SS+SSS  S SS S SS +S+S+S S  S  S
Sbjct: 127 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSISSSS 164

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 47/97 (48%), Positives = 59/97 (60%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS +    P     SSS   SSSSS  S S S S S+S +S++SSSSS  ++ S SS 
Sbjct: 54  RFSSEAHMGMPAGSNGSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSS 113

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 114 SRSSSSSSSNDSSSSSSSSSSSSSSSSSSSSSSSSSS 150

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 43/82 (52%), Positives = 55/82 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 151 SSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 210

Query: 519 SPPSSSTALSSTSSSIFSISSL 584
           S  SSS++ SS SSS  SI+++
Sbjct: 211 SSSSSSSSSSSGSSSSNSIANV 232

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 42/95 (44%), Positives = 58/95 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S P  SS     +P+ S   SS+SS  S S S S S+S +S++SSSSSS ++   SS S 
Sbjct: 51  SWPRFSSEAHMGMPAGSNGSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSS 110

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S S++ SS++ S  S SS S SS +S+S+S S
Sbjct: 111 SSSSRSSSSSSSNDSSSSSSSSSSSSSSSSSSSSS 145

[49][TOP]
>UniRef100_UPI0000DA3CD4 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA3CD4
          Length = 526

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 49/95 (51%), Positives = 67/95 (70%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS    S+S+S ++S +S++SSSSSS ++ S SS S 
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSGSSISISSNSSSSSSSSSSSSSSSSSSSSSSSS 190

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS+S+SS +S+S+S S
Sbjct: 191 SSSSSSSSSSSSSSSSSSGSSISISSSSSSSSSSS 225

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS SSI   S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 136 SSSSSSSSSSSSSSSSSSSSSSGSSISISSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 195

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S S  SISS S SS +S+S+S S
Sbjct: 196 SSSSSSSSSSSSSGSSISISSSSSSSSSSSSSSSS 230

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S   SIS S +S++SSSSSS ++ S SS S 
Sbjct: 178 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSISISSSSSSSSSSSSSSSSSSSSSSS 237

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSST + S+SSS  S SS S SS +S+++S S
Sbjct: 238 SSSSSSTVVVSSSSSRSSNSSSSSSSSSSSNSSSS 272

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 48/95 (50%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S + S+S+  SSSS+  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 295 NSSSSSSSSSSSISSNSSSSSSSSNNNSSSSSCSSSSSSSSSSSSSSSSGSSSSSSSSST 354

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 355 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNS 389

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S   S+SIS+S +S++SSSSSS ++ S SS S 
Sbjct: 180 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSISISSSSSSSSSSSSSSSSSSSSSS-SS 238

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+  +SS+SS   + SS S SS +SNS+S S
Sbjct: 239 SSSSSTVVVSSSSSRSSNSSSSSSSSSSSNSSSSS 273

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 59/129 (45%), Positives = 73/129 (56%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SS  +N       S        SS S SS+  S   S S+  SSSSS 
Sbjct: 278 SSSSSSSSSGSSSSSSSNSSSSSSSSSSSISSNSSSSSSSSNNNSSSSSCSSSSSSSSSS 337

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S+TSSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS
Sbjct: 338 SSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSS 397

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 398 SSSSSSSSS 406

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/93 (52%), Positives = 65/93 (69%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSST++ SSSS RS S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 227 SSSSSSSSSSSSSSSSSTVVVSSSSSRS-SNSSSSSSSSSSSNSSSSSSSSSSSSSSSSS 285

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ +S+SSS  S SS+S +S +S+S+S
Sbjct: 286 SGSSSSSSSNSSSSSSSSSSSISSNSSSSSSSS 318

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S  SS  S   SSS+  SS SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 322 SSSSSCSSSSSSSSSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSS 381

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 382 SSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSS 416

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S ++S  S   SSS+  SSSSS  S   S S S+S TS++SSSSSS ++ S SS S 
Sbjct: 315 SSSSNNNSSSSSCSSSSSSSSSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSS 374

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S+S  S SS S SS +S+S+S S
Sbjct: 375 SSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSS 409

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S SSS  S S + S S+S +S++SSSSSS ++ S SS S 
Sbjct: 323 SSSSCSSSSSSSSSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSS 382

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 383 SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 417

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S + S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 325 SSCSSSSSSSSSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 384

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 385 SSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 419

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 58/95 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS   S   SSST  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 337 SSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSS 396

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S +     STS S
Sbjct: 397 SSSSSSSSSSSSSSSSSSSSSSSCNGTYDTSTSTS 431

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S    SS  +SS+SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 144 SSSSSSSSSSSSSSGSSISISSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 203

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS +++S +SSS  S SS S SS +S+S+S S
Sbjct: 204 SSSSSGSSISISSSSSSSSSSSSSSSSSSSSSSSS 238

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS   SSS  S   SSS+   SSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 324 SSSCSSSSSSSSSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 383

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 384 SSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 418

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS    S+S+S S+S +S++SSSSSS ++ S SS S 
Sbjct: 182 SSSSSSSSSSSSSSSSSSSSSSSSSSSGSSISISSSSSSSSSSSSSSSSSSSSSSSSSSS 241

Query: 519 SPP---SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S     SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 242 SSTVVVSSSSSRSSNSSSSSSSSSSSNSSSSSSSSSSS 279

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/94 (51%), Positives = 60/94 (63%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           S S SSS  S   SSS+  SSSSS  S S  V  S+S  S+ SSSSSS ++ S SS S S
Sbjct: 215 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSTVVVSSSSSRSSNSSSSSSSSSSSNSSSSSS 274

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SSS++ SS+S S  S SS S SS +S+S+S+S
Sbjct: 275 SSSSSSSSSSSSGSSSSSSSNSSSSSSSSSSSIS 308

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 55/129 (42%), Positives = 74/129 (57%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS  +    SSR +N       S        SS S SSS  S    SS+  SS+SS 
Sbjct: 239 SSSSSTVVVSSSSSRSSNSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSGSSSSSSSNSSS 298

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S SIS++ +S++SSS+++ ++ S SS S S  SSS++ SS SSS  S SS S SS
Sbjct: 299 SSSSSSSSISSNSSSSSSSSNNNSSSSSCSSSSSSSSSSSSSSSSGSSSSSSSSSTSSSS 358

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 359 SSSSSSSSS 367

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + +SS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 316 SSSNNNSSSSSCSSSSSSSSSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSS 375

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS++SS  S SS S SS +S+S+S S
Sbjct: 376 SSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSS 410

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/92 (51%), Positives = 60/92 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS+SS  S S S S S+S +S++SSSSSS ++ S S+ S 
Sbjct: 332 SSSSSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSS 391

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNST 614
           S  SSS++ SS+SSS  S SS S SS + N T
Sbjct: 392 SSSSSSSSSSSSSSSSSSSSSSSSSSSSCNGT 423

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S S   +SSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 146 SSSSSSSSSSSSGSSISISSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 205

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS ++SS+SSS  S SS S SS +S+S+S S
Sbjct: 206 SSSGSSISISSSSSSSSSSSSSSSSSSSSSSSSSS 240

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ + SSS  S   SSS+  SSSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 318 SNNNSSSSSCSSSSSSSSSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSS 377

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S SS S SS +S+S+S S
Sbjct: 378 SSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 412

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S  S+ S SSSS ++ S SS S 
Sbjct: 170 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSISISSSSSSSSSSSSSSS 229

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS++   SS S SS +S+S+S S
Sbjct: 230 SSSSSSSSSSSSSSTVVVSSSSSRSSNSSSSSSSS 264

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 50/99 (50%), Positives = 65/99 (65%), Gaps = 4/99 (4%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS+ ++SSSSS  S S S S S+S ++++SSSSSS ++ S SS S 
Sbjct: 228 SSSSSSSSSSSSSSSSTVVVSSSSSRSSNSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSG 287

Query: 519 SPPS----SSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S    SS++ SS+SSSI S SS S SS  +NS+S S
Sbjct: 288 SSSSSSSNSSSSSSSSSSSISSNSSSSSSSSNNNSSSSS 326

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ + SS S 
Sbjct: 335 SSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSS 394

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S   +  TS S
Sbjct: 395 SSSSSSSSSSSSSSSSSSSSSSSSSCNGTYDTSTS 429

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+ + S S S S ++S +S++SSSS+S ++ S SS S 
Sbjct: 221 SSSSSSSSSSSSSSSSSSSSSSSTVVVSSSSSRSSNSSSSSSSSSSSNSSSSSSSSSSSS 280

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SS+  S SS S SS +SNS+S S
Sbjct: 281 SSSSSSGSSSSSSSNSSSSSSSSSSSISSNSSSSS 315

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/95 (49%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S    SS  +SSSSS  S S S S S+S +S++SSSSSS    S SS   
Sbjct: 195 SSSSSSSSSSSSSSGSSISISSSSSSSSSSSSSSSSSSSSSSSSSSSSSTVVVSSSSSRS 254

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S+S  S SS S SS +S+S+  S
Sbjct: 255 SNSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSGSS 289

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS ++ SSSSS  S S S S S+S +S++SSSSS+    S SS S 
Sbjct: 196 SSSSSSSSSSSSSGSSISISSSSSSSSSSSSSSSSSSSSSSSSSSSSSTVVVSSSSSRSS 255

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS++SS  S SS S SS +S+S S S
Sbjct: 256 NSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSGSSS 290

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS      SSS+  SSSSS  S S+S + S+S +S+ ++SSSS  + S SS S 
Sbjct: 277 SSSSSSSSSSGSSSSSSSNSSSSSSSSSSSISSNSSSSSSSSNNNSSSSSCSSSSSSSSS 336

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  + SS S SS +S+S+S S
Sbjct: 337 SSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSS 371

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S++  S    SS+  SSSSS  S S   S S+S +S +SSSSSS ++ S SS S 
Sbjct: 313 SSSSSSNNNSSSSSCSSSSSSSSSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSS 372

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 373 SSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSS 407

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS      SSS+  SSSSS    S S S S++ +S++SSSSSS ++ S SS S 
Sbjct: 317 SSNNNSSSSSCSSSSSSSSSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSS 376

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 377 SSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 411

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 47/96 (48%), Positives = 60/96 (62%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           P SP+      S   SSS+  SSSSS  S S S S S+S +S++SSS SS +  S SS S
Sbjct: 111 PKSPAKEPRFYSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSISISSNSSSS 170

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 171 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 206

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 48/93 (51%), Positives = 62/93 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS++  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 150 SSSSSSSSGSSISISSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSG 209

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  S S++ SS+SSS  S SS S SS +S+S+S
Sbjct: 210 SSISISSSSSSSSSSSSSSSSSSSSSSSSSSSS 242

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 48/102 (47%), Positives = 64/102 (62%), Gaps = 6/102 (5%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVP------SSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATP 497
           P     S++P SP        SS++  SSSSS  S S S S S+S +S++SSSSSS ++ 
Sbjct: 102 PGCQVTSTAPKSPAKEPRFYSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSI 161

Query: 498 SRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S SS S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 162 SISSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 203

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/95 (49%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S S++  SS+S  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 143 SSSSSSSSSSSSSSSGSSISISSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 202

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS +  S SSS  S SS S SS +S+S+S S
Sbjct: 203 SSSSSSGSSISISSSSSSSSSSSSSSSSSSSSSSS 237

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 46/95 (48%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SS SS   + S SS S 
Sbjct: 164 SSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSISISSSSSSSSS 223

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S++ +SS +S S++ S
Sbjct: 224 SSSSSSSSSSSSSSSSSSSSTVVVSSSSSRSSNSS 258

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 55/129 (42%), Positives = 71/129 (55%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SS  ++       S     +  SS S SSS  S   SSS+  SSSSS 
Sbjct: 183 SSSSSSSSSSSSSSSSSSSSSSSSSSGSSISISSSSSSSSSSSSSSSSSSSSSSSSSSSS 242

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            ++ +S S S S  S++SSSSSS +  S SS S S  SSS++ S +SSS  S SS S SS
Sbjct: 243 STVVVSSSSSRSSNSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSGSSSSSSSNSSSSSSS 302

Query: 597 PASNSTSLS 623
            +S+ +S S
Sbjct: 303 SSSSISSNS 311

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS   +S S S S++ +S++SSSSSS ++ S SS S 
Sbjct: 219 SSSSSSSSSSSSSSSSSSSSSSSSSTVVVSSSSSRSSNSSSSSSSSSSSNSSSSSSSSSS 278

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + +S S S
Sbjct: 279 SSSSSSSSGSSSSSSSNSSSSSSSSSSSISSNSSS 313

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 44/95 (46%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S+S ++S +S++S+++SS ++ S SS S 
Sbjct: 275 SSSSSSSSSSSSGSSSSSSSNSSSSSSSSSSSISSNSSSSSSSSNNNSSSSSCSSSSSSS 334

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S +S S SS +S+S+S S
Sbjct: 335 SSSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSS 369

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 47/95 (49%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SS S S ++ S SS S 
Sbjct: 167 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSISISSSSSSSSSSSS 226

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  ++   S SS +SNS+S S
Sbjct: 227 SSSSSSSSSSSSSSSSSTVVVSSSSSRSSNSSSSS 261

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S   S S+S +S+++++SSS +  S SS S 
Sbjct: 276 SSSSSSSSSSSGSSSSSSSNSSSSSSSSSSSISSNSSSSSSSSNNNSSSSSCSSSSSSSS 335

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 336 SSSSSSSSGSSSSSSSSSTSSSSSSSSSSSSSSSS 370

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 45/93 (48%), Positives = 60/93 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS     + S+S+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS   
Sbjct: 151 SSSSSSSGSSISISSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGS 210

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S   SS++ SS+SSS  S SS S SS +S+S+S
Sbjct: 211 SISISSSSSSSSSSSSSSSSSSSSSSSSSSSSS 243

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 72/130 (55%)
 Frame = +3

Query: 228 VFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSS 407
           +  SS SS S     SS  ++       S    +   SS S +SS  S   SSS   SSS
Sbjct: 214 ISSSSSSSSSSSSSSSSSSSSSSSSSSSSSTVVVSSSSSRSSNSSSSSSSSSSSNSSSSS 273

Query: 408 SSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLS 587
           SS  S S S S S S +S++S+SSSS ++ S S  S S  SSS++ +++SSS  S SS S
Sbjct: 274 SSSSSSSSSSSSSGSSSSSSSNSSSSSSSSSSSISSNSSSSSSSSNNNSSSSSCSSSSSS 333

Query: 588 LSSPASNSTS 617
            SS +S+S+S
Sbjct: 334 SSSSSSSSSS 343

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 46/96 (47%), Positives = 61/96 (63%)
 Frame = +3

Query: 354 SSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSS 533
           SSS  S   SSS+  SSSSS  S S S ++  S +S+ SS+SSS ++ S SS S S  SS
Sbjct: 216 SSSSSSSSSSSSSSSSSSSSSSSSSSSSTVVVSSSSSRSSNSSSSSSSSSSSNSSSSSSS 275

Query: 534 STALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S++ SS+SSS  S SS S +S +S+S+S S  S  S
Sbjct: 276 SSSSSSSSSSSGSSSSSSSNSSSSSSSSSSSISSNS 311

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 46/94 (48%), Positives = 62/94 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S S  S   +SS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 152 SSSSSSGSSISISSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSS 211

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSL 620
              SSS++ SS+SSS  S SS S SS +S+S+++
Sbjct: 212 ISISSSSSSSSSSSSSSSSSSSSSSSSSSSSSTV 245

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS++   S S   S S +S++SSSSS+ ++ S SS S 
Sbjct: 220 SSSSSSSSSSSSSSSSSSSSSSSSTVVVSSSSSRSSNSSSSSSSSSSSNSSSSSSSSSSS 279

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS  S+++S S
Sbjct: 280 SSSSSSSGSSSSSSSNSSSSSSSSSSSISSNSSSS 314

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 43/93 (46%), Positives = 61/93 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSS+SS ++ S SS S 
Sbjct: 342 SSGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSS 401

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S +    +S ++++T+
Sbjct: 402 SSSSSSSSSSSSSSSSSSCNGTYDTSTSTSTTT 434

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 44/96 (45%), Positives = 62/96 (64%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+S  S S S S S+S +S++SSSSSS ++ S  + +Y
Sbjct: 365 SSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCNGTY 424

Query: 519 -SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  S+ST  ++TS++  SIS  + SS  SNS+S S
Sbjct: 425 DTSTSTSTTTTTTSNNSSSISISTTSSTGSNSSSSS 460

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 43/93 (46%), Positives = 58/93 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+++SSSSS ++ S SS S 
Sbjct: 345 SSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSS 404

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS       S S+  + +T+
Sbjct: 405 SSSSSSSSSSSSSSSCNGTYDTSTSTSTTTTTT 437

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 346 SSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSS 405

Query: 519 SPPSSSTALSSTSS-----SIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS        + +S + ++ ++NS+S+S
Sbjct: 406 SSSSSSSSSSSSSSCNGTYDTSTSTSTTTTTTSNNSSSIS 445

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 42/102 (41%), Positives = 62/102 (60%)
 Frame = +3

Query: 318 FFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATP 497
           F F+++P   S S S P    +S+   S +   R  S S S S+S +S++SSSSSS ++ 
Sbjct: 86  FPFVVQPRQSSRSQSVPGCQVTSTAPKSPAKEPRFYSSSNSSSSSSSSSSSSSSSSSSSS 145

Query: 498 SRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S SS S S  SS +++S +S+S  S SS S SS +S+S+S S
Sbjct: 146 SSSSSSSSSSSSGSSISISSNSSSSSSSSSSSSSSSSSSSSS 187

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 42/93 (45%), Positives = 57/93 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S  S SSS  S   SSS+  SSSSS  S S S S S+S +S++SS+SSS ++ S SS S 
Sbjct: 343 SGSSSSSSSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSS 402

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS     +   S+  S +T+
Sbjct: 403 SSSSSSSSSSSSSSSSSCNGTYDTSTSTSTTTT 435

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 43/95 (45%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS      +S S 
Sbjct: 371 SSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCNGTYDTSTST 430

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +++T+ +S+S SI + SS   +S +S+S+S S
Sbjct: 431 STTTTTTSNNSSSISISTTSSTGSNSSSSSSSSSS 465

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 41/92 (44%), Positives = 56/92 (60%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S + +  ++TS+S+++  T + SS   
Sbjct: 386 SSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCNGTYDTSTSTSTTTTTTSNNSSSIS 445

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNST 614
              +SST  +S+SSS  S SS S SS +S+ST
Sbjct: 446 ISTTSSTGSNSSSSSSSSSSSSSSSSNSSSST 477

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 44/95 (46%), Positives = 58/95 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +       S 
Sbjct: 369 SSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCNGTYDTST 428

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +++T  S+ SSSI SIS+ S +   S+S+S S
Sbjct: 429 STSTTTTTTSNNSSSI-SISTTSSTGSNSSSSSSS 462

[50][TOP]
>UniRef100_UPI0000DA1E0A PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA1E0A
          Length = 426

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 52/95 (54%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ SRSS S 
Sbjct: 74  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSS 133

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 168

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 52/95 (54%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS RS S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 102 SSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 161

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 162 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 196

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 52/95 (54%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ SRSS S 
Sbjct: 186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSS 245

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 246 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 280

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 52/95 (54%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS RS S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 214 SSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 273

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 274 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 308

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 52/95 (54%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ SRSS S 
Sbjct: 257 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSS 316

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 317 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 351

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 52/95 (54%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS RS S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 285 SSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 344

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 345 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 379

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 51/95 (53%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S+SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 12  SSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 71

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 72  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 106

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 52/97 (53%), Positives = 65/97 (67%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS 
Sbjct: 128 RSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 187

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 188 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 224

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 52/97 (53%), Positives = 65/97 (67%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS 
Sbjct: 311 RSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 370

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 371 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 407

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 60/129 (46%), Positives = 75/129 (58%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SS  ++   R   S        SS S SSS  S   SSS+  SSSSS 
Sbjct: 107 SSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 166

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS
Sbjct: 167 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 226

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 227 SSSSSSSSS 235

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 60/129 (46%), Positives = 75/129 (58%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SS  ++   R   S        SS S SSS  S   SSS+  SSSSS 
Sbjct: 290 SSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 349

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS
Sbjct: 350 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 409

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 410 SSSSSSSSS 418

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 17  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 76

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 77  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 111

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 18  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 77

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 78  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 112

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 19  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 78

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 79  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 113

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 20  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 79

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 80  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 114

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 21  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 80

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 81  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 115

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 22  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 81

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 82  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 116

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 23  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 82

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 83  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 117

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 24  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 83

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 84  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 118

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 25  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 84

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 85  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 119

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 26  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 85

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 86  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 120

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 27  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 86

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 87  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 121

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 28  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 87

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 88  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 122

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 29  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 88

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 89  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 123

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 30  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 89

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 90  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 124

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 31  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 90

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 91  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 125

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 32  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 91

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 92  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 126

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 33  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 92

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 93  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 127

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 35  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 94

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 95  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRS 129

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 45  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 104

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 105 SSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSS 139

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 47  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 106

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 107 SSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSS 141

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 60  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 119

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 120 SSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSS 154

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 69  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSR 128

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 129 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 163

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 71  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSS 130

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 165

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 90  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSS 149

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 184

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 98  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 157

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 158 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 192

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 100 SSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 159

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 160 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 194

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 142 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 201

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 202 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 236

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 143 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 202

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 203 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 237

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 144 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 203

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 204 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 238

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 145 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 205 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 239

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 147 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 206

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 207 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRS 241

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 157 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 217 SSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSS 251

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 159 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 219 SSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSS 253

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 172 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 231

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 232 SSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSS 266

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 181 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSR 240

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 241 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 275

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 183 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSS 242

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 243 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 277

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 202 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSS 261

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 262 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 296

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 210 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 269

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 270 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 304

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 212 SSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 271

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 272 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 306

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 60/129 (46%), Positives = 74/129 (57%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SSR ++       S        SS S SSS  S   SSS+  SSSSS 
Sbjct: 226 SSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 285

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++SSSSSS +  S SS S S  SSS++ SS+SSS  S SS S SS
Sbjct: 286 SSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 345

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 346 SSSSSSSSS 354

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 273 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSS 332

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 333 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 367

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 281 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 340

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 341 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 375

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 283 SSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 342

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 343 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 377

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 325 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 384

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 385 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 419

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 326 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 385

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 386 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 420

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 328 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 387

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 388 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRS 422

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 39  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 98

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S S+S S
Sbjct: 99  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSS 133

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 42  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 101

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 102 SSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSS 136

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 50  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 109

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 110 SSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSS 144

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 52  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 111

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 112 SSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSS 146

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 53  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 112

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 113 SSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSS 147

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 66  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 125

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 126 SSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 160

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 67  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 126

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 127 SRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 161

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 76  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSS 135

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 136 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 170

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 79  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSS 138

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 139 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 173

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 94  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSS 153

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 154 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 188

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 96  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSS 155

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 156 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 190

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 103 SSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 162

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 163 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 197

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 151 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 210

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S S+S S
Sbjct: 211 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSS 245

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 154 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 214 SSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSS 248

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 162 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 221

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 222 SSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSS 256

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 164 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 223

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 224 SSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSS 258

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 165 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 224

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 225 SSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSS 259

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 178 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 237

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 238 SSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 272

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 179 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 238

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 239 SRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 273

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 188 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSS 247

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 248 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 282

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 191 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSS 250

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 251 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 285

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 206 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSS 265

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 266 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 300

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 208 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSS 267

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 268 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 302

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 215 SSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 274

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 275 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 309

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 222 SSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 281

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S S+S S
Sbjct: 282 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSS 316

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 262 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSS 321

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 322 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 356

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 277 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSS 336

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 337 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 371

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 279 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSS 338

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 339 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 373

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 286 SSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 345

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 346 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 380

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 7   SSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 66

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 67  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 101

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 8   SSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 67

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 68  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 102

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 14  SSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 73

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 74  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 108

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 37  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 96

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 97  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSS 131

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 41  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 100

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 101 SSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSS 135

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 57  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 116

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 117 SSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSS 151

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 61  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 120

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 121 SSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSS 155

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 62  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 121

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 122 SSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSS 156

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 77  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSS 136

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 137 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 171

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 78  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSS 137

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 138 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 172

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 86  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSS 145

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 146 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 180

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 87  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSS 146

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 147 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 181

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSSS ++ S SS S 
Sbjct: 89  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSS 148

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 183

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 92  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSS 151

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 152 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 186

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 209 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSS 243

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 153 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 212

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 213 SSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSS 247

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 169 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 228

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 229 SSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSS 263

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 173 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 232

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 233 SSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSS 267

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 174 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 233

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 234 SSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSS 268

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 189 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSS 248

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 249 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 283

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSS 249

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 250 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 284

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 198 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSS 257

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 258 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 292

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 199 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSS 258

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 259 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 293

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSSS ++ S SS S 
Sbjct: 201 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSS 260

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 261 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 295

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 204 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSS 263

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 264 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 298

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 261 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSS 320

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 321 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 355

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 269 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSS 328

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 329 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 363

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 270 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSS 329

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 330 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 364

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSSS ++ S SS S 
Sbjct: 272 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSS 331

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 332 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 366

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 275 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSS 334

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 335 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 369

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 59/129 (45%), Positives = 74/129 (57%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS SI    SS  ++       S        SS S SSS  S   SSS+  SSSSS 
Sbjct: 9   SSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 68

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S S 
Sbjct: 69  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSR 128

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 129 SSSSSSSSS 137

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 59/129 (45%), Positives = 74/129 (57%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SSR ++       S        SS S SSS  S   SSS+  SSSSS 
Sbjct: 114 SSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 173

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS
Sbjct: 174 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 233

Query: 597 PASNSTSLS 623
            +S+S+  S
Sbjct: 234 SSSSSSRSS 242

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 44  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 103

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S  S +S+S+S S
Sbjct: 104 SSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSS 138

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 46  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 105

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS   SS +S+S+S S
Sbjct: 106 SSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSS 140

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 48  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 107

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S  S SS +S+S+S S
Sbjct: 108 SSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSS 142

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 49  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 108

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S  S S SS +S+S+S S
Sbjct: 109 SSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSS 143

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 51  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 110

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS    SS S SS +S+S+S S
Sbjct: 111 SSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSS 145

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 54  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 113

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS   S SS S SS +S+S+S S
Sbjct: 114 SSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSS 148

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 55  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 114

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S S  S SS S SS +S+S+S S
Sbjct: 115 SSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSS 149

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 56  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 115

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+ SS  S SS S SS +S+S+S S
Sbjct: 116 SSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSS 150

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 58  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 117

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S +SSS  S SS S SS +S+S+S S
Sbjct: 118 SSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSS 152

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 59  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 118

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S SS S SS +S+S+S S
Sbjct: 119 SSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSS 153

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 63  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 122

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS ++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 123 SSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 157

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 64  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 123

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 124 SSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 158

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 65  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 124

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 125 SSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 159

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 68  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 127

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 128 RSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 162

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS   
Sbjct: 70  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRS 129

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 130 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 164

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S  S 
Sbjct: 72  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSS 131

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 166

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S  S S 
Sbjct: 73  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSS 132

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 133 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 167

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSS  ++ S SS S 
Sbjct: 80  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSS 139

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 140 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 174

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS S ++ S SS S 
Sbjct: 81  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSS 140

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 141 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 175

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSS SS ++ S SS S 
Sbjct: 82  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSS 141

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 142 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 176

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SS SSS ++ S SS S 
Sbjct: 83  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSS 142

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 143 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 177

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S SSSS ++ S SS S 
Sbjct: 84  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSS 143

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 144 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 178

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++ SSSSS ++ S SS S 
Sbjct: 85  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSS 144

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 145 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 179

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S + ++SSSSSS ++ S SS S 
Sbjct: 88  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSS 147

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 148 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 182

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+  +S++SSSSSS ++ S SS S 
Sbjct: 91  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSS 150

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 151 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 185

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S  +S +S++SSSSSS ++ S SS S 
Sbjct: 93  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSS 152

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 153 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 187

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S   S+S +S++SSSSSS ++ S SS S 
Sbjct: 95  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSS 154

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 155 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 189

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S   S S+S +S++SSSSSS ++ S SS S 
Sbjct: 97  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSS 156

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 157 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 191

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S   S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 99  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 158

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 159 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 193

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS   S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 104 SSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 163

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 164 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 198

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS S  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 105 SSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 164

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 165 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 199

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 106 SSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 165

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 166 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 200

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 209

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+ +S S
Sbjct: 210 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSS 244

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 152 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 211

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + +S+S S
Sbjct: 212 SSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSS 246

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 155 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S  +S+S+S S
Sbjct: 215 SSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSS 249

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 156 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S  S +S+S+S S
Sbjct: 216 SSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSS 250

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 158 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 217

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS   SS +S+S+S S
Sbjct: 218 SSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSS 252

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 160 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 219

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S  S SS +S+S+S S
Sbjct: 220 SSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSS 254

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 161 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 220

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S  S S SS +S+S+S S
Sbjct: 221 SSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSS 255

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 163 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 222

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS    SS S SS +S+S+S S
Sbjct: 223 SSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSS 257

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 166 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 225

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS   S SS S SS +S+S+S S
Sbjct: 226 SSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSS 260

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 167 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 226

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S S  S SS S SS +S+S+S S
Sbjct: 227 SSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSS 261

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 168 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 227

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+ SS  S SS S SS +S+S+S S
Sbjct: 228 SSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSS 262

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 170 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 229

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S +SSS  S SS S SS +S+S+S S
Sbjct: 230 SSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSS 264

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 171 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 230

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S SS S SS +S+S+S S
Sbjct: 231 SSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSS 265

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 175 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 234

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS ++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 235 SSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 269

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 176 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 235

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 236 SSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 270

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 177 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 236

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 237 SSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 271

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 180 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 239

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 240 RSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 274

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS   
Sbjct: 182 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRS 241

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 242 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 276

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S  S 
Sbjct: 184 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSS 243

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 244 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 278

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S  S S 
Sbjct: 185 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSS 244

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 245 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 279

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSS  ++ S SS S 
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSS 251

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 252 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 286

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS S ++ S SS S 
Sbjct: 193 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSS 252

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 253 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 287

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSS SS ++ S SS S 
Sbjct: 194 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSS 253

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 254 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 288

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SS SSS ++ S SS S 
Sbjct: 195 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSS 254

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 255 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 289

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S SSSS ++ S SS S 
Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSS 255

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 256 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 290

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++ SSSSS ++ S SS S 
Sbjct: 197 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSS 256

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 257 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 291

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S + ++SSSSSS ++ S SS S 
Sbjct: 200 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSS 259

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 260 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 294

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+  +S++SSSSSS ++ S SS S 
Sbjct: 203 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSS 262

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 263 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 297

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S  +S +S++SSSSSS ++ S SS S 
Sbjct: 205 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSS 264

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 265 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 299

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S   S+S +S++SSSSSS ++ S SS S 
Sbjct: 207 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSS 266

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 267 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 301

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S   S S+S +S++SSSSSS ++ S SS S 
Sbjct: 209 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSS 268

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 269 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 303

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S   S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 211 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 270

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 271 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 305

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS   S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 216 SSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 275

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 276 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 310

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 218 SSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 277

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 278 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRS 312

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 221 SSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 280

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+ +S S
Sbjct: 281 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSS 315

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSS  ++ S SS S 
Sbjct: 263 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSS 322

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 323 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 357

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS S ++ S SS S 
Sbjct: 264 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSS 323

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 324 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 358

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSS SS ++ S SS S 
Sbjct: 265 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSS 324

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 325 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 359

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SS SSS ++ S SS S 
Sbjct: 266 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSS 325

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 326 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 360

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S SSSS ++ S SS S 
Sbjct: 267 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSS 326

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 327 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 361

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++ SSSSS ++ S SS S 
Sbjct: 268 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSS 327

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 328 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 362

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S + ++SSSSSS ++ S SS S 
Sbjct: 271 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSS 330

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 331 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 365

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+  +S++SSSSSS ++ S SS S 
Sbjct: 274 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSS 333

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 334 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 368

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S  +S +S++SSSSSS ++ S SS S 
Sbjct: 276 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSS 335

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 336 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 370

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S   S+S +S++SSSSSS ++ S SS S 
Sbjct: 278 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSS 337

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 338 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 372

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S   S S+S +S++SSSSSS ++ S SS S 
Sbjct: 280 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSS 339

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 340 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 374

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S   S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 282 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 341

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 342 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 376

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS   S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 287 SSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 346

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 347 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 381

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS S  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 288 SSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 347

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 348 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 382

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 289 SSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 348

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 349 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 383

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 329 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 388

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+  S
Sbjct: 389 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSS 423

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS      SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 6   SSSSSSSSSSISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 65

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 66  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 100

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S S+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 225 SSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 284

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 285 SSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSS 319

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+   SSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 220 SSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 279

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 280 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSS 314

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 223 SSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 282

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + +S+S S
Sbjct: 283 SSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSS 317

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS +  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 224 SSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 283

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 284 SSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSS 318

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S SSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 219 SSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 278

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+  S
Sbjct: 279 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSS 313

[51][TOP]
>UniRef100_Q6CBU0 YALI0C15532p n=1 Tax=Yarrowia lipolytica RepID=Q6CBU0_YARLI
          Length = 892

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 56/103 (54%), Positives = 67/103 (65%), Gaps = 8/103 (7%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLS-SSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           SSP  SSSP S  P SS+  S SSSS  S S S S S+S +S +SSSSSS ++PS SS S
Sbjct: 471 SSPVSSSSPSSSNPGSSSSSSPSSSSPSSSSSSPSSSSSSSSPSSSSSSSSSSPSSSSSS 530

Query: 516 YSPPSSST-------ALSSTSSSIFSISSLSLSSPASNSTSLS 623
            SP SSS+       + SS+SSS  S SS S SS +S+STSLS
Sbjct: 531 SSPSSSSSFSSSSPSSSSSSSSSSSSSSSPSASSSSSSSTSLS 573

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 50/93 (53%), Positives = 64/93 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS PS   SSS+  SSSSS  S   S S S+S +S++S SSSSP++ S SS S 
Sbjct: 495 SSPSSSSSSPSSSSSSSSPSSSSSSSSSSPSSSSSSSSPSSSSSFSSSSPSSSSSSS-SS 553

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS + SS+SSS  S+SS S SS +S+S++
Sbjct: 554 SSSSSSPSASSSSSSSTSLSSSSSSSSSSSSSA 586

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 53/103 (51%), Positives = 63/103 (61%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           RPSS S   S  SPV SSS   S+  S  S S S S  +S +S+ SSSSSS +  S SS 
Sbjct: 460 RPSSSSAPVSSSSPVSSSSPSSSNPGSSSSSSPSSSSPSSSSSSPSSSSSSSSPSSSSSS 519

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S S PSSS++ SS SSS  S SS S SS +S+S+S S  S PS
Sbjct: 520 SSSSPSSSSSSSSPSSS-SSFSSSSPSSSSSSSSSSSSSSSPS 561

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 52/100 (52%), Positives = 65/100 (65%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS S SSS  SP  SSS+  S SSS  S S S S S+S +S +SSSS S ++PS SS  
Sbjct: 492 PSSSSPSSSSSSP-SSSSSSSSPSSSSSSSSSSPSSSSSSSSPSSSSSFSSSSPSSSS-- 548

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSP 635
            S  SSS++ SS S+S  S SS SLSS +S+S+S S  +P
Sbjct: 549 -SSSSSSSSSSSPSASSSSSSSTSLSSSSSSSSSSSSSAP 587

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 51/103 (49%), Positives = 67/103 (65%), Gaps = 10/103 (9%)
 Frame = +3

Query: 345 PSLSSSPPSPVPSSSTL-LSSSSSIRSMSMSVS---ISASLTSATSSSSSSPATPSRSS* 512
           PS SS+ PS  PSSS+  +SSSS + S S S S    S+S + ++SS SSS ++PS SS 
Sbjct: 450 PSSSSASPSSRPSSSSAPVSSSSPVSSSSPSSSNPGSSSSSSPSSSSPSSSSSSPSSSSS 509

Query: 513 SYSPPSSST------ALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S SP SSS+      + SS+SSS  S SS S SSP+S+S+S S
Sbjct: 510 SSSPSSSSSSSSSSPSSSSSSSSPSSSSSFSSSSPSSSSSSSS 552

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 50/103 (48%), Positives = 65/103 (63%), Gaps = 1/103 (0%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASL-TSATSSSSSSPATPSRSS* 512
           P+S S SSS  + +PSSS   S+S S R  S S  +S+S   S++S SSS+P + S SS 
Sbjct: 436 PTSSSGSSSSSTILPSSS---SASPSSRPSSSSAPVSSSSPVSSSSPSSSNPGSSSSSSP 492

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S S PSSS++  S+SSS  S SS S SS +S S+S S  SP S
Sbjct: 493 SSSSPSSSSSSPSSSSSSSSPSSSSSSSSSSPSSSSSSSSPSS 535

 Score = 54.3 bits (129), Expect = 9e-06
 Identities = 42/103 (40%), Positives = 58/103 (56%), Gaps = 3/103 (2%)
 Frame = +3

Query: 342 SPSLSSSPP---SPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           SP + S+ P   S  PS+S  ++ S    S S + S  +S +S    SSSS +  SR S 
Sbjct: 404 SPIVLSTTPNSGSTTPSNSGTITGSEVTSSTSPTSSSGSSSSSTILPSSSSASPSSRPSS 463

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S +P SSS+ +SS+S S  +  S S SSP+S+S S S  SP S
Sbjct: 464 SSAPVSSSSPVSSSSPSSSNPGSSSSSSPSSSSPSSSSSSPSS 506

[52][TOP]
>UniRef100_Q2TWF4 Predicted protein n=1 Tax=Aspergillus oryzae RepID=Q2TWF4_ASPOR
          Length = 249

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 56/126 (44%), Positives = 72/126 (57%)
 Frame = +3

Query: 219 FLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLL 398
           + L+   +F       L+ SR     ++ LF     LL  SS S SSS  S   SSS+  
Sbjct: 74  YRLIIALAFEKTDAMLLWYSRGLVESYKLLFYSKILLLISSSSSSSSSSSSSSSSSSSSS 133

Query: 399 SSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSIS 578
           SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S S
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 193

Query: 579 SLSLSS 596
           S S SS
Sbjct: 194 SSSSSS 199

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 44/81 (54%), Positives = 57/81 (70%)
 Frame = +3

Query: 381 SSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSS 560
           SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SS
Sbjct: 113 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 172

Query: 561 SIFSISSLSLSSPASNSTSLS 623
           S  S SS S SS +S+S+S S
Sbjct: 173 SSSSSSSSSSSSSSSSSSSSS 193

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 42/77 (54%), Positives = 55/77 (71%)
 Frame = +3

Query: 393 LLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFS 572
           L+SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S
Sbjct: 111 LISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 170

Query: 573 ISSLSLSSPASNSTSLS 623
            SS S SS +S+S+S S
Sbjct: 171 SSSSSSSSSSSSSSSSS 187

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 43/81 (53%), Positives = 55/81 (67%)
 Frame = +3

Query: 381 SSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSS 560
           S   LL SSSS  S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SS
Sbjct: 106 SKILLLISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 165

Query: 561 SIFSISSLSLSSPASNSTSLS 623
           S  S SS S SS +S+S+S S
Sbjct: 166 SSSSSSSSSSSSSSSSSSSSS 186

[53][TOP]
>UniRef100_Q75JC9 Uncharacterized protein DDB_G0271670 n=1 Tax=Dictyostelium
           discoideum RepID=Y8484_DICDI
          Length = 374

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 60/136 (44%), Positives = 79/136 (58%)
 Frame = +3

Query: 216 AFLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTL 395
           +FL + ++S SS S     SS  ++       S        SS S SSS  S   SSS+ 
Sbjct: 58  SFLNILDTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 117

Query: 396 LSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSI 575
            SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S 
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 177

Query: 576 SSLSLSSPASNSTSLS 623
           SS S SS +S+S+S S
Sbjct: 178 SSSSSSSSSSSSSSSS 193

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 100 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 159

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 160 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 194

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 101 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 160

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 161 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 195

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 102 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 161

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 162 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 196

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 103 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 162

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 163 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 197

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 104 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 163

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 164 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 198

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 105 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 164

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 165 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 199

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 106 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 165

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 166 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 200

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 107 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 166

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 167 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 201

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 108 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 167

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 168 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 202

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 109 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 168

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 169 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 203

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 110 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 169

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 170 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 111 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 170

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 171 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 205

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 112 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 171

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 172 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 206

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 113 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 172

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 173 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 207

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 114 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 173

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 174 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 174

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 175 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 209

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 116 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 175

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 176 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 210

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 117 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 176

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 177 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 211

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 177

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 178 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 212

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 178

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 179 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 120 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 179

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 180 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 121 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 180

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 181 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 122 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 181

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 182 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 123 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 182

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 183 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 217

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 124 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 183

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 184 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 125 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 184

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 185 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 219

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 126 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 185

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 220

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 127 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 186

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 221

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 128 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 187

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 188 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 222

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 129 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 188

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 189 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 223

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 130 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 189

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 224

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 190

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 191 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 225

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 191

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 226

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 133 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 192

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 193 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 227

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 193

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 194 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 228

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 135 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 194

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 195 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 229

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 136 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 195

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 230

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 137 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 196

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 197 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 231

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 138 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 197

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 198 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 232

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 139 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 198

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 199 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 233

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 140 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 199

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 200 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 234

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 141 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 200

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 201 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 235

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 142 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 201

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 202 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 236

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 143 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 202

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 203 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 237

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 144 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 203

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 204 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 238

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 145 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 205 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 239

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 146 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 205

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 206 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 240

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 147 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 206

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 207 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 241

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 148 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 207

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 208 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 242

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 209 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 243

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 209

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 210 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 244

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 151 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 210

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 211 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 245

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 152 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 211

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 212 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 246

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 153 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 212

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 213 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 247

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 154 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 214 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 248

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 155 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 215 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 249

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 156 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 216 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 250

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 157 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 217 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 251

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 158 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 217

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 218 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 252

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 159 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 219 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 253

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 160 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 219

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 220 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 254

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 161 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 220

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 221 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 255

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 162 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 221

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 222 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 256

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 163 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 222

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 223 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 257

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 164 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 223

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 224 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 258

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 165 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 224

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 225 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 259

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 166 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 225

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 226 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 260

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 167 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 226

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 227 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 261

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 168 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 227

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 228 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 262

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 169 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 228

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 229 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 263

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 170 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 229

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 230 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 264

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 171 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 230

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 231 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 265

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 172 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 231

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 232 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 266

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 173 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 232

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 233 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 267

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 174 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 233

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 234 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 268

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 175 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 234

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 235 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 269

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 176 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 235

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 236 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 270

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 177 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 236

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 237 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 271

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 178 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 237

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 238 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 272

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 179 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 238

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 239 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 273

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 180 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 239

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 240 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 274

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 181 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 240

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 241 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 275

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 182 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 241

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 242 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 276

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 183 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 242

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 243 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 277

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 184 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 243

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 244 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 278

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 185 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 244

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 245 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 279

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 245

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 246 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 280

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 246

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 247 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 281

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 188 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 247

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 248 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 282

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 189 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 248

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 249 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 283

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 249

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 250 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 284

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 191 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 250

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 251 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 285

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 251

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 252 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 286

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 193 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 252

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 253 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 287

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 194 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 253

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 254 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 288

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 195 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 254

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 255 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 289

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 255

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 256 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 290

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 197 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 256

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 257 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 291

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 198 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 257

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 258 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 292

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 199 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 258

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 259 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 293

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 200 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 259

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 260 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 294

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 201 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 260

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 261 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 295

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 202 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 261

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 262 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 296

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 203 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 262

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 263 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 297

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 204 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 263

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 264 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 298

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 205 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 264

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 265 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 299

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 206 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 265

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 266 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 300

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 207 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 266

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 267 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 301

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 208 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 267

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 268 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 302

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 209 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 268

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 269 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 303

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 210 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 269

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 270 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 304

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 211 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 270

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 271 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 305

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 212 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 271

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 272 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 306

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 213 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 272

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 273 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 307

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 214 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 273

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 274 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 308

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 215 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 274

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 275 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 309

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 216 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 275

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 276 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 310

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 217 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 276

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 277 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 311

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 218 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 277

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 278 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 312

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 219 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 278

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 279 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 313

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 220 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 279

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 280 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 314

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 221 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 280

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 281 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 315

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 222 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 281

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 282 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 316

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 223 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 282

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 283 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 317

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 224 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 283

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 284 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 318

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 225 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 284

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 285 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 319

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 226 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 285

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 286 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 320

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 227 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 286

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 287 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 321

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 228 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 287

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 288 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 322

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 229 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 288

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 289 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 323

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 230 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 289

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 290 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 324

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 231 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 290

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 291 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 325

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 232 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 291

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 292 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 326

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 233 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 292

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 293 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 327

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 234 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 293

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 294 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 328

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 235 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 294

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 295 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 329

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 236 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 295

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 296 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 330

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 237 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 296

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 297 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 331

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 238 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 297

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 298 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 332

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 239 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 298

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 299 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 333

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 240 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 299

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 300 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 334

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 241 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 300

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 301 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 335

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 242 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 301

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 302 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 336

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 243 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 302

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 303 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 337

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 244 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 303

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 304 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 338

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 245 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 304

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 305 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 339

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 246 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 305

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 306 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 340

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 247 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 306

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 307 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 341

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 248 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 307

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 308 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 342

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 249 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 308

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 309 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 343

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 250 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 309

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 310 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 344

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 251 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 310

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 311 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 345

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 252 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 311

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 312 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 346

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 253 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 312

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 313 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 347

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 254 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 313

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 314 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 348

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 255 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 314

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 315 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 349

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 256 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 315

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 316 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 350

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 257 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 316

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 317 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 351

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 258 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 317

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 318 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 352

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 259 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 318

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 319 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 353

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 260 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 319

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 320 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 354

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 261 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 320

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 321 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 355

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 262 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 321

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 322 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 356

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 263 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 322

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 323 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 357

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 264 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 323

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 324 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 358

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 265 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 324

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 325 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 359

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 266 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 325

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 326 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 360

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 267 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 326

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 327 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 361

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 268 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 327

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 328 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 362

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 269 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 328

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 329 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 363

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 270 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 329

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 330 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 364

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 271 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 330

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 331 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 365

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 272 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 331

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 332 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 366

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 273 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 332

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 333 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 367

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 274 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 333

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 334 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 368

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 275 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 334

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 335 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 369

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 276 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 335

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 336 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 370

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 277 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 336

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 337 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 371

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/90 (53%), Positives = 58/90 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 285 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 344

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASN 608
           S  SSS++ SS+SSS  S SS S SS   N
Sbjct: 345 SSSSSSSSSSSSSSSSSSSSSSSSSSSGEN 374

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/91 (51%), Positives = 59/91 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 284 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 343

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNS 611
           S  SSS++ SS+SSS  S SS S SS +  +
Sbjct: 344 SSSSSSSSSSSSSSSSSSSSSSSSSSSSGEN 374

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = +3

Query: 375 VPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSST 554
           V S   +L +SSS  S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+
Sbjct: 56  VASFLNILDTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 115

Query: 555 SSSIFSISSLSLSSPASNSTSLS 623
           SSS  S SS S SS +S+S+S S
Sbjct: 116 SSSSSSSSSSSSSSSSSSSSSSS 138

[54][TOP]
>UniRef100_Q17RH7 Putative protein TPRXL n=1 Tax=Homo sapiens RepID=TPRXL_HUMAN
          Length = 258

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 53/98 (54%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATP--SRSS 509
           PSS   SSSP S   SSS   SSS+S  S S S S S+S +S+ SSSSSS ++P  S SS
Sbjct: 65  PSSSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSS 124

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S SP SSS++ SS+SSS  S  S S SSP+S+S+S S
Sbjct: 125 SSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSS 162

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 52/95 (54%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS PS   SSS+  SSSSS  S S   S  +S +S+ SS SSS ++PS SS S 
Sbjct: 145 SSPSSSSSSPS---SSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSPSSSSSSPSSSSSSP 201

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SP SSS + SS+S+S  S SS S SSP+S+S S S
Sbjct: 202 SPRSSSPSSSSSSTSSPSTSSPSSSSPSSSSPSSS 236

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 54/102 (52%), Positives = 65/102 (63%), Gaps = 1/102 (0%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSS-SSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           SSPS SSS  SP  SSS+  SSS SS  S S S S S S +S++SSSS S ++ S SS S
Sbjct: 81  SSPSSSSSTSSPSSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSS 140

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S  SS ++ SS+ SS  S SS S SSP+S+S S S  SP S
Sbjct: 141 SSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSS 182

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 52/97 (53%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS S SSS  SP  S+S+  SSSSS  S S S S S S +S++ SSSSS ++ S SS S
Sbjct: 92  PSSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSS 151

Query: 516 YSPPSSSTALSSTSSSIFSIS-SLSLSSPASNSTSLS 623
            SP SSS++ SS+SSS  S S S S SSP+S+++S S
Sbjct: 152 SSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSPS 188

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 52/101 (51%), Positives = 63/101 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS PS   SSS+  SSS S  S S S S S+S +S +SSSSSS ++PS SS S 
Sbjct: 95  SSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSP 154

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+S S  S SS   S  +SNS+  S  S PS
Sbjct: 155 SSSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSPSSSSSSPS 195

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 59/131 (45%), Positives = 78/131 (59%), Gaps = 6/131 (4%)
 Frame = +3

Query: 249 SWSIKCLYSSRLA------NGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSS 410
           S S KC   SR+A      +G  R   S    +L  SS  LSSS    +PSSS+  SS S
Sbjct: 13  SGSTKCRCGSRIAGPNALGSGGSRSSSSSSRSIL--SSSILSSS----IPSSSSSSSSPS 66

Query: 411 SIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSL 590
           S  S S   S  +S + ++SSS+SSP++ S SS S SP SS+++ SS+SSS  S SS S 
Sbjct: 67  SSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSS 126

Query: 591 SSPASNSTSLS 623
           SSP+S+S+S S
Sbjct: 127 SSPSSSSSSPS 137

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 52/100 (52%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS S SSSP S   SSS   S SSS  S S S S  +S +S++SSSS S +  S SS S
Sbjct: 56  PSSSSSSSSPSSSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSSPSSSNSSSSSSS 115

Query: 516 YSPPSSSTAL----SSTSSSIFSISSLSLSSPASNSTSLS 623
            SP SSS++     SS+SSS  S SS S SSP+S+S+S S
Sbjct: 116 SSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPS 155

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 52/101 (51%), Positives = 66/101 (65%), Gaps = 6/101 (5%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLL---SSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS 509
           SSPS SSS  S  PSSS+     SSSSS  S S S S  +S +S++SSSSSSP++ S SS
Sbjct: 116 SSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSS 175

Query: 510 *SYSPPSSSTALSSTSSSIFSISSL---SLSSPASNSTSLS 623
              SP SS+++ SS+SSS  S SS      SSP+S+S+S S
Sbjct: 176 SGSSPSSSNSSPSSSSSSPSSSSSSPSPRSSSPSSSSSSTS 216

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/102 (49%), Positives = 63/102 (61%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS + SSS  S  PSSS+  SSSS   S S   S S+S +S+ SSSSSSP++ S SS S
Sbjct: 104 PSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSS 163

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S   SS++ SS+ SS  S +S   SS +S S+S S  SP S
Sbjct: 164 SSSSPSSSSPSSSGSSPSSSNSSPSSSSSSPSSSSSSPSPRS 205

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 56/104 (53%), Positives = 65/104 (62%), Gaps = 3/104 (2%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSS-SSSPATPSRSS*S 515
           SSPS SSS  S  PSSS+   SSSS  S S S S S+S  S++ SS SSS ++PS SS S
Sbjct: 134 SSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSPSSSSSS 193

Query: 516 YSPPSSSTA--LSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S  SSS +   SS SSS  S SS S SSP+S+S S S  SP S
Sbjct: 194 PSSSSSSPSPRSSSPSSSSSSTSSPSTSSPSSSSPSSS--SPSS 235

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 52/105 (49%), Positives = 66/105 (62%)
 Frame = +3

Query: 327 LLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRS 506
           +L  S PS SSS  SP  SSS   SS SS  S S   S S++ + ++SSSSSS ++PS S
Sbjct: 50  ILSSSIPSSSSSSSSP--SSSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSSPSSS 107

Query: 507 S*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           + S S  SSS + SS+SSS  S  S S SSP+S+S+S S  S PS
Sbjct: 108 NSSSSSSSSSPSSSSSSSS--SSPSSSSSSPSSSSSSSS--SSPS 148

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 50/94 (53%), Positives = 59/94 (62%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS S SSS  S  PSSS   S SSS  S S S S  +S +S+ SSSSSSP+   RSS  
Sbjct: 154 PSSSSSSSSSSSSSPSSS---SPSSSGSSPSSSNSSPSSSSSSPSSSSSSPS--PRSS-- 206

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            SP SSS++ SS S+S  S SS S SSP+S+  S
Sbjct: 207 -SPSSSSSSTSSPSTSSPSSSSPSSSSPSSSCPS 239

 Score = 54.3 bits (129), Expect = 9e-06
 Identities = 40/76 (52%), Positives = 49/76 (64%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PSS S SSS  SP  S+S+  SSSSS  S S S S  +S  S++SSS+SSP+T S SS  
Sbjct: 168 PSSSSPSSSGSSPSSSNSSPSSSSSSPSSSSSSPSPRSSSPSSSSSSTSSPSTSSPSS-- 225

Query: 516 YSPPSSSTALSSTSSS 563
            S PSSS+  SS  S+
Sbjct: 226 -SSPSSSSPSSSCPSA 240

[55][TOP]
>UniRef100_A9VLA0 VrrB protein n=1 Tax=Bacillus weihenstephanensis KBAB4
           RepID=A9VLA0_BACWK
          Length = 383

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 40/118 (33%), Positives = 51/118 (43%), Gaps = 15/118 (12%)
 Frame = +1

Query: 331 YDHHHHHYH-----HHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLL 495
           ++HH HH H     HH HH +H  Q  +H HHQ  P   L  + H  HQ +  HH     
Sbjct: 167 HEHHGHHGHHQQHGHHQHHGHHQQQVHHHGHHQIHPQAVLYQTHHHGHQGQHQHHGHHGH 226

Query: 496 HLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQ--PRI--------QHHYRSFLHH 639
              H  H H       +HQHH  + Q  H   HHQ  P+         QHH++   HH
Sbjct: 227 QGQHQHHGH-----HGHHQHHGHHQQQVHHQGHHQIHPQAVLYQTHQGQHHHQGQHHH 279

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 34/102 (33%), Positives = 42/102 (41%), Gaps = 1/102 (0%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQRCYHL-HHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHS 513
           H HH +H HH H  HH Q+ +H  HHQ  P   L  +    H  +  HH +   H  H  
Sbjct: 230 HQHHGHHGHHQHHGHHQQQVHHQGHHQIHPQAVLYQTHQGQHHHQGQHHHQGQHH--HQG 287

Query: 514 HIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
             H      H  QHH    Q      HHQ   Q H++   HH
Sbjct: 288 QHHHQGQHHHQGQHHHQGQQHHQGQQHHQG--QQHHQGQQHH 327

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 38/108 (35%), Positives = 47/108 (43%), Gaps = 4/108 (3%)
 Frame = +1

Query: 328 YYDHHHHHY---HHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLH 498
           ++ HH HH    HHH HHQ H     Y  HH  G         H  HQ +  HH     H
Sbjct: 181 HHQHHGHHQQQVHHHGHHQIHPQAVLYQTHHH-GHQGQHQHHGHHGHQGQHQHHGHH-GH 238

Query: 499 LDHHSHIHRPLLPQHYHQHHP-AYSQSPHCHSHHQPRIQHHYRSFLHH 639
             HH H  + +  Q +HQ HP A     H   HH  + QHH++   HH
Sbjct: 239 HQHHGHHQQQVHHQGHHQIHPQAVLYQTHQGQHHH-QGQHHHQGQHHH 285

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 33/121 (27%), Positives = 48/121 (39%), Gaps = 7/121 (5%)
 Frame = +1

Query: 298 SVFFSLSFSSYYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALH 477
           +V +      +   H HH HH H  Q+ HH   +H HHQ           H  H  + +H
Sbjct: 204 AVLYQTHHHGHQGQHQHHGHHGHQGQHQHHG--HHGHHQ-----------HHGHHQQQVH 250

Query: 478 -------HPRRLLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLH 636
                  HP+ +L+  H    H     QH+HQ    +    H    H  + QHH++   H
Sbjct: 251 HQGHHQIHPQAVLYQTHQGQHHHQ--GQHHHQGQHHHQGQHHHQGQHHHQGQHHHQGQQH 308

Query: 637 H 639
           H
Sbjct: 309 H 309

 Score = 54.3 bits (129), Expect = 9e-06
 Identities = 32/111 (28%), Positives = 44/111 (39%), Gaps = 14/111 (12%)
 Frame = +1

Query: 346 HHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALH-------HPRRLLHLD 504
           H +H HH H   H    +H HHQ           H  H  + +H       HP+ +L+  
Sbjct: 155 HGHHEHHGHHGQHEHHGHHGHHQQHG-----HHQHHGHHQQQVHHHGHHQIHPQAVLYQT 209

Query: 505 HHSHIHRPLLPQH-------YHQHHPAYSQSPHCHSHHQPRIQHHYRSFLH 636
           HH H H+     H        HQHH  +    H H HHQ ++ H     +H
Sbjct: 210 HH-HGHQGQHQHHGHHGHQGQHQHHGHHGHHQH-HGHHQQQVHHQGHHQIH 258

[56][TOP]
>UniRef100_A5KBI5 Putative uncharacterized protein n=1 Tax=Plasmodium vivax
           RepID=A5KBI5_PLAVI
          Length = 376

 Score = 71.2 bits (173), Expect = 7e-11
 Identities = 50/162 (30%), Positives = 82/162 (50%), Gaps = 8/162 (4%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           G  G      VE    +E + EE +  LD+ ++   ++E  E D ++ D    ED+EE  
Sbjct: 207 GVKGRKKQRVVEQAVEEEEEEEEEDEGLDEDEEEGDDDEDDEDDDEEEDDDDEEDEEEDD 266

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSD-GDDGRSKKKKKEKRKRK--- 296
            +  D E D + D D  D+++D + DDD   D  +++    D+ R K K+K+KR ++   
Sbjct: 267 DEEDDEEEDDEEDDDDHDEDEDEDEDDDHDDDNDEEEEHLEDEPRRKAKRKQKRAKEYVD 326

Query: 295 -SPFASLEEYKHLIDQDEKED---SKTKRKATSEPTKKKKKK 182
                +L E   L D+DE E+   S T++++T    KK KKK
Sbjct: 327 GEHIRALREEGKLFDEDEVEEFDGSFTRKRSTKAGGKKGKKK 368

[57][TOP]
>UniRef100_Q54MG0 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
           RepID=Q54MG0_DICDI
          Length = 224

 Score = 70.9 bits (172), Expect = 9e-11
 Identities = 55/111 (49%), Positives = 69/111 (62%)
 Frame = +3

Query: 291 GDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATS 470
           G F  +      LL  SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S
Sbjct: 57  GGFSLVIETSRNLLSYSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 116

Query: 471 SSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 117 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 167

 Score = 70.9 bits (172), Expect = 9e-11
 Identities = 61/134 (45%), Positives = 77/134 (57%)
 Frame = +3

Query: 222 LLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLS 401
           LL + SS SS S     SS  ++       S        SS S SSS  S   SSS+  S
Sbjct: 69  LLSYSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 128

Query: 402 SSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISS 581
           SSSS  S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS
Sbjct: 129 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 188

Query: 582 LSLSSPASNSTSLS 623
            S SS +S+S+S S
Sbjct: 189 SSSSSSSSSSSSSS 202

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 60/135 (44%), Positives = 77/135 (57%)
 Frame = +3

Query: 219 FLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLL 398
           F LV E+S +  S     SS  ++       S        SS S SSS  S   SSS+  
Sbjct: 59  FSLVIETSRNLLSYSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 118

Query: 399 SSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSIS 578
           SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S S
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 178

Query: 579 SLSLSSPASNSTSLS 623
           S S SS +S+S+S S
Sbjct: 179 SSSSSSSSSSSSSSS 193

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 109 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 168

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 169 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 203

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 110 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 169

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 170 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/101 (49%), Positives = 62/101 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 174

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+SSS  S SS S SS +S+         PS
Sbjct: 175 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGAEKDEMISPS 215

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/99 (50%), Positives = 61/99 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 178

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSP 635
           S  SSS++ SS+SSS  S SS S SS A     +S   P
Sbjct: 179 SSSSSSSSSSSSSSSSSSSSSSSSSSGAEKDEMISPSKP 217

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 50/101 (49%), Positives = 62/101 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 177

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+SSS  S SS S SS  +    +   S PS
Sbjct: 178 SSSSSSSSSSSSSSSSSSSSSSSSSSSGAEKDEMISPSKPS 218

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 44/91 (48%), Positives = 56/91 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 190

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNS 611
           S  SSS++ SS+SS       +S S P+  S
Sbjct: 191 SSSSSSSSSSSSSSGAEKDEMISPSKPSIKS 221

[58][TOP]
>UniRef100_Q6FTA2 Similar to uniprot|P20840 Saccharomyces cerevisiae YJR004c SAG1
           alpha-agglutinin n=1 Tax=Candida glabrata
           RepID=Q6FTA2_CANGA
          Length = 763

 Score = 70.9 bits (172), Expect = 9e-11
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISA-SLTSATSSSSSSPATPSRSS*S 515
           SS S SSSP S   SSS+  SSSSS  S S S S S+ S+TS++SSSSSS ++ S SS S
Sbjct: 397 SSSSSSSSPSSSSSSSSSTSSSSSSSSSSSTSSSTSSISITSSSSSSSSSSSSSSSSSSS 456

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S  +S++++SS+SSS  S SS S SS  S+STS
Sbjct: 457 SSSSTSTSSISSSSSSTNSSSSSSSSSSTSSSTS 490

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 46/86 (53%), Positives = 62/86 (72%)
 Frame = +3

Query: 366 PSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTAL 545
           PS + SSS+  SSSSS    + S+SI++S +S++SSSSSSP++ S SS S S  SSS++ 
Sbjct: 369 PSRISSSSSSTSSSSS----TSSISITSSSSSSSSSSSSSPSSSSSSSSSTSSSSSSSSS 424

Query: 546 SSTSSSIFSISSLSLSSPASNSTSLS 623
           SSTSSS  SIS  S SS +S+S+S S
Sbjct: 425 SSTSSSTSSISITSSSSSSSSSSSSS 450

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 50/95 (52%), Positives = 65/95 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S++SS  S   SSS+  SSSSS  S S S S S+S +S+TSSS+SS +  S SS S 
Sbjct: 386 SSISITSSSSSSSSSSSSSPSSSSS-SSSSTSSSSSSSSSSSTSSSTSSISITSSSSSSS 444

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS+S SS ++NS+S S
Sbjct: 445 SSSSSSSSSSSSSSSSTSTSSISSSSSSTNSSSSS 479

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 50/104 (48%), Positives = 67/104 (64%), Gaps = 8/104 (7%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATP------ 497
           PSS S SSS  S   SSS+  S+SSS  S+S++ S S+S +S++SSSSSS ++       
Sbjct: 405 PSSSSSSSSSTSSSSSSSSSSSTSSSTSSISITSSSSSSSSSSSSSSSSSSSSSSSTSTS 464

Query: 498 --SRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             S SS S +  SSS++ SSTSSS  SIS  S SS +S+S+S S
Sbjct: 465 SISSSSSSTNSSSSSSSSSSTSSSTSSISITSSSSSSSSSSSSS 508

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S  PSSS+  SSS+S  S S S S ++S TS+ S +SSS ++ S SS S 
Sbjct: 392 SSSSSSSSSSSSSPSSSSSSSSSTSSSSSSSSSSSTSSSTSSISITSSSSSSSSSSSSSS 451

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +STSS   S SS + SS +S+S+S S
Sbjct: 452 SSSSSSSSSTSTSSISSSSSSTNSSSSSSSSSSTS 486

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 50/96 (52%), Positives = 63/96 (65%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPS-PVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           SS S SSS  S  + SSS+  SSSSS  S S S S S++ TS+ SSSSSS  + S SS S
Sbjct: 423 SSSSTSSSTSSISITSSSSSSSSSSSSSSSSSSSSSSSTSTSSISSSSSSTNSSSSSSSS 482

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS++++S TSSS  S SS S SS +S+S+S S
Sbjct: 483 SSTSSSTSSISITSSSSSSSSSSSSSSSSSSSSSSS 518

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S S   SSSSS  S S S S S+S +S+TS+SS S ++ S +S S 
Sbjct: 419 SSSSSSSSTSSSTSSISITSSSSSSSSSSSSSSSSSSSSSSSTSTSSISSSSSSTNSSSS 478

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSST+ S++S SI S SS S SS +S+S+S S
Sbjct: 479 SSSSSSTSSSTSSISITSSSSSSSSSSSSSSSSSS 513

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+S  S+S S S + S +S++SSSS+S +T S S  S 
Sbjct: 438 SSSSSSSSSSSSSSSSSSSSSSSTSTSSISSSSSSTNSSSSSSSSSSTSSSTSSISITSS 497

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS+S SS  ++S S S
Sbjct: 498 SSSSSSSSSSSSSSSSSSSSSISTSSSPNSSGSFS 532

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 49/105 (46%), Positives = 67/105 (63%), Gaps = 4/105 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S +  +S+  SSSSS  S S S S S+S TS +S SSSS +T S SS S 
Sbjct: 422 SSSSSTSSSTSSISITSSSSSSSSSSSSSSSSSSSSSSSTSTSSISSSSSSTNSSSSSSS 481

Query: 519 SPPSSST----ALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  +SS+    +++S+SSS  S SS S SS +S+S+S+S  S P+
Sbjct: 482 SSSTSSSTSSISITSSSSSSSSSSSSSSSSSSSSSSSISTSSSPN 526

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/97 (48%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +3

Query: 339 SSPSLSS--SPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           SS S+S+  S   P  S S + SSSSS  S S + SIS + +S++SSSSSS ++PS SS 
Sbjct: 352 SSESISTVISTVCPHCSPSRISSSSSSTSSSSSTSSISIT-SSSSSSSSSSSSSPSSSSS 410

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  SSS++ SS+SS+  S SS+S++S +S+S+S S
Sbjct: 411 SSSSTSSSSSSSSSSSTSSSTSSISITSSSSSSSSSS 447

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 52/103 (50%), Positives = 61/103 (59%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS S S+S  S   S S   SSSSS  S S S S S+S +S+TSSSSSS ++ S SS 
Sbjct: 371 RISSSSSSTSSSSSTSSISITSSSSSSSSSSSSSPSSSSSSSSSTSSSSSSSSSSSTSS- 429

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
             S  S S   SS+SSS  S SS S SS +S+STS S  S  S
Sbjct: 430 --STSSISITSSSSSSSSSSSSSSSSSSSSSSSTSTSSISSSS 470

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 377 SSTSSSSSTSSISITSSSSSSSSSSSSSPSSSSSSSSSTSSSSSSSSSSSTSSSTSSISI 436

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S +S +S S+S S
Sbjct: 437 TSSSSSSSSSSSSSSSSSSSSSSSTSTSSISSSSS 471

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 44/95 (46%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   +SS  ++SSSS  S S S S S+S +S++S+S+SS ++ S S+ S 
Sbjct: 417 SSSSSSSSSSTSSSTSSISITSSSSSSSSSSSSSSSSSSSSSSSTSTSSISSSSSSTNSS 476

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS++SSI   SS S SS +S+S+S S
Sbjct: 477 SSSSSSSSTSSSTSSISITSSSSSSSSSSSSSSSS 511

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 46/93 (49%), Positives = 59/93 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SS S  S S + S S+S +S+TSSS+SS +  S SS S 
Sbjct: 443 SSSSSSSSSSSSSSSSSSTSTSSISSSSSSTNSSSSSSSSSSTSSSTSSISITSSSSSSS 502

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S SS   SS + +STS
Sbjct: 503 SSSSSSSSSSSSSSSSISTSSSPNSSGSFSSTS 535

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 45/95 (47%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS  S S S S S+   +++SSSSSS ++ S SS S 
Sbjct: 455 SSSSSSTSTSSISSSSSSTNSSSSSSSSSSTSSSTSSISITSSSSSSSSSSSSSSSSSSS 514

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S ST+ S  SS  FS +S   S+P ++STSL+
Sbjct: 515 SSSSISTSSSPNSSGSFSSTSSIQSTPYTSSTSLT 549

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 48/101 (47%), Positives = 59/101 (58%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S  S SSS  S   SSS+  SSSSS  S S   S S+S  S++SSSSSS  + S SS S 
Sbjct: 435 SITSSSSSSSSSSSSSSSSSSSSSSSTSTSSISSSSSSTNSSSSSSSSSSTSSSTSSISI 494

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           +  SSS++ SS+SSS  S SS S  S +S+  S   FS  S
Sbjct: 495 TSSSSSSSSSSSSSSSSSSSSSSSISTSSSPNSSGSFSSTS 535

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 47/102 (46%), Positives = 63/102 (61%), Gaps = 7/102 (6%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSR----- 503
           SS + SSS  S +  +S+  SSSSS  S   S S S+S TS++SSSSSS +T S      
Sbjct: 376 SSSTSSSSSTSSISITSSSSSSSSSSSSSPSSSSSSSSSTSSSSSSSSSSSTSSSTSSIS 435

Query: 504 --SS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SS S S  SSS++ SS+SSS  S S+ S+SS +S++ S S
Sbjct: 436 ITSSSSSSSSSSSSSSSSSSSSSSSTSTSSISSSSSSTNSSS 477

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 45/94 (47%), Positives = 59/94 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSST  SS SS  S + S S S+S +S +SS+SS   T S SS S 
Sbjct: 444 SSSSSSSSSSSSSSSSSTSTSSISSSSSSTNSSSSSSSSSSTSSSTSSISITSSSSSSSS 503

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSL 620
           S  SSS++ SS+SSSI + SS + S   S+++S+
Sbjct: 504 SSSSSSSSSSSSSSSISTSSSPNSSGSFSSTSSI 537

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/94 (47%), Positives = 61/94 (64%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           SPS  SS  S   SSS+  S S +  S S S S S+S +S++SSSSS+ ++ S SS S S
Sbjct: 368 SPSRISSSSSSTSSSSSTSSISITSSSSSSSSSSSSSPSSSSSSSSSTSSSSSSSS-SSS 426

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SS++++S TSSS  S SS S SS +S+S+S S
Sbjct: 427 TSSSTSSISITSSSSSSSSSSSSSSSSSSSSSSS 460

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 9/95 (9%)
 Frame = +3

Query: 366 PSPVPSSSTLLSS-SSSIRSMSMSVSIS--------ASLTSATSSSSSSPATPSRSS*SY 518
           P+ VPS S L+SS SSS  S S+S  IS        + ++S++SS+SSS +T S S  S 
Sbjct: 334 PASVPSPSKLISSLSSSTSSESISTVISTVCPHCSPSRISSSSSSTSSSSSTSSISITSS 393

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 394 SSSSSSSSSSSPSSSSSSSSSTSSSSSSSSSSSTS 428

[59][TOP]
>UniRef100_A7TPB7 Putative uncharacterized protein n=1 Tax=Vanderwaltozyma polyspora
           DSM 70294 RepID=A7TPB7_VANPO
          Length = 228

 Score = 70.9 bits (172), Expect = 9e-11
 Identities = 43/108 (39%), Positives = 53/108 (49%), Gaps = 7/108 (6%)
 Frame = +1

Query: 340 HHH--HYHHHHHHQYHHH--QRCYHL---HHQSGPCPCLCPSLHRSHQPRALHHPRRLLH 498
           HHH  H HHHH HQ+ HH  Q  +H+   HH +   P +   LH  H  + LHH  +L  
Sbjct: 65  HHHPIHQHHHHTHQHPHHIRQLLHHIHLPHHHTLQPPQVTVQLHH-HIHQHLHHTHQL-- 121

Query: 499 LDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHHL 642
              H HIH+ LL      HHP      H H HH  +  HH R  LHH+
Sbjct: 122 ---HHHIHQ-LLQVIVQHHHPI-----HQHHHHTHQHPHHIRQLLHHI 160

[60][TOP]
>UniRef100_B9PS22 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1
            RepID=B9PS22_TOXGO
          Length = 2306

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 60/134 (44%), Positives = 78/134 (58%), Gaps = 10/134 (7%)
 Frame = +3

Query: 270  YSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISA 449
            + +RL++     L        + SSPS SSS  S   SSS+  SSSSS  S S S S S+
Sbjct: 1533 FLTRLSSAPHLSLLRSLLLFEQKSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 1592

Query: 450  SLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLS------SPASN- 608
            S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S S      SP+S+ 
Sbjct: 1593 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSCSPSCSPSSSS 1652

Query: 609  ---STSLS*FSPPS 641
               S+S S FS PS
Sbjct: 1653 CSPSSSCSPFSSPS 1666

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/93 (50%), Positives = 57/93 (61%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 1575 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 1634

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S PSSS+   S S S  S S  S  SP S+ +S
Sbjct: 1635 SSPSSSSCSPSCSPSSSSCSPSSSCSPFSSPSS 1667

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 47/94 (50%), Positives = 58/94 (61%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 1576 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 1635

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSL 620
            SP SSS + S + SS     S S S  +S S+SL
Sbjct: 1636 SPSSSSCSPSCSPSSSSCSPSSSCSPFSSPSSSL 1669

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 49/118 (41%), Positives = 65/118 (55%), Gaps = 22/118 (18%)
 Frame = +3

Query: 336  PSSPSLSSSPPSPV-------------PSSSTLLSSSSSIRSMSMSVSI---------SA 449
            PSS S  SS PSP              P SS+ L+  SS   +S+  S+         S 
Sbjct: 1501 PSSTSSLSSSPSPSSSLDWSEMPSVASPVSSSFLTRLSSAPHLSLLRSLLLFEQKSSPSP 1560

Query: 450  SLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 1561 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 1618

[61][TOP]
>UniRef100_B1N4C0 Serine-rich protein C30B4.01c, putative n=1 Tax=Entamoeba
           histolytica HM-1:IMSS RepID=B1N4C0_ENTHI
          Length = 175

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 63/154 (40%), Positives = 84/154 (54%)
 Frame = +3

Query: 180 FFFFFFFVGSDVAFLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSS 359
           F  F  F+G+         SS +S+S     SS  ++       S        SS S SS
Sbjct: 11  FLTFCLFLGAS--------SSSNSYSYSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 62

Query: 360 SPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSST 539
           S  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S  SSS+
Sbjct: 63  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 122

Query: 540 ALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           + SS+SSS  S SS S SS +S+S+S + +S  S
Sbjct: 123 SSSSSSSSSSSSSSSSSSSSSSSSSSSNSYSSSS 156

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 55/114 (48%), Positives = 71/114 (62%)
 Frame = +3

Query: 282 LANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTS 461
           L+N    ++F  F   L  SS S S S  S   SSS+  SSSSS  S S S S S+S +S
Sbjct: 2   LSNFLIVWIFLTFCLFLGASSSSNSYSYSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 61

Query: 462 ATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           ++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 62  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 115

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/95 (53%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 69  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 128

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S ST  S
Sbjct: 129 SSSSSSSSSSSSSSSSSSSSSNSYSSSSSYSTLFS 163

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 51/95 (53%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 63  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 122

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S S+S S
Sbjct: 123 SSSSSSSSSSSSSSSSSSSSSSSSSSSNSYSSSSS 157

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 50/98 (51%), Positives = 65/98 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 66  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 125

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FS 632
           S  SSS++ SS+SSS  S SS S +S +S+S+  + FS
Sbjct: 126 SSSSSSSSSSSSSSSSSSSSSSSSNSYSSSSSYSTLFS 163

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 80  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 139

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++ SS  S S+L  SS   +S S+S
Sbjct: 140 SSSSSSSSSSNSYSSSSSYSTLFSSSLPFSSNSIS 174

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 75  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 134

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS    SS S S+  S+S   S
Sbjct: 135 SSSSSSSSSSSSSSSNSYSSSSSYSTLFSSSLPFS 169

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/92 (51%), Positives = 59/92 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 74  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 133

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNST 614
           S  SSS++ SS+SSS  S SS S  S   +S+
Sbjct: 134 SSSSSSSSSSSSSSSSNSYSSSSSYSTLFSSS 165

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 45/91 (49%), Positives = 57/91 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 85  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 144

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNS 611
           S  SS++  SS+S S    SSL  SS + +S
Sbjct: 145 SSSSSNSYSSSSSYSTLFSSSLPFSSNSISS 175

[62][TOP]
>UniRef100_B5UNU6 VrrB protein n=1 Tax=Bacillus cereus AH1134 RepID=B5UNU6_BACCE
          Length = 307

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 42/124 (33%), Positives = 51/124 (41%), Gaps = 20/124 (16%)
 Frame = +1

Query: 328 YYDHHHHHYHHHH-----HHQYHHHQ--RCYH-LHHQSGPCPCLCPSLHRSHQPRALHHP 483
           +++HHHHH HHHH     HH +HHHQ  + +H  HH  G         H+ HQ +  HH 
Sbjct: 132 HHEHHHHHGHHHHQGHHGHHGHHHHQGHQGHHGHHHHQGHHGHHHHQDHQGHQQQVHHHG 191

Query: 484 RRLLHLD------------HHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRS 627
              +H              HH H H      H   HH    Q  H H  HQ   QHH   
Sbjct: 192 HHHIHPQAVLYQTHQGQHGHHGHHHHGQHHGHQGHHHHQGHQGQHGHHGHQG--QHHGHQ 249

Query: 628 FLHH 639
             HH
Sbjct: 250 GQHH 253

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 39/113 (34%), Positives = 48/113 (42%), Gaps = 10/113 (8%)
 Frame = +1

Query: 331 YDHHHHHYHH-HHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH 507
           + HH HH+HH HHHHQ HH    +H HH            H+ HQ    HH  +  H  H
Sbjct: 130 HGHHEHHHHHGHHHHQGHHG---HHGHHH-----------HQGHQGHHGHHHHQGHHGHH 175

Query: 508 HSHIHRPLLPQ-HYHQHHPAYSQS--------PHCHSHHQPRIQHHYRSFLHH 639
           H   H+    Q H+H HH  + Q+         H H  H    QHH     HH
Sbjct: 176 HHQDHQGHQQQVHHHGHHHIHPQAVLYQTHQGQHGHHGHHHHGQHHGHQGHHH 228

[63][TOP]
>UniRef100_Q7RCY6 Putative uncharacterized protein PY05640 n=1 Tax=Plasmodium yoelii
           yoelii RepID=Q7RCY6_PLAYO
          Length = 235

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 44/149 (29%), Positives = 71/149 (47%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           +G E+ + D + +  DE D+E+ ++  DD DD+  +++  + D DD D    +DDE+   
Sbjct: 96  EGREDDEEDEDDDDDDEDDDEDDDDEDDDDDDDDDDDDDDDDDDDDDDDEEDDDDEDDDD 155

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
           D  D +   D D D  DDED  ++DDD   D  DDD D DD   +  + ++         
Sbjct: 156 DDDDDDDGDDDDDDDDDDEDFEDMDDDDDDDDDDDDDDEDDDEDEDDEDDE--------- 206

Query: 280 LEEYKHLIDQDEKEDSKTKRKATSEPTKK 194
                   D+D++ED    +K      KK
Sbjct: 207 --------DEDDEEDDDDSKKEGGSNAKK 227

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 47/154 (30%), Positives = 70/154 (45%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D G + D+  +F   D S+N++ E   DD +D   +++  + D DD D    +DD++   
Sbjct: 74  DDGNDEDALKKFSV-DTSENDDEEGREDDEEDEDDDDDDEDDDEDDDDEDDDDDDDDDDD 132

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
           D  D + D D D +  DDEDD++ DDD   DG DDD D DD    +   +          
Sbjct: 133 DDDDDDDDDDDDEEDDDDEDDDD-DDDDDDDGDDDDDDDDDDEDFEDMDDDDDDDDDDDD 191

Query: 280 LEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKK 179
            +E     D DE ED +       E      KK+
Sbjct: 192 DDE-----DDDEDEDDEDDEDEDDEEDDDDSKKE 220

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 39/110 (35%), Positives = 61/110 (55%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  ++ D D + +  D+ D+EE ++  DD DD+  +++G + D DD D    ED E++  
Sbjct: 125 DDDDDDDDDDDDDDDDDDDDEEDDDDEDDDDDDDDDDDGDDDDDDDDDD---EDFEDMDD 181

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKE 311
           D  D + D D D D  +DEDD + D+D   +  DDDS  + G + KK  E
Sbjct: 182 DDDDDDDDDDDDEDDDEDEDDED-DEDEDDEEDDDDSKKEGGSNAKKDSE 230

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 42/139 (30%), Positives = 63/139 (45%), Gaps = 7/139 (5%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENML-------DDVDDNAVEEEGGEYDYDDLDGVAGEDDE 473
           E  + D+E E  D+ ++E+            DD +    +EE  + D DD D    +DDE
Sbjct: 62  EKKNKDIENEDDDDGNDEDALKKFSVDTSENDDEEGREDDEEDEDDDDDDEDDDEDDDDE 121

Query: 472 ELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKS 293
           +   D  D + D D D D  DD+DD+  DDD   D  DDD D DDG       +      
Sbjct: 122 D---DDDDDDDDDDDDDDDDDDDDDDEEDDDDE-DDDDDDDDDDDGDDDDDDDDDD---- 173

Query: 292 PFASLEEYKHLIDQDEKED 236
                E+++ + D D+ +D
Sbjct: 174 -----EDFEDMDDDDDDDD 187

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 5/106 (4%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  ++ D D + E  D+ D+++ ++  DD DD+  +++  E D++D+D    +DD++   
Sbjct: 134 DDDDDDDDDDDEEDDDDEDDDDDDDDDDDGDDDDDDDDDDE-DFEDMDDDDDDDDDD--- 189

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGG-----DDDSDGDD 338
           D  D + D D D +  +DEDD   DDD   +GG     D + +G D
Sbjct: 190 DDDDEDDDEDEDDEDDEDEDDEEDDDDSKKEGGSNAKKDSEDEGFD 235

[64][TOP]
>UniRef100_UPI0000F2AF41 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica
           RepID=UPI0000F2AF41
          Length = 465

 Score = 70.1 bits (170), Expect = 2e-10
 Identities = 52/97 (53%), Positives = 65/97 (67%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS 
Sbjct: 44  RSSSSSHSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 103

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 104 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 140

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 51  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 110

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 111 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 145

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 52  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 111

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 112 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 146

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 53  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 112

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 113 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 147

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 54  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 113

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 114 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 148

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 55  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 114

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 149

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 56  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 115

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 116 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 150

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 57  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 116

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 117 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 151

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 58  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 117

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 152

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 59  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 118

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 153

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 60  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 119

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 120 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 154

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 61  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 120

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 121 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 155

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 62  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 121

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 122 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 156

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 63  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 122

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 123 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 157

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 64  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 123

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 124 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 158

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 65  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 124

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 125 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 159

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 66  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 125

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 126 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 160

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 67  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 126

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 127 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 161

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 68  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 127

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 128 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 162

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 69  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 128

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 129 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 163

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 70  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 129

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 130 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 164

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 71  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 130

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 165

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 72  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 131

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 166

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 73  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 132

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 133 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 167

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 74  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 133

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 168

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 75  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 134

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 135 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 169

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 76  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 135

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 136 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 170

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 77  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 136

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 137 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 171

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 78  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 137

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 138 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 172

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 79  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 138

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 139 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 173

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 80  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 139

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 140 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 174

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 81  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 140

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 141 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 175

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 82  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 141

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 142 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 176

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 83  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 142

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 143 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 177

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 84  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 143

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 144 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 178

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 85  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 144

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 145 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 179

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 86  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 145

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 146 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 180

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 87  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 146

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 147 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 181

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 88  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 147

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 148 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 182

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 89  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 148

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 183

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 90  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 149

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 184

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 91  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 150

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 151 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 185

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 92  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 151

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 152 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 186

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 93  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 152

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 153 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 187

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 94  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 153

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 154 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 188

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 95  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 154

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 155 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 189

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 96  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 155

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 156 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 190

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 97  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 156

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 157 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 191

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 98  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 157

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 158 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 192

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 99  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 158

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 159 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 193

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 100 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 159

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 160 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 194

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 101 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 160

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 161 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 195

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 102 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 161

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 162 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 196

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 103 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 162

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 163 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 197

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 104 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 163

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 164 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 198

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 105 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 164

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 165 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 199

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 106 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 165

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 166 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 200

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 107 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 166

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 167 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 201

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 108 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 167

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 168 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 202

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 109 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 168

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 169 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 203

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 110 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 169

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 170 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 111 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 170

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 171 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 205

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 112 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 171

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 172 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 206

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 113 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 172

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 173 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 207

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 114 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 173

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 174 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 174

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 175 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 209

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 116 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 175

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 176 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 210

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 117 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 176

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 177 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 211

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 177

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 178 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 212

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 178

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 179 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 120 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 179

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 180 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 121 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 180

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 181 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 122 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 181

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 182 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 123 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 182

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 183 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 217

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 124 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 183

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 184 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 125 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 184

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 185 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 219

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 126 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 185

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 220

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 127 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 186

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 221

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 128 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 187

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 188 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 222

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 129 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 188

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 189 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 223

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 130 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 189

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 224

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 190

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 191 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 225

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 191

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 226

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 133 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 192

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 193 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 227

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 193

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 194 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 228

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 135 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 194

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 195 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 229

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 136 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 195

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 230

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 137 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 196

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 197 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 231

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 138 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 197

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 198 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 232

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 139 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 198

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 199 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 233

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 140 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 199

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 200 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 234

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 141 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 200

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 201 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 235

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 142 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 201

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 202 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 236

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 143 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 202

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 203 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 237

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 144 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 203

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 204 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 238

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 145 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 205 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 239

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 146 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 205

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 206 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 240

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 147 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 206

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 207 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 241

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 148 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 207

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 208 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 242

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 209 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 243

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 209

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 210 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 244

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 50/94 (53%), Positives = 64/94 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 152 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 211

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSL 620
           S  SSS++ SS+SSS  S SS S SS +S+S+S+
Sbjct: 212 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSI 245

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 48  SSHSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 107

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 108 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 142

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 42  SSRSSSSSHSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 101

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 102 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 136

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS   SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 47  SSSHSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 106

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 107 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 141

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S  S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 49  SHSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 108

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 109 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 143

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/99 (50%), Positives = 65/99 (65%)
 Frame = +3

Query: 327 LLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRS 506
           +L  +S   SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S
Sbjct: 37  MLAGTSSRSSSSSHSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 96

Query: 507 S*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 97  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 135

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 42/96 (43%), Positives = 59/96 (61%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           PS   +   P S +      + + +S RS S S S S+S +S++SSSSSS ++ S SS S
Sbjct: 17  PSRLDILHYPLSAIVIEDGTMLAGTSSRSSSSSHSSSSSSSSSSSSSSSSSSSSSSSSSS 76

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 77  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 112

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 40/83 (48%), Positives = 55/83 (66%)
 Frame = +3

Query: 375 VPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSST 554
           V    T+L+ +SS  S S   S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+
Sbjct: 31  VIEDGTMLAGTSSRSSSSSHSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 90

Query: 555 SSSIFSISSLSLSSPASNSTSLS 623
           SSS  S SS S SS +S+S+S S
Sbjct: 91  SSSSSSSSSSSSSSSSSSSSSSS 113

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 40/76 (52%), Positives = 51/76 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 171 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 230

Query: 519 SPPSSSTALSSTSSSI 566
           S  SSS++ SS+SS +
Sbjct: 231 SSSSSSSSSSSSSSIV 246

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 39/83 (46%), Positives = 54/83 (65%)
 Frame = +3

Query: 375 VPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSST 554
           +   + L  +SS   S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+
Sbjct: 32  IEDGTMLAGTSSRSSSSSHSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 91

Query: 555 SSSIFSISSLSLSSPASNSTSLS 623
           SSS  S SS S SS +S+S+S S
Sbjct: 92  SSSSSSSSSSSSSSSSSSSSSSS 114

[65][TOP]
>UniRef100_C4LXN3 Putative uncharacterized protein n=1 Tax=Entamoeba histolytica
           HM-1:IMSS RepID=C4LXN3_ENTHI
          Length = 211

 Score = 70.1 bits (170), Expect = 2e-10
 Identities = 42/104 (40%), Positives = 59/104 (56%), Gaps = 3/104 (2%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEE---EGGEYDYDDLDGVAGEDDEE 470
           D  ++ D D + +  D+ D++E ++  DD DD+  EE   E  ++DYDD D    E+DEE
Sbjct: 98  DEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDEEYDLEDDDFDYDDDDDFELEEDEE 157

Query: 469 LVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
              +  D E D D D D  DDEDD++ DDD   D  +DD D DD
Sbjct: 158 DDDEEEDDE-DEDDDDDEDDDEDDDDEDDDEDEDDDEDDDDEDD 200

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 31/101 (30%), Positives = 58/101 (57%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  ++ D D + +  D+ D++E ++  DD DD+  ++E  + D D+ D    ++DEE   
Sbjct: 78  DEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDEEYDL 137

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
           +  D + D D D +L +DE+D++ ++D   +  DDD D D+
Sbjct: 138 EDDDFDYDDDDDFELEEDEEDDDEEEDDEDEDDDDDEDDDE 178

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 34/101 (33%), Positives = 56/101 (55%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  ++ D D + +  D+ D++E ++  DD DD+  ++E  EYD +D D    +DD++   
Sbjct: 94  DEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDEEYDLED-DDFDYDDDDDFEL 152

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
           +  + + D + D +  DD+DD   DDD   D  DDD D DD
Sbjct: 153 EEDEEDDDEEEDDEDEDDDDDE--DDDEDDDDEDDDEDEDD 191

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 36/134 (26%), Positives = 71/134 (52%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
           EN D ++  E  D+ + ++ +   DD DD   +E+  E D +D D    EDD+E   +  
Sbjct: 31  ENND-ELNIEDNDDEEYDDDDEEYDDDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDD 89

Query: 451 DAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEE 272
           D + D D D D  +D+D+++ +DD   D  DDD D D+   + ++ +       +   ++
Sbjct: 90  DEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDEEYDLEDDDFDYDDDDD 149

Query: 271 YKHLIDQDEKEDSK 230
           ++  +++DE++D +
Sbjct: 150 FE--LEEDEEDDDE 161

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 33/101 (32%), Positives = 57/101 (56%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  E  D D E++  D+ D++E ++  DD DD+  ++E  + D D+ D    EDD+E   
Sbjct: 42  DDEEYDDDDEEYDDDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDD---EDDDEDDD 98

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
           +  D + D D D D  +D+D+++ +DD   D  D++ D +D
Sbjct: 99  EDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDEEYDLED 139

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 36/89 (40%), Positives = 48/89 (53%), Gaps = 6/89 (6%)
 Frame = -1

Query: 586 DNEEIENM----LDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAEMDTDMDMD 419
           DN+E EN     ++D DD   +++  EYD DD +    +DDE+   D  D + D D D D
Sbjct: 26  DNKETENNDELNIEDNDDEEYDDDDEEYDDDDDEDDDEDDDED---DDEDDDEDDDEDDD 82

Query: 418 LIDDEDDNNVDD--DGTGDGGDDDSDGDD 338
             DDEDD+  DD  D   D  DDD D D+
Sbjct: 83  EDDDEDDDEDDDEDDDEDDDEDDDEDDDE 111

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 44/135 (32%), Positives = 67/135 (49%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  ++ D D + +  D+ D++E ++  DD DD+  ++E  + D D+ D    EDD+E   
Sbjct: 54  DDDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDDDEDD---DEDDDE--D 108

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
           D  D + D D D D  DDEDD   D+D   D  DDD D DD    + ++++         
Sbjct: 109 DDEDDDEDDDEDDDEDDDEDD---DEDEEYDLEDDDFDYDDDDDFELEEDEEDDDE---- 161

Query: 280 LEEYKHLIDQDEKED 236
            EE     D D+ ED
Sbjct: 162 -EEDDEDEDDDDDED 175

[66][TOP]
>UniRef100_UPI00015539A6 PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI00015539A6
          Length = 372

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 93  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 152

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 153 SSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCS 187

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 81  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 140

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 141 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCS 175

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 91  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 150

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 151 SSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSS 185

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 8   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 67

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 68  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 102

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 9   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 68

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 69  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 103

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 10  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 69

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 70  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 104

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 11  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 70

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 71  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 105

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 12  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 71

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 72  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 106

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 13  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 72

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 73  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 107

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 14  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 73

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 74  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 108

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 15  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 74

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 75  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 109

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 16  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 75

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 76  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 110

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 17  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 76

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 77  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 111

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 18  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 77

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 78  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 112

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 19  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 78

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 79  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 113

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 20  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 79

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 80  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 114

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 21  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 80

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 81  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 115

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 22  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 81

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 82  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 116

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 23  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 82

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 83  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 117

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 24  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 83

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 84  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 118

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 25  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 84

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 85  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 119

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 26  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 85

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 86  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 120

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 27  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 86

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 87  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 121

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 28  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 87

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 88  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 122

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 29  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 88

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 89  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 123

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 30  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 89

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 90  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 124

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 31  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 90

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 91  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 125

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 32  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 91

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 92  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 126

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 33  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 92

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 93  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 127

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 34  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 93

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 94  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 128

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 35  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 94

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 95  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 129

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 36  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 95

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 96  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 130

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 37  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 96

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 97  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 131

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 38  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 97

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 98  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 132

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 39  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 98

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 99  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 133

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 40  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 99

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 100 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 134

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 41  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 100

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 101 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 135

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 42  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 101

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 102 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 136

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 43  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 102

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 103 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 137

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 44  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 103

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 104 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 138

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 45  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 104

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 105 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 139

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 46  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 105

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 106 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 140

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 47  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 106

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 107 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 141

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 48  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 107

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 108 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 142

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 49  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 108

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 109 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 143

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 50  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 109

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 110 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 144

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 51  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 110

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 111 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 145

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 52  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 111

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 112 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 146

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 53  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 112

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 113 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 147

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 54  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 113

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 114 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 148

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 55  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 114

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 149

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 56  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 115

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 116 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 150

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 57  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 116

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 117 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 151

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 58  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 117

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 152

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 59  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 118

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 153

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 60  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 119

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 120 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 154

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 61  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 120

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 121 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 155

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 62  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 121

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 122 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 156

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 63  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 122

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 123 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 157

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 64  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 123

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 124 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 158

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 65  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 124

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 125 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 159

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 66  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 125

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 126 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 160

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 67  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 126

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 127 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 161

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 68  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 127

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 128 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 162

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 69  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 128

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 129 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 163

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 70  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 129

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 130 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 164

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 71  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 130

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 165

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 72  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 131

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 166

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 73  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 132

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 133 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 167

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 74  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 133

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 168

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 75  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 134

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 135 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 169

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 76  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 135

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 136 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 170

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 77  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 136

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 137 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 171

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 78  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 137

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 138 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 172

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 79  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 138

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 139 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 173

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 99  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 158

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 159 SSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSS 193

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 87  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 146

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 147 SSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSS 181

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 103 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 162

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 163 SSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSS 197

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 108 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 167

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 168 SSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSS 202

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 50/98 (51%), Positives = 65/98 (66%)
 Frame = +3

Query: 330 LRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS 509
           +  +S S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS
Sbjct: 4   IESNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 63

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 64  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 101

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 83  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 142

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 143 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSS 177

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 88  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 147

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 148 SSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSS 182

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSC 174

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 175 SSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSS 209

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 125 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSS 184

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 185 SCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCS 219

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/95 (53%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSSS +  S SS S 
Sbjct: 135 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSS 194

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 195 SSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSRS 229

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 85  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 144

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S S+S S
Sbjct: 145 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSS 179

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 96  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 155

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+ +S S
Sbjct: 156 SSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSS 190

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 105 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 164

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S SS S SS +S+S+S S
Sbjct: 165 SSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSS 199

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 106 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 165

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S  S SS +S+S+S S
Sbjct: 166 SSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSS 200

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 111 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 170

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 171 SSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSS 205

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S  S 
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSS 177

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 178 SSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSS 212

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 120 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSS 179

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 180 SSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 82  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 141

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+  S
Sbjct: 142 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSS 176

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 84  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 143

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+ +S S
Sbjct: 144 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSS 178

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 86  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 145

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + +S+S S
Sbjct: 146 SSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSS 180

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 89  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 148

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S  +S+S+S S
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSS 183

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 90  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 149

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S  S +S+S+S S
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSS 184

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 98  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 157

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + +S+S S
Sbjct: 158 SSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSS 192

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 110 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 169

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 170 SSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSS 204

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 117 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSS 176

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S SS S SS +S+S+S S
Sbjct: 177 SSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSS 211

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/93 (53%), Positives = 62/93 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 124 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSS 183

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S SS S SS +S+S+S
Sbjct: 184 SSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 107 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 166

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S  S S SS +S+S+S S
Sbjct: 167 SSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSS 201

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S  S S 
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSS 178

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 179 SSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSS 191

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSS 226

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 152 SSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSS 211

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 212 SSSSSSCSSSSSSSSSRSCSSSSSSSSSSSSSSSS 246

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S  S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 3   SIESNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 62

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 63  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 97

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 100 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 159

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS   S SS S SS +S+S+S S
Sbjct: 160 SSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSS 194

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 112 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 171

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS   S SS S SS +S+S+S S
Sbjct: 172 SSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSS 206

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 113 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 172

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S S  S SS S SS +S+S+S S
Sbjct: 173 SCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSS 207

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 122 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSS 181

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 182 SSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 123 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSS 182

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 183 SSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 217

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS S ++ S SS S 
Sbjct: 127 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSC 186

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSS 221

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+  +S++SSSSSS ++ S SS S 
Sbjct: 137 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSS 196

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 197 SSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSRSCS 231

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 50/95 (52%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS    S S S S+S  S++SSSSSS ++ S SS S 
Sbjct: 147 SSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSS 206

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 207 SSSSSSSSSSSCSSSSSSSSSRSCSSSSSSSSSSS 241

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 161 SSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSS 220

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+   S+SSS  S SS S SS +S+S+S S
Sbjct: 221 SSSSSSSRSCSSSSSSSSSSSSSSSSSSSSSSSRS 255

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 97  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 156

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS    SS S SS +S S+S S
Sbjct: 157 SSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSS 191

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SS SSS ++ S SS S 
Sbjct: 129 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSS 188

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S S+S S
Sbjct: 189 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSS 223

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 101 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 160

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S S  S SS S S  +S+S+S S
Sbjct: 161 SSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSS 195

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 102 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 161

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+ SS  S SS S  S +S+S+S S
Sbjct: 162 SSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSS 196

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 114 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 173

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS++ SS+ SS  S SS S SS +S+S+S S
Sbjct: 174 CSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSS 208

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++   SS S 
Sbjct: 121 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSS 180

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS ++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 181 SSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S SSSS ++ S SS S 
Sbjct: 142 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSS 201

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + +S+S S
Sbjct: 202 SSSSSSSSSSSSSSSSCSSSSSSSSSRSCSSSSSS 236

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++ SSSSS ++ S  S S 
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSS 190

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 191 SSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSS 225

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS ++   SS S 
Sbjct: 133 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSS 192

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S  +S+S+S S
Sbjct: 193 SSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSS 227

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS   S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSS 209

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S  S SS +S+S+S S
Sbjct: 210 SSSSSSSSCSSSSSSSSSRSCSSSSSSSSSSSSSS 244

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 156 SSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+ S   S SS S SS +S+S+S S
Sbjct: 216 SSCSSSSSSSSSRSCSSSSSSSSSSSSSSSSSSSS 250

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSS SS ++ S SS S 
Sbjct: 140 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSS 199

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + + +S S
Sbjct: 200 SSSSSSSSSSSSSSSSSSCSSSSSSSSSRSCSSSS 234

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+  +S++SSSSSS ++ S SS S 
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSS 208

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S  S S SS +S+S+S S
Sbjct: 209 SSSSSSSSSCSSSSSSSSSRSCSSSSSSSSSSSSS 243

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S   S S+S +S++SSSSSS ++ S SS S 
Sbjct: 155 SSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ SS+S S  S SS S SS +S+S+S S
Sbjct: 215 SSSCSSSSSSSSSRSCSSSSSSSSSSSSSSSSSSS 249

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 144 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSS 203

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS   S SS S  S +S+S+S S
Sbjct: 204 SSSSSSSSSSSSSSCSSSSSSSSSRSCSSSSSSSS 238

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+   SSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 154 SSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S S++ SS+SS   S SS S SS +S+S+S S
Sbjct: 214 SSSSCSSSSSSSSSRSCSSSSSSSSSSSSSSSSSS 248

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S SSSS ++ S S  S 
Sbjct: 130 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSS 189

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + +S+S S
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSS 224

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S   S S+S +S++ SSSSS ++ S SS S 
Sbjct: 143 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSS 202

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S   S+S+S S
Sbjct: 203 SSSSSSSSSSSSSSSCSSSSSSSSSRSCSSSSSSS 237

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S   S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 145 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSS 204

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S S  S SS S S  +S+S+S S
Sbjct: 205 SSSSSSSSSSSSSCSSSSSSSSSRSCSSSSSSSSS 239

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 49/95 (51%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S   S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 157 SSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS S S  S SS S SS +S+S+S S
Sbjct: 217 SCSSSSSSSSSRSCSSSSSSSSSSSSSSSSSSSSS 251

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S S+  SSSSS    S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 159 SSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSC 218

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S SSS  S SS S SS +S+S+S S
Sbjct: 219 SSSSSSSSSRSCSSSSSSSSSSSSSSSSSSSSSSS 253

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 49/95 (51%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S  SS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 169 SSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSR 228

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S   S+S+S S
Sbjct: 229 SCSSSSSSSSSSSSSSSSSSSSSSSRSCSSSSSRS 263

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 49/94 (52%), Positives = 60/94 (63%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           S S SSS  S   SSS+  SSSSS  S S S S S+S +S++S SSSS ++ SRS  S S
Sbjct: 175 SSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSRSC-SSS 233

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SSS++ SS+SSS  S SS S SS +S S S S
Sbjct: 234 SSSSSSSSSSSSSSSSSSSSRSCSSSSSRSCSSS 267

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 49/95 (51%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS   S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 167 SSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSS 226

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ SS+SSS  S SS S SS  S S+S S
Sbjct: 227 SRSCSSSSSSSSSSSSSSSSSSSSSSSRSCSSSSS 261

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S + ++SSSSSS  + S SS S 
Sbjct: 178 SSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSRSCSSSSSSS 237

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S  S +S+S+S S
Sbjct: 238 SSSSSSSSSSSSSSSSRSCSSSSSRSCSSSSSSSS 272

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 48/95 (50%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS S  S S S S S+S +S++SSSSSS ++ S  S S 
Sbjct: 163 SSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSS 222

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS +  SS+SSS  S SS S SS +S+S S S
Sbjct: 223 SSSSSRSCSSSSSSSSSSSSSSSSSSSSSSSRSCS 257

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/95 (49%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS +  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 158 SSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 217

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS++ S + SS  S SS S SS +S+S+S S
Sbjct: 218 CSSSSSSSSSRSCSSSSSSSSSSSSSSSSSSSSSS 252

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/95 (49%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S  SS  S   SSS+  SSSSS  S S S S S+  +S++SSSS S ++ S SS S 
Sbjct: 181 SSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSRSCSSSSSSSSSS 240

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S S  S SS S SS +S+S+S S
Sbjct: 241 SSSSSSSSSSSSSRSCSSSSSRSCSSSSSSSSSSS 275

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 47/95 (49%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS S  S S S S  +S +S++SSSSSS ++ S SS S 
Sbjct: 151 SSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSS 210

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS     S S SS +S+S+S S
Sbjct: 211 SSSSSSSCSSSSSSSSSRSCSSSSSSSSSSSSSSS 245

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 47/95 (49%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS   SSS  S   S S+  SSSSS  S S S S S+S +S++SSSS S ++ S SS S 
Sbjct: 171 SSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSRSC 230

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S  +S+S S S
Sbjct: 231 SSSSSSSSSSSSSSSSSSSSSSSRSCSSSSSRSCS 265

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 48/95 (50%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS   S   SSS+  SSSSS  S S S S S+S  S++SSSSSS +  S SS S 
Sbjct: 179 SSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSRSCSSSSSSSS 238

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS    SS S S  +S+S+S S
Sbjct: 239 SSSSSSSSSSSSSSSRSCSSSSSRSCSSSSSSSSS 273

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS      SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 176 SSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSRSCSSSSS 235

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S  S SS + +S+S S
Sbjct: 236 SSSSSSSSSSSSSSSSSSRSCSSSSSRSCSSSSSS 270

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 45/94 (47%), Positives = 60/94 (63%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           S S SSS  S   SSS+  SSSSS  S S S S S+S +S+ S SSSS ++ S SS S S
Sbjct: 187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSRSCSSSSSSSSSSSSSSSS 246

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SSS++ S +SSS  S SS S SS +S++ +++
Sbjct: 247 SSSSSSSRSCSSSSSRSCSSSSSSSSSSSTVAVA 280

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 47/95 (49%), Positives = 58/95 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S SSS  S S S S S+S +S++SSSSSS ++   SS S 
Sbjct: 165 SSSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSS 224

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   S ++ SS+SSS  S SS S SS +S S S S
Sbjct: 225 SSSRSCSSSSSSSSSSSSSSSSSSSSSSSRSCSSS 259

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 47/95 (49%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+   SSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 166 SSSSSSSSCSSSSSSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSS 225

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S S++ SS+SSS  S SS S SS + + +S S
Sbjct: 226 SSRSCSSSSSSSSSSSSSSSSSSSSSSSRSCSSSS 260

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/95 (47%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S + + SSSSSS ++ S SS S 
Sbjct: 188 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSSSSSRSCSSSSSSSSSSSSSSSSS 247

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SS   S SS S SS ++ + +++
Sbjct: 248 SSSSSSRSCSSSSSRSCSSSSSSSSSSSTVAVAVA 282

[67][TOP]
>UniRef100_UPI0000DA3A17 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA3A17
          Length = 356

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 48/172 (27%), Positives = 83/172 (48%), Gaps = 10/172 (5%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           GD  E+ D D E E  DE D +E E+  D+ +D   E+E  + D DD D    EDDEE  
Sbjct: 68  GDEDEDEDEDEEDEDEDEEDEDEDEDEEDEDEDEEDEDEDEDEDEDDED--EDEDDEEED 125

Query: 463 ADVSDAEMDTDMDMDLIDDEDDN----------NVDDDGTGDGGDDDSDGDDGRSKKKKK 314
            D  + + D D + +  D+ED++          + D+DG  D  D+D DGD+    ++ +
Sbjct: 126 EDEDEEDEDEDEEDEDEDEEDEDEDEDEDEDEEDEDEDGDEDEEDEDEDGDEDEEDEEDE 185

Query: 313 EKRKRKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE*E 158
           ++ + +      +E +   D+DE+ED   +     +  + ++    +  E E
Sbjct: 186 DEDEAEDEDEDEDEDED-XDEDEREDEDAEEADEEDQDEDEEDDDDREHEDE 236

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 44/136 (32%), Positives = 71/136 (52%), Gaps = 1/136 (0%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYD-DLDGVAGEDDEELV 464
           D  E+ D D + +  ++ D +E E+  +D D++  EEE  E D D D DG   ED++E  
Sbjct: 19  DEDEDEDEDGDEDEDEDEDEDEDEDGDEDEDEDEDEEEEEEEDEDEDEDGDEDEDEDEDE 78

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
            D  + E D D D D  +DED++  D+D   D  +DD D D+   ++ + E  + +    
Sbjct: 79  EDEDEDEEDEDEDEDE-EDEDEDEEDEDEDEDEDEDDEDEDEDDEEEDEDEDEEDEDEDE 137

Query: 283 SLEEYKHLIDQDEKED 236
             +E +   D+DE ED
Sbjct: 138 E-DEDEDEEDEDEDED 152

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 36/163 (22%), Positives = 78/163 (47%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           GD  E+ D D + +   + D +E E+  ++ +++  E+E G+ D D+ +    ED++E  
Sbjct: 28  GDEDEDEDEDEDEDEDGDEDEDEDEDEEEEEEEDEDEDEDGDEDEDEDEDEEDEDEDEED 87

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
            D  + E D D D +  D+++D + DD+   +  +++ + +D   + + +E         
Sbjct: 88  EDEDEDEEDEDEDEEDEDEDEDEDEDDEDEDEDDEEEDEDEDEEDEDEDEEDEDEDEEDE 147

Query: 283 SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE*EA 155
             +E +   ++DE ED     +   E   + ++ +    E EA
Sbjct: 148 DEDEDEDEDEEDEDEDGDEDEEDEDEDGDEDEEDEEDEDEDEA 190

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 45/143 (31%), Positives = 66/143 (46%), Gaps = 1/143 (0%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYD-DLDGVAGEDDEELVADV 455
           E+ D D E E  DE D +E E+  +D D+   +E+G E + D D DG   E+DEE   + 
Sbjct: 131 EDEDEDEEDEDEDEEDEDEDED--EDEDEEDEDEDGDEDEEDEDEDGDEDEEDEEDEDED 188

Query: 454 SDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLE 275
              + D D D D   DED+   +D    D  D D D +D   ++ + E      P A   
Sbjct: 189 EAEDEDEDEDEDEDXDEDEREDEDAEEADEEDQDEDEEDDDDREHEDEDEDEDDP-AGXP 247

Query: 274 EYKHLIDQDEKEDSKTKRKATSE 206
              H  D DE E+ + + +   E
Sbjct: 248 LGPHAADXDEDEEDEDEDEDEDE 270

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 38/137 (27%), Positives = 68/137 (49%), Gaps = 2/137 (1%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  E+ D D E E  D+ + +E E+  D+ +D   E+E  E + +D D    E+DE+   
Sbjct: 105 DEDEDEDEDDEDEDEDDEEEDEDEDEEDEDEDEEDEDEDEEDEDEDEDEDEDEEDEDEDG 164

Query: 460 DVSDAEMDTDMDMDLID--DEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPF 287
           D  + + D D D D  D  DED++  +D+   +  D+D D D+   +  ++   + +   
Sbjct: 165 DEDEEDEDEDGDEDEEDEEDEDEDEAEDEDEDEDEDEDXDEDEREDEDAEEADEEDQDED 224

Query: 286 ASLEEYKHLIDQDEKED 236
              ++ +   D+DE ED
Sbjct: 225 EEDDDDREHEDEDEDED 241

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 41/164 (25%), Positives = 80/164 (48%), Gaps = 3/164 (1%)
 Frame = -1

Query: 640 DGGENYDSDV---EFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEE 470
           DG E+ D D    E E GDE ++E+ +   ++ +D   +E+G E + +D D    ++DEE
Sbjct: 27  DGDEDEDEDEDEDEDEDGDEDEDEDEDEEEEEEEDEDEDEDGDEDEDEDEDEEDEDEDEE 86

Query: 469 LVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSP 290
              D  + E + D D D  D+++D + D+D   +  DD+ + +D   + + +++      
Sbjct: 87  ---DEDEDEDEEDEDEDEEDEDEDEDEDEDDEDEDEDDEEEDEDEDEEDEDEDEEDEDED 143

Query: 289 FASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE*E 158
               +E     D+DE ED + + +   E  + + +   +  E E
Sbjct: 144 EEDEDE-----DEDEDEDEEDEDEDGDEDEEDEDEDGDEDEEDE 182

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 38/151 (25%), Positives = 72/151 (47%), Gaps = 6/151 (3%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGE------YDYDDLDGVAGED 479
           DG E+ D D + E  +E D +E E+  +D D++  EE+  E       D D+ D    E+
Sbjct: 43  DGDEDEDEDEDEEEEEEEDEDEDEDGDEDEDEDEDEEDEDEDEEDEDEDEDEEDEDEDEE 102

Query: 478 DEELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKR 299
           DE+   D  + + D D D +  D+++D   +D+   D  +D+ D D+   + + +E    
Sbjct: 103 DEDEDEDEDEDDEDEDEDDEEEDEDEDEEDEDEDEEDEDEDEEDEDEDEDEDEDEEDEDE 162

Query: 298 KSPFASLEEYKHLIDQDEKEDSKTKRKATSE 206
                  +E +   + +E E+ + + +A  E
Sbjct: 163 DGDEDEEDEDEDGDEDEEDEEDEDEDEAEDE 193

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 39/136 (28%), Positives = 63/136 (46%), Gaps = 1/136 (0%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVA-GEDDEELV 464
           D  E+   D + E  DE D +E     D+ DD+  E E  + D DD  G   G    +  
Sbjct: 202 DXDEDEREDEDAEEADEEDQDE-----DEEDDDDREHEDEDEDEDDPAGXPLGPHAADXD 256

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
            D  D + D D D D  +DED++  ++D   D  D+D D +D    ++ +++ + +    
Sbjct: 257 EDEEDEDEDEDEDEDEDEDEDEDEDEEDEDEDEEDEDEDEEDEDEDEEDEDEDEDEDEDE 316

Query: 283 SLEEYKHLIDQDEKED 236
             E+     D+DE ED
Sbjct: 317 DEEDEDEDGDEDEDED 332

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 40/162 (24%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
           E+ D D + E  DE  +E+ E+  D+ +D A +E+  E + +D D    ED++   AD  
Sbjct: 160 EDEDGDEDEEDEDEDGDEDEEDEEDEDEDEAEDEDEDEDEDEDXDEDEREDEDAEEADEE 219

Query: 451 DAEMDTDMDMDLIDDEDDNNVDDDGTGDGG----DDDSDGDDGRSKKKKKEKRKRKSPFA 284
           D + D + D D   +++D + DD      G    D D D +D    + + E         
Sbjct: 220 DQDEDEEDDDDREHEDEDEDEDDPAGXPLGPHAADXDEDEEDEDEDEDEDEDEDEDEDED 279

Query: 283 SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE*E 158
             EE +   ++DE ED + + +   +  + + + + +  E E
Sbjct: 280 EDEEDEDEDEEDEDEDEEDEDEDEEDEDEDEDEDEDEDEEDE 321

 Score = 54.3 bits (129), Expect = 9e-06
 Identities = 36/141 (25%), Positives = 70/141 (49%), Gaps = 1/141 (0%)
 Frame = -1

Query: 583 NEEIENMLDDVDDNAVEEEGGEYDYD-DLDGVAGEDDEELVADVSDAEMDTDMDMDLIDD 407
           N+E E+  +D D++  E+E  + D D D DG   ED++E   +  + + D D D D  +D
Sbjct: 14  NDEDEDEDEDEDEDGDEDEDEDEDEDEDEDGDEDEDEDEDEEEEEEEDEDEDEDGDEDED 73

Query: 406 EDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEEYKHLIDQDEKEDSKT 227
           ED++  D+D   +  D+D D +D    ++ +++          +E +   D+DE ED + 
Sbjct: 74  EDEDEEDEDEDEEDEDEDEDEEDEDEDEEDEDE----------DEDEDEDDEDEDEDDEE 123

Query: 226 KRKATSEPTKKKKKKKSKASE 164
           + +   E  + + ++     E
Sbjct: 124 EDEDEDEEDEDEDEEDEDEDE 144

[68][TOP]
>UniRef100_Q816T1 VrrB n=2 Tax=Bacillus cereus RepID=Q816T1_BACCR
          Length = 295

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 42/110 (38%), Positives = 50/110 (45%), Gaps = 13/110 (11%)
 Frame = +1

Query: 328 YYDHHH--HHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALH------HP 483
           ++ HHH  HH HH HHH   HH    H HHQ           H  HQ +A H      HP
Sbjct: 119 HHGHHHQGHHGHHGHHHHQGHHGHHGHHHHQGH------HGHHGHHQQQAHHHGHHHIHP 172

Query: 484 RRLL---HLDHHSHI-HRPLLPQH-YHQHHPAYSQSPHCHSHHQPRIQHH 618
           + +L   H DHH H  H     QH +H HH       H H HHQ ++ HH
Sbjct: 173 QAVLYQIHQDHHGHHGHHGHQGQHGHHGHHHHQGHHGH-HGHHQQQVHHH 221

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 35/103 (33%), Positives = 44/103 (42%), Gaps = 2/103 (1%)
 Frame = +1

Query: 337 HHHHHYHHHHHHQYHHHQ--RCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHH 510
           H HHH  HH HH +HHHQ    +H HH            H+ H     HH ++  H  HH
Sbjct: 120 HGHHHQGHHGHHGHHHHQGHHGHHGHHH-----------HQGHHGHHGHHQQQAHHHGHH 168

Query: 511 SHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            HIH   +    HQ H  +      H HH  + QH +    HH
Sbjct: 169 -HIHPQAVLYQIHQDHHGH------HGHHGHQGQHGHHGHHHH 204

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 4/105 (3%)
 Frame = +1

Query: 328 YYDHHHHHYHH-HHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLD 504
           ++ HH HH+H  HH H  HH Q+ +H  H       +   +H+ H     HH  +  H  
Sbjct: 139 HHGHHGHHHHQGHHGHHGHHQQQAHHHGHHHIHPQAVLYQIHQDHHGHHGHHGHQGQH-G 197

Query: 505 HHSHIHRPLLPQHYHQHHPAYSQSPHCH---SHHQPRIQHHYRSF 630
           HH H H     Q +H HH  + Q  H H    HH  + QH ++ +
Sbjct: 198 HHGHHHH----QGHHGHHGHHQQQVHHHGHQGHHGHQGQHGHQGY 238

[69][TOP]
>UniRef100_Q8IJQ2 Conserved protein n=1 Tax=Plasmodium falciparum 3D7
            RepID=Q8IJQ2_PLAF7
          Length = 2379

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 49/154 (31%), Positives = 76/154 (49%), Gaps = 2/154 (1%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D G+N D + + +  D+ D+++ ++  DD DDN  E+E    D DD      E+D+E   
Sbjct: 996  DEGDNDDDEDDEDDDDDDDDDDDDDNDDDEDDNDDEDE----DEDD-----DENDDEEDD 1046

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
            D  D E DT  + D    E ++  DDD T +  D+DS   D   K+++K++   KS    
Sbjct: 1047 DDDDEEEDTREETDDNICEKEDLEDDDDTYEYSDEDSTHKDRNKKRRRKKRNNNKSKRKR 1106

Query: 280  LEEYKH--LIDQDEKEDSKTKRKATSEPTKKKKK 185
              + KH    D +E EDS+ +     E    KKK
Sbjct: 1107 KRKSKHDDYYDDNENEDSRKENDKEEESYYNKKK 1140

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 44/163 (26%), Positives = 83/163 (50%), Gaps = 10/163 (6%)
 Frame = -1

Query: 631  ENYDSDVEFEAGDESDNEEIENMLDDVD-DNAVEEEGGEYDYDDLDGVAGEDDEELVADV 455
            E+ + D +++  D  D++  ++  DD D DN   ++  + D DD D   G++D++   + 
Sbjct: 949  EDDEGDDDYDDDDYDDDDYDDDDYDDDDYDNDDYDDDDDDDNDDNDDDEGDNDDDEDDED 1008

Query: 454  SDAEMDTDMDMDLIDDEDDN-----NVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSP 290
             D + D D D D  DDEDDN     + DDD   D  DDD D ++  ++++  +    K  
Sbjct: 1009 DDDDDDDDDDDDNDDDEDDNDDEDEDEDDDENDDEEDDDDDDEEEDTREETDDNICEKED 1068

Query: 289  FASLEEYKHLIDQD----EKEDSKTKRKATSEPTKKKKKKKSK 173
                ++     D+D    ++   + ++K  +  +K+K+K+KSK
Sbjct: 1069 LEDDDDTYEYSDEDSTHKDRNKKRRRKKRNNNKSKRKRKRKSK 1111

 Score = 67.8 bits (164), Expect = 8e-10
 Identities = 51/178 (28%), Positives = 84/178 (47%), Gaps = 19/178 (10%)
 Frame = -1

Query: 640  DGGENYDSDVEF--EAGDESDNEEIENMLDDVDDNAVEEEGGEYD---YDDLDGVAGEDD 476
            D  EN  +D E   E  DE D++  ++  DD D +  + +  +YD   YDD D    +D+
Sbjct: 934  DDEENEKNDKEEGKEEDDEGDDDYDDDDYDDDDYDDDDYDDDDYDNDDYDDDDDDDNDDN 993

Query: 475  EELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKK----KEK 308
            ++   D  D E D D D D  DD+DD+N DD+   D  D+D D D+   ++      +E+
Sbjct: 994  DDDEGDNDDDEDDEDDDDDDDDDDDDDNDDDEDDNDDEDEDEDDDENDDEEDDDDDDEEE 1053

Query: 307  RKRKSPFASLEEYKHLIDQDEK----------EDSKTKRKATSEPTKKKKKKKSKASE 164
              R+    ++ E + L D D+           +D   KR+       K K+K+ + S+
Sbjct: 1054 DTREETDDNICEKEDLEDDDDTYEYSDEDSTHKDRNKKRRRKKRNNNKSKRKRKRKSK 1111

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 36/102 (35%), Positives = 54/102 (52%), Gaps = 1/102 (0%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D  E  D +   +  D+ + ++ EN  +D ++   E++ G+ DYDD D    +DD+    
Sbjct: 914  DEEEQMDDNQREDRDDKDEEDDEENEKNDKEEGKEEDDEGDDDYDDDDY---DDDDYDDD 970

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVD-DDGTGDGGDDDSDGDD 338
            D  D + D D   D  DD+DD+N D DD  GD  DD+ D DD
Sbjct: 971  DYDDDDYDND---DYDDDDDDDNDDNDDDEGDNDDDEDDEDD 1009

[70][TOP]
>UniRef100_C0H5K2 Putative uncharacterized protein n=1 Tax=Plasmodium falciparum 3D7
            RepID=C0H5K2_PLAF7
          Length = 2039

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 47/142 (33%), Positives = 68/142 (47%), Gaps = 5/142 (3%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEI-----ENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDD 476
            D  EN D D + +  +  DNE+      EN  D+ DDN  ++E  + D DD D    EDD
Sbjct: 1217 DDDENDDKDDDEDDDENDDNEDDNEDDDENDDDENDDNEDDDENDDKDDDDNDD--NEDD 1274

Query: 475  EELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRK 296
            +E   D  D E D + D D  DD+DD++ DDD   D  DD+ D D+    +   E    +
Sbjct: 1275 DENDDDEDDDENDDNEDDDENDDKDDDDNDDDEDDDENDDNEDDDENDDNEDDDENDDDE 1334

Query: 295  SPFASLEEYKHLIDQDEKEDSK 230
                + +E     D DE +D +
Sbjct: 1335 DDDENDDENDDDEDDDENDDDE 1356

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 37/101 (36%), Positives = 57/101 (56%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D  EN D + + E  D  D++E ++  DD +D+  +++  + + DD +    EDD+E   
Sbjct: 1273 DDDENDDDEDDDENDDNEDDDENDDKDDDDNDDDEDDDENDDNEDDDENDDNEDDDENDD 1332

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
            D  D E D + D D  DDE+D++ DDD   D  DDD+D DD
Sbjct: 1333 DEDDDENDDENDDDEDDDENDDDEDDDENDDKDDDDNDDDD 1373

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 40/135 (29%), Positives = 66/135 (48%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D  EN D++ + E  DE+D++E ++  DD +++  +++  + + DD +    EDD+E   
Sbjct: 1229 DDDENDDNEDDNEDDDENDDDENDDNEDDDENDDKDDDDNDDNEDDDENDDDEDDDENDD 1288

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
            +  D E D   D D  DDEDD+  DD+   D  DD+ D D+    +   E          
Sbjct: 1289 NEDDDENDDKDDDDNDDDEDDDENDDNEDDDENDDNEDDDENDDDEDDDENDDENDDDED 1348

Query: 280  LEEYKHLIDQDEKED 236
             +E     D DE +D
Sbjct: 1349 DDENDDDEDDDENDD 1363

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 40/146 (27%), Positives = 65/146 (44%)
 Frame = -1

Query: 631  ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
            E YD D E +  D+ +++E  +  D+ DD   +++    D DD +    +DD+E   D +
Sbjct: 1153 EKYDDDDEKDDNDDENDDEKYDDDDENDDEKYDDDDENDDKDDDENDDEKDDDEKDDDEN 1212

Query: 451  DAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEE 272
            D   D D + D  DDEDD+  DD+   +  DD++D D+    +   E   +        E
Sbjct: 1213 DDNEDDDENDDKDDDEDDDENDDNEDDNEDDDENDDDENDDNEDDDENDDKDDDDNDDNE 1272

Query: 271  YKHLIDQDEKEDSKTKRKATSEPTKK 194
                 D DE +D     +   E   K
Sbjct: 1273 DDDENDDDEDDDENDDNEDDDENDDK 1298

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 45/139 (32%), Positives = 68/139 (48%), Gaps = 2/139 (1%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYD--YDDLDGVAGEDDEEL 467
            D  EN D D + E  DE D++E ++  D+ DDN  ++E  + D   DD +    EDD E 
Sbjct: 1186 DDDENDDKDDD-ENDDEKDDDEKDD--DENDDNEDDDENDDKDDDEDDDENDDNEDDNED 1242

Query: 466  VADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPF 287
              +  D E D + D D  DD+DD++ DD+   D  DDD D D+    +   E   +    
Sbjct: 1243 DDENDDDENDDNEDDDENDDKDDDDNDDNEDDDENDDDEDDDENDDNEDDDENDDKDDDD 1302

Query: 286  ASLEEYKHLIDQDEKEDSK 230
               +E     D DE +D++
Sbjct: 1303 NDDDE-----DDDENDDNE 1316

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 39/140 (27%), Positives = 68/140 (48%), Gaps = 3/140 (2%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDL---DGVAGEDDEE 470
            D  EN D++ + E  D+ D+E+ +   D+ DDN  ++E  + + DD    D    +DD++
Sbjct: 1208 DDDENDDNEDDDENDDKDDDEDDDENDDNEDDNEDDDENDDDENDDNEDDDENDDKDDDD 1267

Query: 469  LVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSP 290
               +  D E D D D D  DD +D++ +DD   D  DDD D D+    +   E    +  
Sbjct: 1268 NDDNEDDDENDDDEDDDENDDNEDDDENDDKDDDDNDDDEDDDENDDNEDDDENDDNEDD 1327

Query: 289  FASLEEYKHLIDQDEKEDSK 230
              + ++     + DE +D +
Sbjct: 1328 DENDDDEDDDENDDENDDDE 1347

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 39/102 (38%), Positives = 53/102 (51%), Gaps = 1/102 (0%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D  EN D D +    DE D+E  +N  DD +D+  +++  + D DD      E+D+E   
Sbjct: 1291 DDDENDDKDDDDNDDDEDDDENDDNEDDDENDDNEDDDENDDDEDD-----DENDDENDD 1345

Query: 460  DVSDAEMDTDMDMDLIDD-EDDNNVDDDGTGDGGDDDSDGDD 338
            D  D E D D D D  DD +DD+N DDD   D  +DD   DD
Sbjct: 1346 DEDDDENDDDEDDDENDDKDDDDNDDDDYNDDDYNDDDYNDD 1387

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D  E+ D + + E  D  D++E ++  DD +D+  +++  + D DD +    EDD+E   
Sbjct: 1238 DDNEDDDENDDDENDDNEDDDENDDKDDDDNDDNEDDDENDDDEDDDENDDNEDDDEN-D 1296

Query: 460  DVSDAEMDTDMDMDLIDD-EDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
            D  D + D D D D  DD EDD+  DD+   D  DDD D D+   +    E         
Sbjct: 1297 DKDDDDNDDDEDDDENDDNEDDDENDDNEDDDENDDDEDDDENDDENDDDEDDDENDDDE 1356

Query: 283  SLEEYKHLIDQDEKED 236
              +E     D D  +D
Sbjct: 1357 DDDENDDKDDDDNDDD 1372

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 40/134 (29%), Positives = 60/134 (44%), Gaps = 3/134 (2%)
 Frame = -1

Query: 628  NYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSD 449
            N D D + +  DE D+++     D+ DD+  E++  + + DD DG   +DD+E   D  +
Sbjct: 1064 NSDKDEKDDDDDEKDDDD-----DEKDDDDDEKDDDDDEKDDDDGEKDDDDDEKDDDDDE 1118

Query: 448  AEMDTDM---DMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASL 278
             + D D    D D  DD+DD   DDD   D  DD+   DD        E    K      
Sbjct: 1119 KDDDDDEKDDDDDEKDDDDDEKHDDDDEKDDNDDEKYDDDDEKDDNDDENDDEKYDDDDE 1178

Query: 277  EEYKHLIDQDEKED 236
             + +   D DE +D
Sbjct: 1179 NDDEKYDDDDENDD 1192

 Score = 58.9 bits (141), Expect = 4e-07
 Identities = 41/137 (29%), Positives = 61/137 (44%), Gaps = 2/137 (1%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDD--VDDNAVEEEGGEYDYDDLDGVAGEDDEEL 467
            D  ++ D D + +  DE D+ + E   DD   DDN  E +  +YD DD +     DD++ 
Sbjct: 1130 DDEKDDDDDEKHDDDDEKDDNDDEKYDDDDEKDDNDDENDDEKYDDDDENDDEKYDDDDE 1189

Query: 466  VADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPF 287
              D  D E D + D    DDE D++ +DD   D  +DD D D+   +    E        
Sbjct: 1190 NDDKDDDENDDEKD----DDEKDDDENDDNEDDDENDDKDDDEDDDENDDNEDDNEDDDE 1245

Query: 286  ASLEEYKHLIDQDEKED 236
               +E     D DE +D
Sbjct: 1246 NDDDENDDNEDDDENDD 1262

 Score = 58.9 bits (141), Expect = 4e-07
 Identities = 39/137 (28%), Positives = 66/137 (48%), Gaps = 5/137 (3%)
 Frame = -1

Query: 631  ENYDSDVE-----FEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEEL 467
            E YD D E     ++  DE+D+++ +   D+ DD+  +++  + + DD D    +DD+E 
Sbjct: 1171 EKYDDDDENDDEKYDDDDENDDKDDDENDDEKDDDEKDDDENDDNEDD-DENDDKDDDED 1229

Query: 466  VADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPF 287
              +  D E D + D +  DDE+D+N DDD   D  DDD+D ++   +    E        
Sbjct: 1230 DDENDDNEDDNEDDDENDDDENDDNEDDDENDDKDDDDNDDNEDDDENDDDEDDDENDDN 1289

Query: 286  ASLEEYKHLIDQDEKED 236
               +E     D D  +D
Sbjct: 1290 EDDDENDDKDDDDNDDD 1306

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 33/101 (32%), Positives = 55/101 (54%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D  EN D++ + E  D+ D++  ++  DD +D+  +++  + + DD +    EDD+E   
Sbjct: 1282 DDDENDDNEDDDENDDKDDDDNDDDEDDDENDDNEDDDENDDNEDDDENDDDEDDDENDD 1341

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
            +  D E D + D D  DDE+D+  DDD   D  +DD   DD
Sbjct: 1342 ENDDDEDDDENDDDEDDDENDDKDDDDNDDDDYNDDDYNDD 1382

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 33/105 (31%), Positives = 58/105 (55%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D  ++ + D +++  DE+D+E+ ++  D+ DD   +E   E D D+ D    +D+E+   
Sbjct: 1162 DDNDDENDDEKYDDDDENDDEKYDDD-DENDDKDDDENDDEKDDDEKDDDENDDNED--D 1218

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSK 326
            D +D + D + D +  D+EDDN  DD+   D  DD+ D D+   K
Sbjct: 1219 DENDDKDDDEDDDENDDNEDDNEDDDENDDDENDDNEDDDENDDK 1263

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 40/136 (29%), Positives = 65/136 (47%), Gaps = 1/136 (0%)
 Frame = -1

Query: 640  DGGENYDSDVE-FEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
            D  E  D+D E ++  DE D+ + EN  +  DD   ++E  +  YDD D    +DD+E  
Sbjct: 1143 DDDEKDDNDDEKYDDDDEKDDNDDENDDEKYDD---DDENDDEKYDDDDENDDKDDDEND 1199

Query: 463  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
             +  D E D D + D  DD+++++ DDD   D  DD+ D ++   +    E    +    
Sbjct: 1200 DEKDDDEKDDDENDDNEDDDENDDKDDDEDDDENDDNEDDNEDDDENDDDENDDNEDD-- 1257

Query: 283  SLEEYKHLIDQDEKED 236
               + K   D D+ ED
Sbjct: 1258 DENDDKDDDDNDDNED 1273

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 43/146 (29%), Positives = 67/146 (45%), Gaps = 9/146 (6%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDES---DNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEE 470
            D  E  D D E +  D+    D++E ++  D+ DD+  E++  + + DD D    +DD+E
Sbjct: 1066 DKDEKDDDDDEKDDDDDEKDDDDDEKDDDDDEKDDDDGEKDDDDDEKDDDDDEKDDDDDE 1125

Query: 469  LVADVSDAEMDTDM---DMDLIDDEDDNNVDDDGTGDGGDDDSDG---DDGRSKKKKKEK 308
               D  + + D D    D D  DD DD   DDD   D  DD++D    DD      +K  
Sbjct: 1126 KDDDDDEKDDDDDEKHDDDDEKDDNDDEKYDDDDEKDDNDDENDDEKYDDDDENDDEKYD 1185

Query: 307  RKRKSPFASLEEYKHLIDQDEKEDSK 230
               ++     +E     D DEK+D +
Sbjct: 1186 DDDENDDKDDDENDDEKDDDEKDDDE 1211

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 42/162 (25%), Positives = 74/162 (45%), Gaps = 6/162 (3%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D  E+ D + + E  DE+D++E ++  DD +D+  +++  + D DD +    +DD+    
Sbjct: 1313 DDNEDDDENDDNEDDDENDDDEDDDENDDENDDDEDDDENDDDEDDDENDDKDDDDNDDD 1372

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDD------SDGDDGRSKKKKKEKRKR 299
            D +D + + D   D   ++DD N DD    D  DDD      +D D         +    
Sbjct: 1373 DYNDDDYNDDDYNDDDYNDDDYNDDDYNEDDYNDDDYNEDDYNDDDYNEDDYNDDDYNNN 1432

Query: 298  KSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSK 173
             +   +L+    L +++  E+ KT        +KKK KK  K
Sbjct: 1433 NNNDNNLKNNYSLENKNISENKKTSNIKNMFDSKKKIKKNKK 1474

[71][TOP]
>UniRef100_UPI0000F2E8A7 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica
           RepID=UPI0000F2E8A7
          Length = 1008

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 622 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSN 681

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +SNS+S S
Sbjct: 682 SSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSS 716

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 620 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSN 679

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S +S S SS +S+S S S
Sbjct: 680 SNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSS 714

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 603 SSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 662

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 663 SSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSS 697

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 627 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSS 686

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS +SS  S SS S +S +S+S+S S
Sbjct: 687 SSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSS 721

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 630 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSS 689

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 690 SSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSS 724

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ S+SSSS ++ S SS S 
Sbjct: 637 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSS 696

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  S SS S SS +SN++S S
Sbjct: 697 SNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSS 731

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 609 SSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 668

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S+++SS  S SS S SS +SN++S S
Sbjct: 669 SSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSS 703

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + +SS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 610 SSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 669

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S SSS  S SS S SS ++NS+S S
Sbjct: 670 SSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSS 704

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   S+S   SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 598 SSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 657

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 658 SSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSS 692

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 601 SSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 660

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S+ S SS +S+S+S S
Sbjct: 661 SSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSS 695

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 618 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 677

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S S+ S SS +S+S+S S
Sbjct: 678 SNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNS 712

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S+ S 
Sbjct: 625 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSS 684

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S++  S SS S SS +S+S+S S
Sbjct: 685 SSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSS 719

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +  + SS S 
Sbjct: 628 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSS 687

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S+ SSS  S SS S SS +S+S+S S
Sbjct: 688 SSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSS 722

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ + SS S 
Sbjct: 673 SSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSS 732

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S +S S SS +SN++S S
Sbjct: 733 SSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSS 767

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S S S+S +S+++SSSSS ++ + SS S 
Sbjct: 709 SSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSS 768

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S +S S SS +SN++S S
Sbjct: 769 SSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSS 803

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +S+  S   S+S+  SSS+S  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 590 SSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 649

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +SNS S S
Sbjct: 650 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSS 684

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 596 SNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 655

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S+ +S+S+S S
Sbjct: 656 SSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSS 690

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 613 NSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 672

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S S+ +S+S+S S
Sbjct: 673 SSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSS 707

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 616 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 675

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +S+++ SS+SSS  S SS + SS +S+S+S S
Sbjct: 676 SSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSS 710

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S +S S 
Sbjct: 624 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSS 683

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  S SS S SS  S+S+S S
Sbjct: 684 SSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSS 718

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  +SSSS  S S S S S+S +S++SS+SSS ++ S S+ S 
Sbjct: 779  SSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSS 838

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS+SSS  S SS S SS +SNS+S S
Sbjct: 839  SSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSS 873

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   +SSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 577 SSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSS 636

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 637 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 671

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SS+SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 583 SSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 642

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 643 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 677

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  + + S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 586 SSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 645

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 646 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNS 680

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   S+S+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 600 SSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 659

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S +S S SS +S+S+S S
Sbjct: 660 SSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSS 694

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 602 SSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 661

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + +S S SS +S+S+S S
Sbjct: 662 SSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSS 696

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 615 NSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 674

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S + SS+SSS  S SS S +S +S+S+S S
Sbjct: 675 SSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSS 709

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S ++SSSSS ++ S SS S 
Sbjct: 638 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSS 697

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+S+S  S SS S SS ++NS+S S
Sbjct: 698 NNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSS 732

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + +SS  S   SSS+  S+S+S  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 592 SSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 651

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  SNS+S S
Sbjct: 652 SSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSS 686

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 606 SSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 665

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S+S  S SS S SS +S+S++ S
Sbjct: 666 SSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNS 700

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 50/95 (52%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S  S +SSSSSS ++ S SS + 
Sbjct: 640 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNN 699

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS  S+S+S S
Sbjct: 700 SSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSS 734

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S + ++S +S++SSSSSS ++ + SS S 
Sbjct: 646 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSS 705

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S S+ S SS +SNS+S S
Sbjct: 706 SSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSS 740

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 649 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSS 708

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S+S S
Sbjct: 709 SSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSS 743

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS  S + S S S+S  S +SSSSSS ++ S SS S 
Sbjct: 556 SSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSN 615

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 616 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 650

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS++  SSSSS  S S S S S S +S++S+S+SS ++ S SS S 
Sbjct: 569 SSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSS 628

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 629 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 663

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSS++  S S S S S+S +S+ S+SSSS ++ S SS S 
Sbjct: 571 SSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSS 630

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 631 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 665

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  S + S S S++  S++SSSSSS ++ S SS S 
Sbjct: 576 SSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSS 635

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 636 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 670

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   S+++  SSSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 579 SSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSS 638

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 639 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 673

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +S++  SSSS+  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 581 SSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSS 640

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 641 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 675

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 619 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 678

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S ++ S SS +S+S++ S
Sbjct: 679 NSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSS 713

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 629 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSS 688

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +++SSS  S SS + SS +S+S+S S
Sbjct: 689 SSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSS 723

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSS+  + S SS S 
Sbjct: 631 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSS 690

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S S+ S SS +S+S+S S
Sbjct: 691 SSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSS 725

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 701 SSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSS 760

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S SS S SS  S+S+S S
Sbjct: 761 SNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSS 795

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SS+   SSSSS  S S S S S+S +S+ SSSSSS ++ + SS S 
Sbjct: 710 SNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSS 769

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS ++NS+S S
Sbjct: 770 SNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSS 804

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   S+S+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 737  SSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSS 796

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ S++SSS  S SS S SS  S+S+S S
Sbjct: 797  SNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSS 831

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  + S S S S+S +S++S+SSSS ++ S +S S 
Sbjct: 744  SSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSS 803

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +SS++ SS+SSS  S S+ S SS +SNS S S
Sbjct: 804  SSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSS 838

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   SS+   SSSSS  S S S S S+S +S+ SSSSSS ++ + SS S 
Sbjct: 746  SSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSS 805

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS  SNS+S S
Sbjct: 806  SNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSS 840

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   S+S+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 773  SSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSS 832

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ SS SSS  S SS S SS  S+S+S S
Sbjct: 833  NSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSS 867

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S + S S ++S +S+ SSSSSS ++ S SS + 
Sbjct: 496 SSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNS 555

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS++SS  S SS S SS +SNS+S S
Sbjct: 556 SSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSS 590

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S + + S S+S  S++SSSS+S ++ S SS S 
Sbjct: 566 SSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSS 625

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 626 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 660

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S++  S   SSS   SSSSS  + S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 588 SSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 647

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 648 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNS 682

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SS++  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 597 NSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 656

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS + +S +S+S+S S
Sbjct: 657 SSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSS 691

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 607 SSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 666

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS++S+  S SS S SS +S+S + S
Sbjct: 667 SSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSS 701

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +S+  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 608 SSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 667

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS S+S  S SS S SS +S++ S S
Sbjct: 668 SSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSS 702

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SSSSSS ++ + SS S 
Sbjct: 645 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSS 704

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS + SS +S+++S S
Sbjct: 705 SSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSS 739

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   SSS+  SSS+S  S S S S S+S +S+++SSSSS ++ S SS S 
Sbjct: 801  SSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSN 860

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SSS  S SS + SS +SNS S S
Sbjct: 861  SSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSS 895

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  +SSSS  S S S S S++ +S+++SSSSS ++ S SS S 
Sbjct: 879  SSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSN 938

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS SSS  S SS S SS +SNS+S S
Sbjct: 939  SSSSSNSSSSSNSSSSSSSSSSSSSSSSSNSSSSS 973

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 46/93 (49%), Positives = 64/93 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS +S S + S S+S +S++SSSSSS ++ + SS S 
Sbjct: 500 SSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSS 559

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S SS S S+ +S+S+S
Sbjct: 560 SSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSS 592

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S S S S S+S +S+ SSSSSS +  S SS S 
Sbjct: 543 SSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSS 602

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S+++SS  S SS S SS +S+S+S S
Sbjct: 603 SSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSS 637

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  S S S S + S +S++SSS+SS ++ S S+ S 
Sbjct: 559 SSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSS 618

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 619 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 653

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S++S+  S S S S S+S +++ SSSSSS ++ S SS S 
Sbjct: 573 SSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSS 632

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 633 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 667

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  +S+SS  S S S S S+S ++++SSSSSS ++ S SS S 
Sbjct: 575 SSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSS 634

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 635 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 669

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  +   SSS+  +SSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 595 NSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 654

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S +S +S+S+S S
Sbjct: 655 SSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSS 689

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   +S++  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 599 SSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 658

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S+ + SS +S+S+S S
Sbjct: 659 SSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSS 693

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 614 SNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 673

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS++  SS+SSS  S SS S ++ +S+S+S S
Sbjct: 674 SSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSS 708

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+++S+SSS ++ S SS S 
Sbjct: 636 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSS 695

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S SS S SS +S++ S S
Sbjct: 696 SSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSS 730

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 49/95 (51%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  S S S S S+S  S++SSSSSS +  S SS S 
Sbjct: 660 SSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSS 719

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS   SS+SSS  S SS S SS +S+S++ S
Sbjct: 720 SSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSS 754

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  + S S S ++S +S++SSSSSS ++ S SS S 
Sbjct: 700 SSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSS 759

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS SSS  S SS S SS +++S+S S
Sbjct: 760 SSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSS 794

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS   SSSSS  S S S S S+S +S++S++SSS ++ + SS S 
Sbjct: 718  SSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSS 777

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ S++SSS  S S+ S SS +SNS+S S
Sbjct: 778  SSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSS 812

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS   SSSSS  S S S S S+S +S+++S+SSS ++ S SS S 
Sbjct: 790  SSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSS 849

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ S++SSS  S SS S SS +S+S+S S
Sbjct: 850  SSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNS 884

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 49/95 (51%), Positives = 60/95 (63%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +SS  S   SSS+  SSSSS  S S S S S+S  S +SSSSSS  + S SS S 
Sbjct: 794  SSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSS 853

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+SS+  S SS + SS +SNS+S S
Sbjct: 854  SSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSS 888

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  SS+SS  S S + S S+S +S+ SSSSSS  + S SS S 
Sbjct: 563 SSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSS 622

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 623 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 657

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  S S + + S+S +S +SSSSSS +  S SS S 
Sbjct: 564 SSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSS 623

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 624 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 658

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS+  SSSSS  + S S S S+S +S++SSS+S+ ++ S SS S 
Sbjct: 567 SNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSS 626

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 627 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 661

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS+  +S+SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 593 SNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 652

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +++S+S S
Sbjct: 653 SSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSS 687

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ + SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 612 SNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 671

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  +S+SSS  S SS S SS  S+S+S S
Sbjct: 672 SSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSS 706

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +++ SSSSSS ++ S SS S 
Sbjct: 639 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSN 698

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS++SS  S SS S SS  ++S+S S
Sbjct: 699 NSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSS 733

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S +++ +S++SSSSSS ++ S +S S 
Sbjct: 644 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSS 703

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS + SS +S+S S S
Sbjct: 704 SSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSS 738

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS++ ++ S SS S 
Sbjct: 651 SSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSS 710

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S +S +S+S+S S
Sbjct: 711 NSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSS 745

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS+S+  S S S S S+S +S  SSSSSS ++ S SS S 
Sbjct: 657 SSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSS 716

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +++SSS  S SS S SS +S+S+S S
Sbjct: 717 SSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSS 751

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/93 (50%), Positives = 61/93 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S + S S S+S +S+ SSSSSS ++ S SS + 
Sbjct: 669 SSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNS 728

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS + SS+SSS  S SS S SS +S+S+S
Sbjct: 729 SSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSS 761

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS++  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 703 SSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSN 762

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S S+ +S+S+S S
Sbjct: 763 NSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSS 797

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S + S S S+S +S++SSSSSS ++ S +S S 
Sbjct: 769  SSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSS 828

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S + SS+SSS  S SS S SS +S+S S S
Sbjct: 829  SSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSS 863

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  S   SSS   SSSSS  + S S S S S +S++SSSSSS ++ + SS S 
Sbjct: 771  NSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSS 830

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S++ SS+S+S  S SS S SS +SNS+S S
Sbjct: 831  SSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSS 865

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  S   SSS+  +SSSS  S S S S S++ +S++SSS+S+ ++ S SS S 
Sbjct: 787  SNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSS 846

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+S+S  S SS S SS +SNS+S S
Sbjct: 847  SSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSS 881

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  + + S S S+S +S++SSS+ S ++ S SS S 
Sbjct: 479 SSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSN 538

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  S SS S SS +SNS+S S
Sbjct: 539 SSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSS 573

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS ++ S SS + 
Sbjct: 536 SSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNN 595

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  + +S S SS +S+S+S S
Sbjct: 596 SNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSS 630

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS++S  S S S + S+S +S ++SSSSS ++ S SS S 
Sbjct: 572 SSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSS 631

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 632 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 666

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  ++S+S  S S + S S+S  S +SSSSSS ++ S SS S 
Sbjct: 574 SSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSS 633

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 634 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 668

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SS+   SSSSS  + S S S +++ +S++SSSSSS ++ S SS S 
Sbjct: 578 SSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSS 637

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 638 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 672

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   ++S   SSSSS  S S S + ++S +S++SSSSSS ++ S SS S 
Sbjct: 580 SSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSS 639

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 640 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 674

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   S+S+  SSS+S  S S + + S+S +S++SSSSSS ++ S SS S 
Sbjct: 582 SSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSS 641

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 642 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 676

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  +   SSS+  S+SSS  S + + S S+S +S++SSSSSS ++ S SS S 
Sbjct: 584 SNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSS 643

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 644 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 678

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S+S+SS ++ S SS S 
Sbjct: 635 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSS 694

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  ++S++ SS+SSS  S SS S SS +S+S + S
Sbjct: 695 SSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSS 729

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S++  S++SSSSSS ++ S S+ S 
Sbjct: 642 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSS 701

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  S SS S ++ +S+S+S S
Sbjct: 702 SSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNS 736

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  + + S S S+S +S++SSS++S ++ S SS S 
Sbjct: 652 SSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSN 711

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 712 SSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSS 746

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  + S S S S+S +S++S++SSS ++ S SS S 
Sbjct: 654 SSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSS 713

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+++S  S SS S SS +S+S+S S
Sbjct: 714 SSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSS 748

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +S+SS  S S S S S+S  +++SSSSSS ++ S SS S 
Sbjct: 659 SSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSS 718

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 719 SSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNS 753

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS++  SSSSS  S S S S + S +S++SSSSS+ ++ S SS S 
Sbjct: 663 SSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSS 722

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  ++S++ SS++SS  S SS S SS +SNS+S S
Sbjct: 723 SSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSS 757

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +S+  S   SSS+  SSSS+  S S S S S++ +S++SSSSSS ++ + SS S 
Sbjct: 674 SSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSS 733

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS ++NS+S S
Sbjct: 734 SNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSS 768

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  S+SSS  S S + S S+S ++++SSSSSS ++ S SS S 
Sbjct: 731  SSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSS 790

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 791  SSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNS 825

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SS++  SSSSS  + S S S ++S +S++SSSSSS ++ S SS S 
Sbjct: 736  SSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSS 795

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +SS++ SS SSS  S SS S SS +++S+S S
Sbjct: 796  SSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSS 830

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  S+SSS  S S + S S+S ++++SSSSSS ++ S SS S 
Sbjct: 767  SSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSS 826

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+SSS  + SS S SS +S+S+S S
Sbjct: 827  SSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNS 861

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SS+  S   SS+   SS+SS  S S S S S+S +S++S+SSSS  + S SS S 
Sbjct: 900  SSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSS 959

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S S+ S SS +SNS+S S
Sbjct: 960  SSSSSSSSNSSSSSSSSSNSNSSSSSSSSNSSSSS 994

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  SSSSS    S S S S+S  S++SSSSSS ++ S +S S 
Sbjct: 499 SSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSS 558

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 559 SSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSS 593

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS   SSS+S  S S S S S+S +S++SS++SS ++ S SS S 
Sbjct: 508 NSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSS 567

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  + SS S SS  SNS+S S
Sbjct: 568 NSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSS 602

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/95 (49%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSS+  S S S S S+S  +++SSSSS+ ++ S SS S 
Sbjct: 514 SSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSS 573

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S S+ S SS +S+S S S
Sbjct: 574 SSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSS 608

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS   SSSSS  + + S S S++ +S++SS+S+S ++ S SS S 
Sbjct: 568 NSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSS 627

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 628 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 662

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S ++S  S   SS++  SSSS+  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 589 SSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 648

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S++++ S
Sbjct: 649 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSS 683

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SSSSSS ++ S ++ S 
Sbjct: 643 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSS 702

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S +S +S+S++ S
Sbjct: 703 SSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSS 737

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S + + S S+S +S++SSSSS+ ++ S SS S 
Sbjct: 650 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSS 709

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S S+ +S+S+S S
Sbjct: 710 SNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSS 744

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SS++SS ++ S SS + 
Sbjct: 653 SSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNS 712

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S++  S SS + SS +S+S+S S
Sbjct: 713 SSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSS 747

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S S S+S +S++++SSSS ++ S S+ S 
Sbjct: 655 SSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSS 714

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS +SS  S S+ S SS +S+S+S S
Sbjct: 715 SSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSS 749

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+S  S S S S S+S +S+ +SSSSS ++ S +S S 
Sbjct: 656 SSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSS 715

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S+ SSS  S +S S SS +S+S+S S
Sbjct: 716 SSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSS 750

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S + S S+S +S++S+SSSS ++ S SS S 
Sbjct: 667 SSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSN 726

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S S+ +S+S+S S
Sbjct: 727 NSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSS 761

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS+   SSSSS  S + S S S+S +S++S++SSS ++ + SS S 
Sbjct: 682 SSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSS 741

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S S+ S SS +SNS+S S
Sbjct: 742 SSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSS 776

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 49/95 (51%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S S S S+S +S  SSSSSS  + S SS S 
Sbjct: 685 SSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSS 744

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  + SS S SS +S+S+S S
Sbjct: 745 SSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSS 779

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S ++ +SSSSSS ++ S SS S 
Sbjct: 686 SSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSS 745

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  + SS S S+ +S+S+S S
Sbjct: 746 SSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSS 780

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  + S S S S S +S++SSSSSS ++ + SS S 
Sbjct: 699 NSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSS 758

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  ++S++ SS++SS  S SS S SS +SNS+S S
Sbjct: 759 SSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSS 793

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   SSS+  SSS+S  S S S + S+S +S+ SSSSSS ++ S SS S 
Sbjct: 729  SSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSN 788

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +++SSS  S SS S SS +S+S+S S
Sbjct: 789  SSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSS 823

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S + S S S+S +S++SSSSSS ++ S +S S 
Sbjct: 733  SSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSS 792

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+ + SS+SS+  S SS S SS +S+S S S
Sbjct: 793  SSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSS 827

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  S   SSS   SSSSS  + S S S S S +S++SSSSSS ++ + SS S 
Sbjct: 735  NSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSS 794

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  ++S++ SS++SS  S SS S SS +SNS+S S
Sbjct: 795  SSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSS 829

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   SSS+  SSS+S  S S S + S+S +S+ SSSSSS ++ S SS S 
Sbjct: 765  SSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSN 824

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ S++SSS  S +S S SS +S+S+S S
Sbjct: 825  SSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSS 859

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/93 (50%), Positives = 60/93 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   SS+   SSSSS  S S S S S+S +S+ SSSSSS +  + SS S 
Sbjct: 782  SSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSS 841

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S  SSS++ SS+SSS  S SS S SS +S+S+S
Sbjct: 842  SSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSS 874

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SS++  SSSSS  + S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 808  SSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSS 867

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ SS+SSS  S SS + +S +SNS S S
Sbjct: 868  NSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSS 902

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS   SSSSS  S S S S S+S +S++++S+SS ++ S SS S 
Sbjct: 551 SSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSS 610

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 611 SSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 645

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  SSSSS  S S S S S+S  ++ SSSSSS  + S SS + 
Sbjct: 555 SSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNS 614

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 615 NSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 649

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S +++ +S++SS+SSS ++ + +S S 
Sbjct: 560 SSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSS 619

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 620 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 654

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SS+  S   SSS+  SSSS+  S S S + S S +S++S+SSSS ++ S SS S 
Sbjct: 561 SNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSS 620

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 621 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 655

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  SSSS+  + S S S ++S +S+++S+SSS ++ S SS S 
Sbjct: 570 SSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSS 629

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 630 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 664

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S++ +S++SSSSSS  + S SS S 
Sbjct: 661 SSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSS 720

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+ + SS+SS+  S SS S SS +S+S S S
Sbjct: 721 SSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSS 755

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S   SSSSS  S S S S ++S +S++SSSS+S ++ S SS S 
Sbjct: 664 SSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSS 723

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS SSS  S SS S SS +++S+S S
Sbjct: 724 SSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSS 758

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  SSSSS  S S S + S+S +S++SS+SSS ++ S SS S 
Sbjct: 666 SSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSS 725

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 726 NNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSS 760

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  SSSSS  + S S S S+S  S++SSSSSS ++ S +S S 
Sbjct: 672 SSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSS 731

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S S+ S SS +S++ S S
Sbjct: 732 SSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSS 766

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS   SSSSS  S S S S S+S +S++SS++SS ++ S SS S 
Sbjct: 681 NSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSS 740

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS + SS +S+++S S
Sbjct: 741 SSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSS 775

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S ++S  S   SSS+  SSSSS  S S S + S+S +S+ SSSSSS ++ S SS S 
Sbjct: 693 SSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSN 752

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +++SSS  S SS S SS +S+S+S S
Sbjct: 753 SSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSS 787

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S + S+S +S++SSSSSS  + S SS S 
Sbjct: 702 SSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSS 761

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 762 NNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSS 796

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSS+S ++ S SS S 
Sbjct: 724  SSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSS 783

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 784  SSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSS 818

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SS+  S   SS++  SSSSS  S S S + S+S +S++++SSSS ++ S SS S 
Sbjct: 755  SSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSS 814

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +S+SSS  S S+ S SS +SNS+S S
Sbjct: 815  SSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSS 849

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +SS  S   SSS+  SSSSS  S S S S S+S ++ +SSSSSS ++ S SS S 
Sbjct: 758  SSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSS 817

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+SSS  + SS S SS +S+S+S S
Sbjct: 818  SSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSS 852

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 381 SSSSRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSS 440

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  S SS S ++ +++S+S S
Sbjct: 441 SSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSS 475

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 534 SSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSS 593

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  +SS++ SS SSS  S +S S SS +S+S+S S
Sbjct: 594 NNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSS 628

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  + S S S S +  S++SSSS+S ++ S +S S 
Sbjct: 558 SSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSS 617

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 618 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 652

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  +SSSS  S + S S S+S ++++SSSSS+  + S SS S 
Sbjct: 565 SSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSS 624

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 625 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 659

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S + + S+S +S++SSSSSS    S SS S 
Sbjct: 648 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSS 707

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S +S S SS  S+S+S S
Sbjct: 708 SSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSS 742

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S S S+S  +++SSSSS+ ++ S SS S 
Sbjct: 687 SSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSS 746

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S SS S +S +S+S+S S
Sbjct: 747 SSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSS 781

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSS+S  S S S S S+S  S++SSSS+S ++ S SS S 
Sbjct: 688 SSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSS 747

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 748 SSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSS 782

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SS++  SSSSS  S S + S S+S ++++SSSSSS ++ S SS S 
Sbjct: 695 SSSNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSS 754

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 755 SSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNS 789

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  S S S S S+S +S++SSSSS+ ++ S SS S 
Sbjct: 714 SSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSS 773

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  S SS S ++ +S+S+S S
Sbjct: 774 SSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNS 808

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 46/93 (49%), Positives = 63/93 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  S+SSS  S S S S S+S +S++SSSSS+ ++ S SS S 
Sbjct: 750  SSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSS 809

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S  SSS++ SS+SS+  S SS S S+ +S+S+S
Sbjct: 810  SSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSS 842

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SS++S  S S + S S+S +S++SSSSS+ ++ S SS S 
Sbjct: 776  SSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSN 835

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S +S +S+S++ S
Sbjct: 836  SSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSS 870

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   +SS+  SS+SS  S S S S S+S  S++SSSSS+  + S SS S 
Sbjct: 785  SSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSN 844

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 845  SSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSS 879

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +SS  S   SSS+  S+SSS  S S S S +++ +S+ S+SSSS ++ S SS S 
Sbjct: 855  SSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSS 914

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SSS  S SS S SS +SNS+S S
Sbjct: 915  SNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSS 949

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S S+S  S   SS++  SSSSS  S S + S S+S +S++SSSS+S ++ + SS S 
Sbjct: 891  SNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSN 950

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  + SS S SS  SNS+S S
Sbjct: 951  SSSSSSSSSSSSSSSSSNSSSSSSSSSNSNSSSSS 985

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS++  SS+SS  S S S S S+S +S++SSS+SS ++ S SS S 
Sbjct: 389 SSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSS 448

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  + S+ S SS ++NS+S S
Sbjct: 449 SNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSS 483

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 46/95 (48%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S + S+S +++ SSSS++ ++ S SS S 
Sbjct: 417 SSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSS 476

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS S+S  S SS S SS +SNS S S
Sbjct: 477 NNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSS 511

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S ++S  S   SS++  SSSSS  S S S S S S +S++SSSSSS ++ ++SS S 
Sbjct: 472 SSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSN 531

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS + SS +S+++S S
Sbjct: 532 SSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSS 566

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S+S +S+++SSSSS ++ + +S S 
Sbjct: 542 SSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSS 601

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS S+S  S SS S SS +S+S+S S
Sbjct: 602 SSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSS 636

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSS+S  S S S S S+S ++++SSSSSS  + S SS S 
Sbjct: 545 SSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSS 604

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ S++SSS  S SS S SS +S+S+S S
Sbjct: 605 NSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSS 639

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   +SS+  SSSSS  S S + S S+S ++ ++SSSSS +  S SS S 
Sbjct: 554 NSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSN 613

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 614 SNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 648

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 55/129 (42%), Positives = 72/129 (55%)
 Frame = +3

Query: 237  SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
            SS SS S     SS  +N +     S        SS + SSS  S   S+S+  SSSSS 
Sbjct: 662  SSSSSSSSSSSSSSSSSNSNSSSSSSSSSSSSSSSSNNSSSSSSSSSSSNSSSSSSSSSS 721

Query: 417  RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
             S S + S S+S  S++SSSSSS ++ S S+ S S  SSS   SS+SSS  S SS S SS
Sbjct: 722  SSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSS 781

Query: 597  PASNSTSLS 623
             +S+S++ S
Sbjct: 782  SSSSSSNSS 790

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   ++S+  SSS+S  S S S S S+S ++++SSSSSS    S SS S 
Sbjct: 712 SSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSN 771

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 772 SSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSS 806

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  +   SSS+  SSSSS  S S S S ++S +S++SS++SS ++ S SS S 
Sbjct: 717  SSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSS 776

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS SSS  S SS + SS +S+++S S
Sbjct: 777  SSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSS 811

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +SS  S   SSS+  SSSSS  S S S S S+S ++ +SSSSSS ++ S SS S 
Sbjct: 722  SSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSS 781

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+SSS  + SS S S+ +S+S+S S
Sbjct: 782  SSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSS 816

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   +SS+  SSSS+  S S S + S+S +S++SSSSSS  + S SS S 
Sbjct: 738  SSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSS 797

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 798  NNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSS 832

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 45/93 (48%), Positives = 62/93 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  S++SS  S S S S S+S +S++SSSS+S ++ S SS + 
Sbjct: 741  SSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNS 800

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S  SSS + SS+SSS  S SS S SS +S+S++
Sbjct: 801  SSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSN 833

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  +   SSS+  SSSSS  S S S S ++S +S++SS++SS ++ S SS S 
Sbjct: 753  SSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSS 812

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS SSS  S S+ + SS +S+S S S
Sbjct: 813  SSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSS 847

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSS+S ++ S SS S 
Sbjct: 760  SSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSS 819

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S++ SS+S+S  S SS S +S +S+S+S S
Sbjct: 820  SSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSS 854

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  +   SSS+  S+SSS  S S S S S+S +S++SSS+SS ++ S SS S 
Sbjct: 814  SSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSS 873

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +S+SSS  S SS S S+ +S+S+S S
Sbjct: 874  SSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNS 908

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS   SSSSS  S S S S S+S +S++S+SSSS ++ S SS S 
Sbjct: 816  SSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSS 875

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS+  SS+SS+  S SS S SS +S+S S S
Sbjct: 876  NSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSS 910

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 45/95 (47%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   S+S   SSSSS  S S S S S+S +S+ SSSSSS  + S SS + 
Sbjct: 818  SSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNS 877

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS++S+  S +S S SS +SNS+S S
Sbjct: 878  SSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSS 912

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS   SSSSS  S S S + S+S  S++SS+SSS ++ S SS S 
Sbjct: 905  SSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSSSSS 964

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +SS++ SS+S+S  S SS S +S +S+S+S S
Sbjct: 965  SSSNSSSSSSSSSNSNSSSSSSSSNSSSSSSSSSS 999

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S+++SSSSS  + S SS + 
Sbjct: 407 SSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNN 466

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S+ SSS  S SS S SS +S+S S S
Sbjct: 467 SSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSS 501

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S + S S++ +S++S+SSSS ++ S SS S 
Sbjct: 494 SSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSN 553

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SS+  S SS S SS +S+S S S
Sbjct: 554 NSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSS 588

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SS+  S   +SS+  SSSSS  S + S S S+S +S++S+SSSS ++ S SS S 
Sbjct: 524 SNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSS 583

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S+ S+S  S SS S SS +SNS S S
Sbjct: 584 SNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSS 618

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 47/94 (50%), Positives = 59/94 (62%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           S S +SS  S   SSS+  SSSSS  + S S S S S +S+ SSSSSS ++ S SS S S
Sbjct: 527 SSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNS 586

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SSS++ +S SSS  S +S S SS  SNS+S S
Sbjct: 587 SSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSS 620

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 46/95 (48%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SS++  SS+SS  S S S S S+S  S++SSSSS+ +  S SS S 
Sbjct: 546 SSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSN 605

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  +S+SSS  S SS S SS +S+S+S S
Sbjct: 606 SSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSS 640

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  S   SSS+  SSSSS  S S S S + S +S++S+SSSS ++ S SS S 
Sbjct: 727  NSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSS 786

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS +SS  S S+ S SS +S+S+S S
Sbjct: 787  SNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSS 821

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 46/95 (48%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   SSS+  +SSSS  S S + S S+S  S++SSSSSS ++ S S+ S 
Sbjct: 732  SSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSS 791

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS   SS+SSS  S SS S SS +S+S++ S
Sbjct: 792  SSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSS 826

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 44/95 (46%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  S   SSS+  SSSSS  S + S S S++ +S++SSSSSS ++ S SS S 
Sbjct: 734  SNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSS 793

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S++++ SS+S+S  S SS S SS +S+++S S
Sbjct: 794  SSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSS 828

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  S   SSS+  SSSSS  S S S S + S +S++S+SSSS ++ S SS S 
Sbjct: 763  NSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSS 822

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ S+++SS  S SS S SS +S+S+S S
Sbjct: 823  SNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSS 857

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 44/95 (46%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  S   SSS+  SSSSS  S + S S S++ +S++SSSSSS ++ S SS S 
Sbjct: 770  SNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSS 829

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +S+++ SS+SS+  S SS S SS +S+++S S
Sbjct: 830  SSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSS 864

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSS++  S S S S S+S +S++SSSSSS ++ S SS + 
Sbjct: 775  SSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNS 834

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ +S+SSS  S SS S S+ +S+S+S S
Sbjct: 835  NSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNS 869

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  S++SS  S S S S S+S +S++SSSS+S ++ S S+ + 
Sbjct: 777  SSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNS 836

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SSS  S SS S SS +S+S S S
Sbjct: 837  SSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSS 871

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 46/95 (48%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   +SS+  SSS+S  S S S S S+S +S++SSSSSS  + S SS + 
Sbjct: 810  SSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNS 869

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+S+S  S S+ + SS  SNS+S S
Sbjct: 870  SSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSS 904

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S + S S S++ +S++SS+SSS ++ S SS S 
Sbjct: 831  SSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSN 890

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+SSS  S SS S S+ +S+S S S
Sbjct: 891  SNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSS 925

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   SSS+  SS+SS  S S S S S+S +S++SS+SSS ++ S SS S 
Sbjct: 838  SSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSN 897

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +S+SSS  S +S S +S +S+S+S S
Sbjct: 898  SNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSS 932

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SS+  S   SSS   SSSSS  + S S S S+S +S++SSSSS+ ++ S SS S 
Sbjct: 890  NSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSS-SS 948

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S +S S SS +SNS S S
Sbjct: 949  SNSSSSSSSSSSSSSSSSSNSSSSSSSSSNSNSSS 983

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 46/93 (49%), Positives = 61/93 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   +SS+  SSSSS  S S S S S S +S+ SSSSSS ++ S SS S 
Sbjct: 908  SSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSSSSSSSS 967

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            +  SSS++ S+++SS  S SS S SS +S+S+S
Sbjct: 968  NSSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSS 1000

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSS+S  S S   S S+S +S++SSSS+S ++ S +S S 
Sbjct: 388 SSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSS 447

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S SSS  + SS S SS +SN++S S
Sbjct: 448 SSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSS 482

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS  + S SS S 
Sbjct: 393 SSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSS 452

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S + SS ++S  S SS S ++ +S+S+S S
Sbjct: 453 SSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSS 487

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+   SSSS  S S S S S+S +S++SSSS++ ++ S S+ S 
Sbjct: 506 NSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSS 565

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S +S S SS ++NS S S
Sbjct: 566 SSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSS 600

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S + S+S  S++SSSSSS ++ S S+ S 
Sbjct: 529 SSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSS 588

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+ + SS+SSS  S SS S +S +S+S+S S
Sbjct: 589 SSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSS 623

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SS+   SSSSS  S S + S S+S +S++SSSSS+ ++ S SS + 
Sbjct: 537 SNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNS 596

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 597 NSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSS 631

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 47/95 (49%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSS+  S S S S S+S +S +SSSSSS    + SS S 
Sbjct: 544 SSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSS 603

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S SSS  S SS S SS +S+S+S S
Sbjct: 604 SNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSSSSS 638

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           ++ S SSS  S   S+S+  SSSSS  S S S S S+S +S  S+SSSS ++ S SS S 
Sbjct: 553 NNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSS 612

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 613 NSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 647

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S S+S  S   SSS+  SSS+S  S S S + ++S +S+++SSSSS +  + SS S 
Sbjct: 562 NSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSS 621

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 622 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 656

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   +SS+  SSSSS  S + S S S+S +S++SSSSSS ++ S +S S 
Sbjct: 697 SNNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSS 756

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+ + SS+SS+  S SS S SS +S+S S S
Sbjct: 757 SSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSS 791

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S+S +S++SS+SSS ++ S ++ S 
Sbjct: 707 SSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSS 766

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SSS  S SS S SS +S+S + S
Sbjct: 767 SSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSS 801

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  + S S S S+S +S++S+SSSS ++ S +S S 
Sbjct: 708 SSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSS 767

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S S+ S SS +S++ S S
Sbjct: 768 SSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSS 802

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S++  S   S+S+  SSSSS  S S S S S+S +S+ +SSSSS +  S SS S 
Sbjct: 720  SSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSS 779

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S +S S SS  S+S+S S
Sbjct: 780  SSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSS 814

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   SSS+  SSSSS  S + S S S+S  +++SSSSS+ ++ S SS S 
Sbjct: 723  SSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSS 782

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS+SSS  S SS S +S +S+S+S S
Sbjct: 783  SSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSS 817

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            ++ S SSS  S   SSS+  SSSSS  S S S S S + +S++SS+SSS ++ S SS S 
Sbjct: 726  NNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSS 785

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+++S  S SS S SS +S+S+S S
Sbjct: 786  SSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSS 820

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SS+  S   SSS+  SSSS+  S S S S ++S +S+++SSSSS ++ S SS S 
Sbjct: 728  SSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSS 787

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ S+ SSS  S +S S SS +S+S+S S
Sbjct: 788  NSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSS 822

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SS++S  S S + S S+S +S++SSSSS+ ++ S SS + 
Sbjct: 740  SSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNN 799

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SSS  S SS S +S +S+S+S S
Sbjct: 800  SSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNS 834

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   +SS+  SS+SS  S S S S S+S  S++SSSSSS  + S SS + 
Sbjct: 749  SSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNS 808

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S +S +S+S+S S
Sbjct: 809  SSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSS 843

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            ++ S SSS  S   SSS+  SSSSS  S S S S S + +S++SS+SSS ++ S SS S 
Sbjct: 762  NNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSS 821

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS S+S  S SS + SS +S+S+S S
Sbjct: 822  SSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSS 856

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SS+  S   SSS+  SSSS+  S S S S ++S +S+++SSSSS ++ S SS S 
Sbjct: 764  SSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSS 823

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ +S SSS  S S+ S SS +S+S+S S
Sbjct: 824  NSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSS 858

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S++  S   S+S+  SSSSS  S S S S S+S +S ++SSSSS ++ S SS S 
Sbjct: 792  SSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSS 851

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S +S +S+S S S
Sbjct: 852  SSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSS 886

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  S   SSS+  SSSSS  + + S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 806  SNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSS 865

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ S++SSS  + SS S +S +S+S S S
Sbjct: 866  SSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNS 900

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   S+S+  SSSS+  S S S S ++S +S++SSSSSS +  S SS S 
Sbjct: 809  SSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSN 868

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SS+  S SS S SS +++++S S
Sbjct: 869  SSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSS 903

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/93 (48%), Positives = 63/93 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SS+SS  S S S S S+S +S++SSS+SS ++ S SS S 
Sbjct: 822  SSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSS 881

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S  SSS++ S++SSS  + SS S S+ +S+S+S
Sbjct: 882  SNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSS 914

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 47/95 (49%), Positives = 59/95 (62%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SS+  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS  + S SS S 
Sbjct: 826  SSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSS 885

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S + SS S+S  S SS S SS +S++ S S
Sbjct: 886  SSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSS 920

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  S   SSS+  SSSSS  + S S S ++S +S+++SSSSS  + S SS S 
Sbjct: 833  NSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSN 892

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S + SS+SS+  S SS S +S +SNS+S S
Sbjct: 893  SSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSS 927

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSS+  S S S S S+S ++++SSSS+S ++ S S+ S 
Sbjct: 836  SSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSS 895

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +SS++ SS SSS  S S+ S SS +S+S+S S
Sbjct: 896  SNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSS 930

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   SSS+  SSSSS  + S S S ++S +S+ SSSSSS +  S S+ + 
Sbjct: 841  SSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNS 900

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 901  SSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSS 935

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  + S S S S+S +S ++SSSS+  + S SS + 
Sbjct: 849  SSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNS 908

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+S+S  S SS S SS +SNS+S S
Sbjct: 909  SSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSS 943

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   SSS+  SSSSS  + S S S S+S +S+ SSSSSS +  S SS S 
Sbjct: 865  SSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSS 924

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+S+S  S +S S S+ +S+S+S S
Sbjct: 925  SSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSS 959

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   +SS+  SSSSS  S S S S ++S +S +SSSS+S ++ S SS S 
Sbjct: 903  SSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSSS 962

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS+SSS  + SS S SS +S+S+S S
Sbjct: 963  SSSSSNSSSSSSSSSNSNSSSSSSSSNSSSSSSSS 997

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   SSS+  SSSSS  S S S S S+S ++++SSS+SS ++ S SS S 
Sbjct: 904  SSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSSSS 963

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S++ SS+SS+  S SS S S+ +S+S+S S
Sbjct: 964  SSSSNSSSSSSSSSNSNSSSSSSSSNSSSSSSSSS 998

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  +   SS++  SSSSS  S S S S S+S +S++S+SSSS ++ S SS S 
Sbjct: 906  SNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSSSSSS 965

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS++S+  S SS S SS +S+S+S S
Sbjct: 966  SSNSSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSS 1000

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 44/93 (47%), Positives = 63/93 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S++  S   SSS+  SSSSS  S S S S S+S ++++SSSSSS ++ S SS + 
Sbjct: 910  SSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSSSSSSSSNS 969

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S  SSS++ S++SSS  S +S S SS +S+ST+
Sbjct: 970  SSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSTT 1002

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 45/97 (46%), Positives = 61/97 (62%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R  + S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS 
Sbjct: 375 RKGNSSSSSSRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSS 434

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           + S  SSS + SS+S+S  S S+ + SS  +NS++ S
Sbjct: 435 NSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSS 471

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S   S+S +S++SSSSSS ++ S SS S 
Sbjct: 386 SSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSS 445

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS S+S  S ++ S SS +S+S + S
Sbjct: 446 SSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSS 480

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 47/95 (49%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ + SSS  S   SSS+  S+SSS  S S S S S+S  S++S+SSSS +  S SS S 
Sbjct: 487 SNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSS 546

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS   SS+SSS  S SS S SS +S+S+S S
Sbjct: 547 SSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSS 581

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   +S++  SSSSS  S S S + S+S  S++SSS+SS ++ S SS S 
Sbjct: 492 SSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSS 551

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S SS S SS +S+S+S S
Sbjct: 552 SNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNS 586

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 49/98 (50%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASL---TSATSSSSSSPATPSRSS 509
           SS S SSS  S   SSS+  SSSSS  S S S S S+S    +S++SSS+SS ++ S SS
Sbjct: 513 SSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSS 572

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S S  SSS++ +S+SSS  S +S S SS +SNS+S S
Sbjct: 573 SSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSS 610

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 46/93 (49%), Positives = 61/93 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+   S   SSS+  SSSSS  S S S S ++S +S+++SSSSS ++ S SS S 
Sbjct: 519 SSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSS 578

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS + SS+SSS  S SS S SS +S+S+S
Sbjct: 579 SSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSS 611

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   ++S+  SSS+S  S S S S S+S ++++SSSSSS    S SS S 
Sbjct: 748  SSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSN 807

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S S+  S+S+S S
Sbjct: 808  SSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSS 842

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   SSS+  +SSSS  S S + S S+S  S++SSSSSS ++ S S+ S 
Sbjct: 768  SSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSS 827

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS++  SS+SSS  S SS S SS +S+S++ S
Sbjct: 828  SSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSS 862

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  S   SSS+  SSSSS  S S S S S S +S++SS+SSS ++ S SS S 
Sbjct: 799  NSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSS 858

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +S+SSS  + SS S +S +S+S S S
Sbjct: 859  SNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNS 893

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S S S S S+S +S +SSSSS+  + S +S S 
Sbjct: 842  SSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSS 901

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS+SS+  S S+ S SS +S+S+S S
Sbjct: 902  SSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSS 936

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  +SSSS  S S S S ++S +S+ S+SSSS +  S SS S 
Sbjct: 848  SSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSN 907

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +S+SS+  S SS S SS +S+++S S
Sbjct: 908  SSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSS 942

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SS++  SSSSS  S S S S + S +S +SSSSSS ++ S SS S 
Sbjct: 881  SSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSS 940

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +SS++ +S+SSS  S SS S SS  S+S+S S
Sbjct: 941  SSSNSSSSSNSSSSSSSSSSSSSSSSSNSSSSSSS 975

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 44/93 (47%), Positives = 62/93 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   S+S+  SSS+S  S S S + S+S +S++SSSSSS ++ S SS S 
Sbjct: 884  SSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSS 943

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            +  SSS + SS+SSS  S SS S +S +S+S+S
Sbjct: 944  NSSSSSNSSSSSSSSSSSSSSSSSNSSSSSSSS 976

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  S   SSS   SSS+S  S S S S S+S  S++SS+SSS +  S SS S 
Sbjct: 899  NSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSS 958

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +S+SSS  S +S S SS +S+++S S
Sbjct: 959  SSSSSSSSSNSSSSSSSSSNSNSSSSSSSSNSSSS 993

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 45/95 (47%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS      SSS+  SSSSS  S S S S S+S +S +SSSSS+  + S ++ S 
Sbjct: 409 SSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSS 468

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ +S+SSS  S +S S SS +SNS+S S
Sbjct: 469 NSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSS 503

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   S+S   SSSSS  S S S + ++S +S++SSSSSS ++   SS + 
Sbjct: 473 SSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNS 532

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S S+ S SS +SNS+S S
Sbjct: 533 SSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSS 567

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  + S S + S+S +S++SSSSSS  + S SS S 
Sbjct: 535 SSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSN 594

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ S++SSS  S S+ S SS +S+S+S S
Sbjct: 595 NSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSS 629

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 43/95 (45%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  + S S S S+S +S++S+SSSS ++ + S+ S 
Sbjct: 541 SSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSS 600

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS++S+  S SS S SS +S+S+S S
Sbjct: 601 SSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSSSSS 635

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  SSSSS  S S S S S S +S++SS++S+ ++ S S+ S 
Sbjct: 549 SSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSS 608

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S + SS+SSS  S SS S SS +S+S+S S
Sbjct: 609 SSSSNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSS 643

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 43/95 (45%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           ++ S SSS  S   SSS+  SSSSS  S + S S S++ +S++SSSSSS ++ S SS S 
Sbjct: 698 NNSSSSSSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSS 757

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S++++ SS+S+S  S SS S SS +S+++S S
Sbjct: 758 SSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSS 792

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  +   SSS+  SSSSS  S S S S S S +S++SSS++S ++ S +S S 
Sbjct: 716  SSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSS 775

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS++SS  S SS + SS +S+S S S
Sbjct: 776  SSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSS 810

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   SSS+  SSSSS  S + S S S+S  +++SSSSS+ ++ S SS S 
Sbjct: 759  SSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSS 818

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS+SS+  S SS S S+ +S+S+S S
Sbjct: 819  SSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSS 853

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 43/95 (45%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  +   SSS+  ++SSS  S + S S S+S +S++SSS+SS ++ S +S S 
Sbjct: 778  SSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSS 837

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+SSS  S SS + SS +S+++S S
Sbjct: 838  SSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSS 872

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   ++S+  SSS+S  S S S S S+S ++++SSSSSS +  S SS S 
Sbjct: 784  SSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSS 843

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ SS+SSS  S SS S +S +S+S++ S
Sbjct: 844  NSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSS 878

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 45/95 (47%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S ++S  S   +SS+  SSSSS  S S + S S+S +++ SSSSSS +  S SS S 
Sbjct: 793  SSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSS 852

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SSS  S SS S SS +S+++S S
Sbjct: 853  SSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSS 887

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 44/95 (46%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SS+S+  S S S + S+S +S++SSSSSS ++ S SS S 
Sbjct: 811  SSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSS 870

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS++SS  S +S S SS +++S+S S
Sbjct: 871  SSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSS 905

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   +SS+  SSS+S  S S S S S+S  S++SSSS+S ++ S +S S 
Sbjct: 821  SSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSS 880

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +S SSS  S SS S SS +S+S+S S
Sbjct: 881  SSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSS 915

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  +SSSS  S S S S S S +S+++SSSSS  + S SS S 
Sbjct: 840  SSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSN 899

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SSS  + SS + SS +S+S+S S
Sbjct: 900  SSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSS 934

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   S+S+  SSS+S  S S + S S+S +S++SS+S+S ++ S SS S 
Sbjct: 845  SSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSS 904

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS +SS  + SS S SS +S+S+S S
Sbjct: 905  SSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNS 939

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  +   SSS   SSSS+  S S S S S+S +S++++SSSS ++ S SS S 
Sbjct: 873  SSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSS 932

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS SSS  + SS S SS +S+S+S S
Sbjct: 933  SSSSSNSSSSSNSSSSSNSSSSSSSSSSSSSSSSS 967

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  +   S+S   SSSSS  S S S S ++S ++++SSSSSS ++ S S+ S 
Sbjct: 882  SNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSS 941

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 942  SSNSSSSSNSSSSSSSSSSSSSSSSSNSSSSSSSS 976

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 43/95 (45%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ + SSS  S   SSS+  ++SSS  S S S S S+S +S+ SSSSS+ ++ S SS S 
Sbjct: 896  SNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSS 955

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS++SS  S SS + +S +S+S+S S
Sbjct: 956  SSSSSSSSSSSSNSSSSSSSSSNSNSSSSSSSSNS 990

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 46/95 (48%), Positives = 60/95 (63%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +SS  S   ++S+  +SSSS  S S S S S S +S+ SSSSS+ ++ S SS S 
Sbjct: 902  SSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSS 961

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+SSS  S SS S SS  S+S+S S
Sbjct: 962  SSSSSSNSSSSSSSSSNSNSSSSSSSSNSSSSSSS 996

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 44/93 (47%), Positives = 61/93 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S ++S  S   SSS+  SSSSS  + S S + S+S  S++SSSSSS ++ S SS S 
Sbjct: 911  SSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSSSSSSSSNSS 970

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S  SSS+  +S+SSS  S SS S SS +S++T+
Sbjct: 971  SSSSSSSNSNSSSSSSSSNSSSSSSSSSSSTTA 1003

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 42/90 (46%), Positives = 61/90 (67%)
 Frame = +3

Query: 348 SLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPP 527
           S+SSSP     SSS+   SSSS  S S S S S+S ++++SSS+SS ++ S SS S S  
Sbjct: 368 SISSSPERKGNSSSSSSRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSS 427

Query: 528 SSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           SSS++ S++SSS  S SS S S+ +S+S++
Sbjct: 428 SSSSSSSNSSSSSSSNSSSSSSNSSSSSSN 457

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  +SSSS  S S S S S+S +S++S+SSSS ++ S SS S 
Sbjct: 391 SSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSN 450

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+S++  S SS S SS  S+S+S S
Sbjct: 451 SSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSS 485

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 45/93 (48%), Positives = 62/93 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S + ++S +S++SSS++S ++ S SS S 
Sbjct: 431 SSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSN 490

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS+  SS+SSS  + SS S SS +S+S+S
Sbjct: 491 SSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSS 523

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 47/95 (49%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  + S S S S+S  S++SSSSSS +  S SS S 
Sbjct: 439 SSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSN 498

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  +S+SSS  S SS S SS  S+S++ S
Sbjct: 499 SSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSS 533

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 44/92 (47%), Positives = 60/92 (65%)
 Frame = +3

Query: 348 SLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPP 527
           S +SS  S   +SS+  SSSS+  S S S S S+S +S+ S+SSSS ++ S SS S S  
Sbjct: 467 SSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNK 526

Query: 528 SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SSS+  SS+SS+  S SS S SS +SN++S S
Sbjct: 527 SSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSS 558

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 46/95 (48%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +S+SS  S S S S S+S   ++SS+SSS ++ S SS S 
Sbjct: 486 SSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSS 545

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS + SS +S+S+S S
Sbjct: 546 SSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSS 580

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 42/95 (44%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ + SSS  S   SSS+  + SSS  S S S + S+S +S++SSSSS+ ++ S SS S 
Sbjct: 505 SNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSS 564

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S S+ S SS +SN+++ S
Sbjct: 565 SSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSS 599

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 46/95 (48%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S    SS+  SSSSS  S S S S S+S +S  SSSSSS  + S S+ S 
Sbjct: 512 SSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSS 571

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S+S  S SS + S+ +S+S+S S
Sbjct: 572 SSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNS 606

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   S+++  SSSS+  S S S S S+S +S++SSSS+S ++ S S+ S 
Sbjct: 538 NSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSN 597

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  + SS S SS +S+S+S S
Sbjct: 598 SSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSS 632

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 43/95 (45%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  +   SSS+  ++SSS  S + S S S+S +S++SSS+SS ++ S S+ S 
Sbjct: 742  SSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSS 801

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS+SSS  S SS + SS +S+S S S
Sbjct: 802  SSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNS 836

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  +   SSS+  SSSSS  + S S S S S +S++SSSS+S ++ S SS S 
Sbjct: 797  SNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSS 856

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +SS++ SS SSS  S +S S SS +S+S+S S
Sbjct: 857  SSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNS 891

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  S   SSS+  +SSSS  S S S S S S +S++S+SSSS ++ S SS S 
Sbjct: 824  NSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSN 883

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+S+S  S SS S SS +S+S++ S
Sbjct: 884  SSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNS 918

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 44/95 (46%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S S S + ++S +S+++SSSSS ++ + SS + 
Sbjct: 864  SSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNS 923

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SS+  S S+ S SS +S+S+S S
Sbjct: 924  SSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSS 958

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  S   SSS+  SSSS+  S S S S S+S ++++SSS+SS ++ S SS S 
Sbjct: 898  SNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSS 957

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ S++SSS  S S+ + SS +S+S S S
Sbjct: 958  SSSSSSSSSSNSSSSSSSSSNSNSSSSSSSSNSSS 992

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 44/93 (47%), Positives = 61/93 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SS+  S   SSS+  SSSSS  S + S S ++S +S +SSSSSS ++ S SS S 
Sbjct: 909  SSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSSSSSSSSN 968

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S  SSS++ +S SSS  S S+ S SS +S+S++
Sbjct: 969  SSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSST 1001

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 44/95 (46%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S S  S   SSS+  SSSSS  S S S S S+S + ++SSSSSS ++ S S+ S 
Sbjct: 379 SSSSSSRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSS 438

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS SSS  S S+ S S+  S+++S S
Sbjct: 439 SSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSS 473

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S S+ + 
Sbjct: 401 SSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNS 460

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +++++ SS+SSS  + SS S SS  SNS+S S
Sbjct: 461 SSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSS 495

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           ++ S SSS  S   SSS+  SSS+S  S S S + S+S +S ++SSSSS ++ S SS S 
Sbjct: 465 NNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSS 524

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS + SS+S+S  S SS S SS ++NS+S S
Sbjct: 525 NKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSS 559

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/95 (47%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS   SSSSS  S S S S S   +S+ SSSSSS ++ S SS S 
Sbjct: 489 SNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSS 548

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S++++ SS+S+S  S +S S SS +S+S+S S
Sbjct: 549 SSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSS 583

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   S+S+  SSSSS  S S S   S+S +S++SS+SSS ++ S SS S 
Sbjct: 493 SSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSS 552

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ +S+SSS  S SS S SS +S+S++ S
Sbjct: 553 NNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSS 587

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 43/95 (45%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  +   SS++  SSSSS  S S S + S+S +S+ +S+SSS ++ + SS S 
Sbjct: 552 SNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSS 611

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 612 SNSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 646

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 43/95 (45%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S++ +S++SSSS++ ++ S S+ S 
Sbjct: 715 SSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSS 774

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S+S  S SS S +S +S+S++ S
Sbjct: 775 SSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSS 809

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 46/95 (48%), Positives = 60/95 (63%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S ++S  S   +SS+  SSSSS  S S + S S+S +S  SSSSSS  + S SS S 
Sbjct: 721  SSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSS 780

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SSS  + SS S SS +S+S+S S
Sbjct: 781  SSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSS 815

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +SS  S   S+++  SSSS+  S S S S S+S +S +SSSSSS +  S SS S 
Sbjct: 747  SSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSS 806

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ SS+SSS  + SS S SS +++S+S S
Sbjct: 807  NSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSS 841

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 47/95 (49%), Positives = 59/95 (62%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S ++S  S   +SS+  SSSSS  S S + S S+S +S  SSSSSS  + S SS S 
Sbjct: 757  SSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSS 816

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+SSS  S SS S SS  S+S+S S
Sbjct: 817  SSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSS 851

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 43/95 (45%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  +   SSS+  SSSSS  + S S S S++ +S++SSS+SS ++ S SS S 
Sbjct: 761  SNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSS 820

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +SS++ SS++S+  S SS S SS +S+S+S S
Sbjct: 821  SSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSS 855

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +SS  S   S+++  SSSS+  S S S S S+S +S +SSSSSS  + S SS S 
Sbjct: 783  SSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSS 842

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  + SS S S+ +S+S+S S
Sbjct: 843  SNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNS 877

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 43/95 (45%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SS+  S   SSS+  SSSS+  S S S + ++S +S++S+SSSS ++ S SS S 
Sbjct: 800  SSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSS 859

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ SS+SSS  S SS S SS +S++++ S
Sbjct: 860  NSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSS 894

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/95 (47%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +SS  S   SSS+  S+SSS  S S S S S S +S++SS++SS +  S SS S 
Sbjct: 871  SSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSS 930

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+S+S  S +S S SS +S+S+S S
Sbjct: 931  SSSSSSSNSSSSSNSSSSSNSSSSSSSSSSSSSSS 965

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  +SSSS  + S S S ++S +S++S++SSS  + S SS S 
Sbjct: 872  SSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSS 931

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS++SS  S SS S SS +S+S+S S
Sbjct: 932  SSSSSSNSSSSSNSSSSSNSSSSSSSSSSSSSSSS 966

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   +SS+  SSS++  S + S S S+S +S++SS+SSS +  S SS S 
Sbjct: 893  SSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSS 952

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S S+  S+S+S S
Sbjct: 953  SSSSSSSSSSSSSSSNSSSSSSSSSNSNSSSSSSS 987

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  +   SSS+  +SSSS  S S S S S+S +S +SSSS+S ++ + SS S 
Sbjct: 897  NSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSSSSS 956

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS SSS  S SS S SS +S+S++ S
Sbjct: 957  SSSSSSSSSSSNSSSSSSSSSNSNSSSSSSSSNSS 991

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 46/95 (48%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S ++S +S+ S+SSSS    S SS S 
Sbjct: 415 SSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSS 474

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+S+S  S SS S SS +S+S S S
Sbjct: 475 SSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNS 509

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 46/95 (48%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS++  SSS+S  S S S S S++  S+ SSSSSS    S SS S 
Sbjct: 427 SSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSS 486

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS SSS  S +S S SS +S+S+S S
Sbjct: 487 SNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSS 521

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 45/93 (48%), Positives = 60/93 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S ++S  S   SSS   SSSSS  S S S S S+S +S++SSS+S+ ++ S SS S 
Sbjct: 460 SSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSS 519

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SS+ + SS SSS  S SS S SS +S+S+S
Sbjct: 520 SSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSS 552

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   +SS+  SS+SS  S S S S S+S +S++SSSSSS  + S +S S 
Sbjct: 476 SNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSS 535

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S++ S
Sbjct: 536 SSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSS 570

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 43/95 (45%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           ++ S SSS  S   SSS+  S+SSS  S + + S S+S +S++SSSSS+ ++ S SS S 
Sbjct: 477 NNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSS 536

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S S+ +S+S S S
Sbjct: 537 SNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSS 571

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SS++  SSSS+  S S S S S+S +S+++ SSSS ++ S S+ S 
Sbjct: 482 SSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSS 541

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS +SS  S S+ S SS +S+S+S S
Sbjct: 542 SSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSS 576

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 45/95 (47%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSS+   S + S S S S +S++SSSSSS +  S SS S 
Sbjct: 502 SSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSS 561

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS + SS+SSS  S SS S SS +S+S++ S
Sbjct: 562 NSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNS 596

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 43/95 (45%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS+   SS+SS  S + S S S+S +S++S++SSS ++ + SS S 
Sbjct: 509 SSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSN 568

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S+ +++S+S S
Sbjct: 569 SSSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSS 603

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  S++SS  S S S S S S +S++SSSSSS ++ + SS S 
Sbjct: 532 SSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSS 591

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +S+++ SS+S+S  S SS S SS +S+S+S S
Sbjct: 592 SSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSS 626

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 42/95 (44%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  ++SSS  S + S S S+S +S++SSS+SS ++ S S+ S 
Sbjct: 706 SSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSS 765

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S SS + SS +S+S++ S
Sbjct: 766 SSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNS 800

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  +   SSS+  SSSSS  S S S S S S +S++SSS++S ++ S +S S 
Sbjct: 752  NSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSS 811

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS++SS  S SS S SS +S+S++ S
Sbjct: 812  SSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSS 846

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  S+S+S  S S S S S+S +S++SSSSS+ ++ S S+ S 
Sbjct: 812  SSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSS 871

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S++ SS SSS  S S+ S S+  S+S+S S
Sbjct: 872  SSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSS 906

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +SS  S   +S++  SSSSS  S S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 819  SSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSS 878

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S++ SS S+S  S S+ S SS +++S+S S
Sbjct: 879  SSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSS 913

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   SSS   SSSSS  S S S + S+S +S +SSSSSS ++ S S+ S 
Sbjct: 827  SSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSS 886

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +S+++ S+++SS  S S+ S SS +SN++S S
Sbjct: 887  SSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSS 921

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  S   SS++  SSS+S  S S S S S+S ++++SSSSSS  + S +S S 
Sbjct: 867  SNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSS 926

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS SSS  + SS S SS +S+S+S S
Sbjct: 927  SSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSS 961

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 43/95 (45%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +S+  S   +SS+  SS+SS  S S + S S++ +S++SSSSSS ++ + SS S 
Sbjct: 885  SSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSN 944

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SS+++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 945  SSSSSNSSSSSSSSSSSSSSSSSNSSSSSSSSSNS 979

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S  SS  S   SSS+  SSSSS  S S + S S+S  S++SSSSSS ++ S +S S 
Sbjct: 380 SSSSSRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSS 439

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ S++SSS  + +S S ++ +SNS+S S
Sbjct: 440 SSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSS 474

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 43/93 (46%), Positives = 61/93 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS   S   SSS+  SSS+S  S S + S S+S +S++SS+S+S ++ + SS S 
Sbjct: 412 SSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSS 471

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SS+ + SS+SSS  S SS S SS +S+S+S
Sbjct: 472 SSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSS 504

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 44/95 (46%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  +   S++   +SSSS  S + S S S+S  S +SSSSSS ++ S SS S 
Sbjct: 449 SNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSN 508

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS    SS + SS +SNS+S S
Sbjct: 509 SSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSS 543

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 45/95 (47%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  S+S+S  S S + S S+S  S +SSSSSS ++ S SS + 
Sbjct: 467 SSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNK 526

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS SSS  S SS S SS  S+S+S S
Sbjct: 527 SSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSS 561

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 45/95 (47%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  +SSSS  S S S S S S +S++SSSSSS ++ S +  S 
Sbjct: 470 SSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSS 529

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S +S +S+S++ S
Sbjct: 530 SNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSS 564

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SS++  SSSSS  S S S S + S +S +SSSSS+ ++ S SS S 
Sbjct: 490 NSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSS 549

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  ++S++ SS++SS  S SS S SS +S+S+S S
Sbjct: 550 SSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSS 584

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 45/95 (47%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+ SS  + S S S S+S +S++SSSSSS  + S SS + 
Sbjct: 504 SSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNS 563

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SSS  S SS S SS +S++ S S
Sbjct: 564 SSSSNSSSSSSSSSSSSSSSSNSSSSSSSSNNSNS 598

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 44/95 (46%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS+  SSS++  S S S S S+S +S++SSSSSS ++ S +S S 
Sbjct: 530 SNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSS 589

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+++  SS+SSS  S SS S S+ +S+S+S S
Sbjct: 590 SSSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSS 624

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 42/95 (44%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  +   SSS+  SSSSS  + S S S S++ +S++SSS+SS ++ S SS S 
Sbjct: 725  SNNSSSSSSSNSSSSSSSSSSSSSSSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSSS 784

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +SS++ SS+S++  S SS + SS +S+S+S S
Sbjct: 785  SSSNSSSSSSSSSNNSSSSSSSNSSSSSSSSSSSS 819

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 43/95 (45%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  +SSSS  S + S S S+S +S++SS+SSS ++ + SS S 
Sbjct: 815  SSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSS 874

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  + SS + +S +S+S++ S
Sbjct: 875  SNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSS 909

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   S+S+  SSSSS  S S + S S+S  S++SSSS+S ++ S SS S 
Sbjct: 829  SSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSS 888

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +SS++ S++SSS  S SS S SS  ++S+S S
Sbjct: 889  SNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNS 923

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 42/95 (44%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  S   SSS   SSSSS  S S S + S+S ++++SSSS+S ++ S S+ S 
Sbjct: 843  SNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSS 902

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S++ SS+S++  S +S S SS +S+S+S S
Sbjct: 903  SSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSS 937

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   +SS+  SS+SS  S S S S S++ +S++S+S+SS +  + SS S 
Sbjct: 846  SSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSS 905

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ S+ SSS  S SS S SS +S+S++ S
Sbjct: 906  SNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSS 940

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 43/95 (45%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SS+  S   +SS+  S+S+S  S S S S S+S +S++SSSS++ ++ + SS S 
Sbjct: 869  SSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSS 928

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 929  SSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSSSSS 963

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 44/95 (46%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   S+S+  +S+SS  S S S S S+S  +++SS+SSS ++ S SS S 
Sbjct: 877  SSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSS 936

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS+  SS+S+S  S SS S SS +S+S S S
Sbjct: 937  SNSSSSSNSSSSSNSSSSSSSSSSSSSSSSSNSSS 971

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S +SS  S   +SS+  S+SSS  S + S S S+S  S++S+SSSS ++ S SS S 
Sbjct: 878  SSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSS 937

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS + SS++SS  S SS S SS +S+++S S
Sbjct: 938  NSSSSSNSSSSSNSSSSSSSSSSSSSSSSSNSSSS 972

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 43/95 (45%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S +S+  S   S+S+  SSSS+  S S S S S+S +S++SSS+SS ++ S SS + 
Sbjct: 892  NSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNS 951

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +++S+S S
Sbjct: 952  SSSSSSSSSSSSSSSSNSSSSSSSSSNSNSSSSSS 986

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 44/95 (46%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS +  SSSSS  S S S S S+S ++++SSSS+S ++ S S+ S 
Sbjct: 403 SSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSS 462

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS + SS+SS+  S SS S S+  S+S+S S
Sbjct: 463 SNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSS 497

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 43/95 (45%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   +SS+  S+S+S  S + S + S+S +S  SSSSSS ++ S SS S 
Sbjct: 436 SSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSS 495

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S+++SS  S SS S SS +SN +S S
Sbjct: 496 SSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSS 530

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 43/95 (45%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  S+SSS  S + S S S++  S++SSSSSS ++ S S+ S 
Sbjct: 469 NSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSS 528

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  S SS S ++ +S+S+S S
Sbjct: 529 SSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNS 563

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   +SS+  SS+S+  S S S S S+S +S  SSSS+S ++ S SS S 
Sbjct: 484 SSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSS 543

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +++SSS  S SS S +S +S+S+S S
Sbjct: 544 SSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSS 578

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  +   SSS+  +SSSS  S S S S S++ +S+++SSSSS  + S SS S 
Sbjct: 488 NSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSS 547

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+ + SS+SS+  S S+ S SS +S+S+S S
Sbjct: 548 SSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSS 582

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 42/95 (44%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  ++SSS  S + S S ++S +S++SSSSSS ++ S SS S 
Sbjct: 533 SSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSSSS 592

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS++SS  S S+ + SS +S+S+S S
Sbjct: 593 SNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSS 627

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 44/95 (46%), Positives = 60/95 (63%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  +   SSS   SSSS+  S S + + S+S +S +SSSSSS    S S+ S 
Sbjct: 866  SSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSS 925

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS++SS  S SS S +S +S+S+S S
Sbjct: 926  SSSSSSSSSSSSNSSSSSNSSSSSNSSSSSSSSSS 960

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 44/95 (46%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            S+ S SSS  S   S+S   SS+S+  S S S S S+S +S  SSSS+S ++ S SS S 
Sbjct: 875  SNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSS 934

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  +SS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 935  SSSNSSSSSNSSSSSNSSSSSSSSSSSSSSSSSNS 969

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 43/95 (45%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + +SS  S   SSS+  SS++S  S S S S S+S +S++S+SSSS  + S S+ S 
Sbjct: 894  SSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSSSSNSSSSSNSSS 953

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SS+  S SS S +S +S+S+S S
Sbjct: 954  SSSSSSSSSSSSSSNSSSSSSSSSNSNSSSSSSSS 988

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 43/95 (45%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS+  SSSSS  S S S + S+S ++++SSSS+S ++ S ++ S 
Sbjct: 410 STSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSN 469

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S S+ S SS +++S+S S
Sbjct: 470 SSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSS 504

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 43/95 (45%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S++  S   SSS   SSSSS  + S S S +++ +S++SSSSSS ++ S  S S 
Sbjct: 471 SSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSS 530

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS+  SS+SSS  S SS + SS +S+S S S
Sbjct: 531 NSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSS 565

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+ +  S+SSS  S S S S S+S +S++++SSSS ++ S SS + 
Sbjct: 510 SSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNS 569

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S ++  S+S+S S
Sbjct: 570 SSSSSSSSSSSSSSSNSSSSSSSSNNSNSSSSSSS 604

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S + S  S   SSS+  SSSSS  S S S + S+S +S+ SSSSS+ ++ S SS S 
Sbjct: 520 SSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSS 579

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SS+  + SS S S+ +S+S+S S
Sbjct: 580 SSSSSNSSSSSSSSNNSNSSSSSSSNSSSSSSSNS 614

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  S   SSS+  SSSSS  S S S + S+S +S +SSSSS+ ++ S +S S 
Sbjct: 835  NSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSS 894

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S++ SS++SS  S SS + SS  S+S+S S
Sbjct: 895  SSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSS 929

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 44/95 (46%), Positives = 61/95 (64%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  S+SSS  S + S S S S +S+++S+SSS  + S SS S 
Sbjct: 847  SSSSSSSSSSSSSNSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSS 906

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ +++SSS  S SS S SS +S+S S S
Sbjct: 907  NSSSSSSSSNNSSSSNSSSSSSSSSSSSSSSNSSS 941

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 47/96 (48%), Positives = 60/96 (62%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  S SSS  S S S S S++ +S++SS+SSS ++ S SS S 
Sbjct: 398 SSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSN 457

Query: 519 SPPSSSTALSS-TSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS   SS +SSS  S +S S SS +SNS S S
Sbjct: 458 SNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSS 493

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 42/95 (44%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S + ++S ++  SS+SSS ++ + SS S 
Sbjct: 424 SSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSS 483

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S + SS+SS+  S SS + +S +S+S+S S
Sbjct: 484 SSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSS 518

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S S S S S+S  + +S+SSSS ++ + SS S 
Sbjct: 425 SSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSS 484

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +S+++ SS+S+S  S SS S SS +S+S+S S
Sbjct: 485 SSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSS 519

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 43/95 (45%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +S+  S   +SS   SSSSS  S S S S S S +S++SSS+SS ++ S S+ S 
Sbjct: 452 SSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSS 511

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S+   S +S S SS +S+S+S S
Sbjct: 512 SSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSS 546

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 42/95 (44%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + +SS  S   SSS+  S+S+S  S S S S S+S ++ +SSS+SS ++ + SS S 
Sbjct: 485 SSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSS 544

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  + SS S SS +S+S+S S
Sbjct: 545 SSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSS 579

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 41/95 (43%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + SSS  S   SSS+  +SSSS  S + + S S+S ++++SSSSSS ++ S S+ S 
Sbjct: 804  SSSNSSSSSSSSSSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSS 863

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S++ SS++SS  S +S S SS +++S+S S
Sbjct: 864  SSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNS 898

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 44/95 (46%), Positives = 64/95 (67%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S S+S  S   +SS+  S+SSS  S S S S +++ +S++SS+SSS ++ S +S S 
Sbjct: 862  SSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSS 921

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            +  SSS++ SS+SSS  S SS S SS +SNS+S S
Sbjct: 922  NSSSSSSSSSSSSSSSNS-SSSSNSSSSSNSSSSS 955

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 43/95 (45%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SS   S   SSS+  SSSSS  + S S + S+S +S +SSSSSS ++ S SS S 
Sbjct: 378 NSSSSSSRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSS 437

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS++SS  S +S S SS  ++S S S
Sbjct: 438 SSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSS 472

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 42/93 (45%), Positives = 59/93 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S  S SSS  S   SSS+  S+SSS  + S S S  +S +S++SSSSSS +  S SS S 
Sbjct: 384 SRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSN 443

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS + SS+S+S  S S+ + S+ +S+S+S
Sbjct: 444 SSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSS 476

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 42/95 (44%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  SSS+S  S S S S S++  S++S+++SS ++ S SS + 
Sbjct: 420 SSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNS 479

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S SS S SS +++S+S S
Sbjct: 480 SSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSS 514

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 43/95 (45%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  +   SSS   SSSS+  S + S S S++ +S++SSSSS+  + S SS + 
Sbjct: 440 SSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNS 499

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S S+ +S+S S S
Sbjct: 500 SSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSS 534

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 42/95 (44%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  +   SSS+  +SSSS  S S S S S+S +S++SSSS+  ++ + SS S 
Sbjct: 478 NSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSS 537

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S +S +S+++S S
Sbjct: 538 NSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSS 572

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 40/95 (42%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SS+  S   SSS+  SS++S  S S + S S++ +S++SSSSSS ++ S SS S 
Sbjct: 531 NSSSSSSNSSSSSSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSSSSSSSSSNSSSSS 590

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  ++S + SS+SS+  S SS + +S +S+S+S S
Sbjct: 591 SSSNNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSS 625

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 42/96 (43%), Positives = 60/96 (62%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           P     SSS  S   SSS+  SSSSS  S S + S S++ +S++SS SSS ++ S SS S
Sbjct: 373 PERKGNSSSSSSRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSS 432

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ +S+SSS  S SS S S+ +S++ + S
Sbjct: 433 SSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSS 468

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS+SS  S S S S S S +S++SSSSSS ++ + SS S 
Sbjct: 383 SSRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGS-SSSSSSSSSSSSSSNSSSSSS 441

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS + +S  S+S+S S
Sbjct: 442 SNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSS 476

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 44/95 (46%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS   SSSSS  S S S + S+S +S +SSSSS+ ++ S +S S 
Sbjct: 402 SSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSS 461

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  ++S+  SS+SSS  S SS S SS +++S+S S
Sbjct: 462 SSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSS 496

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 42/95 (44%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  S S S S +++ +S+ ++SS+S ++ S ++ S 
Sbjct: 422 SSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSS 481

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S +S +S+S+S S
Sbjct: 482 SSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSS 516

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 44/95 (46%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  + S S S S S +S  +SS+SS ++ S +S S 
Sbjct: 423 SSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSS 482

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS++  SS+SSS  S SS S S+ +S+S+S S
Sbjct: 483 SSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSS 517

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 42/95 (44%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSS+  S S + + S+S  ++++SSSSS +  S SS S 
Sbjct: 426 SSSSSSSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSS 485

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS++SS  S S+ + SS +S+S+S S
Sbjct: 486 SSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSS 520

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 44/95 (46%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  +   SSS   SS+SS  S S + S S+S +S ++SSSSS +  S SS S 
Sbjct: 447 SSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSN 506

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S  S S +S +S+S S S
Sbjct: 507 SNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSS 541

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 42/95 (44%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   ++S+  SSSSS  + S S S S++  S++SSSS+S ++ S +S S 
Sbjct: 451 SSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSS 510

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  S S+ S SS  S+S+S S
Sbjct: 511 SSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSS 545

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 41/95 (43%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +S+  S   S+S+  SSS+S  S S S S S+S +S+  SSSS+ ++ S +S S 
Sbjct: 483 SSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSS 542

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S+ SSS  S +S S S+ +S+S+S S
Sbjct: 543 SSSSSSSSSSNNSSSSSSSNSSSSSNSSSSSSSSS 577

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 40/93 (43%), Positives = 59/93 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSP    +  S    SS+  SSSSS  S S S S S+S ++++SSSSS  ++ S SS S 
Sbjct: 371 SSPERKGNSSSSSSRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSS 430

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  S+S++ SS++SS  S +S S SS +++S+S
Sbjct: 431 SSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSS 463

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 43/95 (45%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SS SS  S S S S S+S +S++SSS+SS ++ + SS S 
Sbjct: 397 SSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSSSSS 456

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS+  +S++SS  S S+ S SS +S+S S S
Sbjct: 457 NSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNS 491

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S S++  S   SSS+  +SSSS  S S S S S+S ++++SSSSS+  + S SS S 
Sbjct: 458 SNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSSS 517

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+S+S  S S+ S SS +S+S+S S
Sbjct: 518 SSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSSS 552

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 54/133 (40%), Positives = 74/133 (55%), Gaps = 4/133 (3%)
 Frame = +3

Query: 237  SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
            SS SS S     SS  +N +     S        SS S SSS  +   SSS+  SSSSS 
Sbjct: 816  SSSSSSSSNSSSSSSSSNSNSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSS 875

Query: 417  RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSS----TALSSTSSSIFSISSL 584
             S S S + S+S +++ SSSS+S ++ S SS S S  SSS    ++ SS+SSS  S SS 
Sbjct: 876  NSSSSSSNSSSSSSNSNSSSSNSNSSSSSSSNSSSSSSSSNNSSSSNSSSSSSSSSSSSS 935

Query: 585  SLSSPASNSTSLS 623
            S +S +S+++S S
Sbjct: 936  SSNSSSSSNSSSS 948

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 45/96 (46%), Positives = 63/96 (65%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTS-ATSSSSSSPATPSRSS*S 515
           SS S SSS  S   SSST  SSSSS  S S S S S+S +S ++SSSSS+ ++ S +S S
Sbjct: 394 SSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSSSSSSSSNSSSSSSSNSSSSSSNSSS 453

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  S+S++ ++ SS+  S SS + SS +S+S+S S
Sbjct: 454 SSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNS 489

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 41/93 (44%), Positives = 62/93 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  + S S + S++ +S++SS++SS ++ S S+ + 
Sbjct: 432 SSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNS 491

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS + SS+SS+  S SS S SS +S+S+S
Sbjct: 492 SSSSSSNSSSSSSSNSNSSSSSSSSSSSSSSSS 524

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 43/95 (45%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS+   S+SSS  S + S S S+S +++ SSSSSS  + S SS + 
Sbjct: 448 SSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNS 507

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  + SS S SS +S+++S S
Sbjct: 508 NSSSSSSSSSSSSSSSSNKSSSSNSSSSSSNSSSS 542

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 42/95 (44%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   +SS+  SS++S  S S S + ++S +S+++SSSSS +  + SS S 
Sbjct: 455 SSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSS 514

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S+ SSS  S SS S SS +S+S+S S
Sbjct: 515 SSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSS 549

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 43/95 (45%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ + SSS  +   SSS+  S++SS  S S S S S+S +S+ SSSSSS  + S SS S 
Sbjct: 456 SNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSS 515

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ + +SSS  S SS + SS +S+S+S S
Sbjct: 516 SSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSS 550

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 43/95 (45%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SS+  S   SSS+  ++SSS  S S + + S+S +S +SSSSSS +  S SS S 
Sbjct: 457 NSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSSSSS 516

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SS+  S SS S SS +S+S+S S
Sbjct: 517 SSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSSSSS 551

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 44/95 (46%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  SSSSS  S S S S S+S +S++SS+SSS ++ S SS S 
Sbjct: 406 SSSSSTSSSSSSSGSSSSSSSSSSS-SSSSNSSSSSSSNSSSSSSNSSSSSSNSNSSSSN 464

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  S+S++ SS+++S  S SS S S+ +S+S+S S
Sbjct: 465 NNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNS 499

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 46/96 (47%), Positives = 61/96 (63%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS++  SSS++  S S S S S + +S++SSSS+S ++ S SS S 
Sbjct: 441 SSNSSSSSSNSSSSSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSS 500

Query: 519 SPPSS-STALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS S + SS+SSS  S SS S  S +SNS+S S
Sbjct: 501 SSSSSNSNSSSSSSSSSSSSSSSSNKSSSSNSSSSS 536

 Score = 54.3 bits (129), Expect = 9e-06
 Identities = 40/83 (48%), Positives = 55/83 (66%)
 Frame = +3

Query: 375 VPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSST 554
           + SS     +SSS  S S S S S+S +S++SSSSS+ ++ S SS S S  SSS++ SS+
Sbjct: 369 ISSSPERKGNSSSSSSRSSSSSSSSSSSSSSSSSSSNSSSSSTSSSSSSSGSSSSSSSSS 428

Query: 555 SSSIFSISSLSLSSPASNSTSLS 623
           SSS  S SS S SS +S+S+S S
Sbjct: 429 SSSSSSNSSSSSSSNSSSSSSNS 451

 Score = 54.3 bits (129), Expect = 9e-06
 Identities = 41/95 (43%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + +SS  +   S+S+  SSS++  S S S S S S +S++S+SSSS ++ S SS S 
Sbjct: 454 SSSNSNSSSSNNNSSNSSSSSSSNNSSSSSSSSSNSNSSSSSSSNSSSSSSSNSNSSSSS 513

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS  SS  + SS S +S +S+S+S S
Sbjct: 514 SSSSSSSSSSSNKSSSSNSSSSSSNSSSSSSSSSS 548

[72][TOP]
>UniRef100_UPI0000DA363D PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA363D
          Length = 315

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SS+SSS ++ S SS S 
Sbjct: 194 SSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSS 253

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +SNS+S S
Sbjct: 254 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSS 288

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 159 SSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S S+ S SS +SNS+S S
Sbjct: 219 SNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSS 253

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S ++S +S++SSSSSS ++ S SS S 
Sbjct: 150 SSSSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 209

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S S+ S SS +SNS+S S
Sbjct: 210 SSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSS 244

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS+S ++ S SS S 
Sbjct: 173 SSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSS 232

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 233 SSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSS 267

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS +  S SS S 
Sbjct: 188 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSS 247

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 248 NSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 282

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 171 SSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSN 230

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S+S S
Sbjct: 231 SSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSS 265

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSS+ ++ S SS S 
Sbjct: 182 SSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSS 241

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 242 SSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSS 276

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S+SSSS ++ + SS S 
Sbjct: 186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSS 245

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 246 SSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 280

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S + S+S +S+++SSSSS ++ S SS S 
Sbjct: 187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSS 246

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 247 SNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 281

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S+SSSS ++ S SS S 
Sbjct: 176 SSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSS 235

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS++SS  S SS S SS +S+S+S S
Sbjct: 236 SSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSS 270

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+++SSSSS ++ + SS S 
Sbjct: 177 SSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSS 236

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 237 SSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 271

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 178 SSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSS 237

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S SS S SS +S+S+S S
Sbjct: 238 SNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 272

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSSS ++ S SS + 
Sbjct: 181 SSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNS 240

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 241 SSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 275

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S ++++SSSSSS ++ S SS + 
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNS 249

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 250 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNS 284

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS+S ++ S S+ S 
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSS 251

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 252 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSS 286

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+S  S S S + S+S +S+ SSSSSS +  S SS S 
Sbjct: 197 SSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSS 256

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 257 SSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSS 291

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S+S  S++SSSSS+ ++ S SS S 
Sbjct: 200 SSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSS 259

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 260 SSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSS 294

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S++ +S++SSS+SS ++ S SS S 
Sbjct: 202 SSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSS 261

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 262 SSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSS 296

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  SSSSS  S S S S S+S +S+++SSSSS ++ S SS S 
Sbjct: 205 SSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSS 264

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 265 SSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSS 299

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+S  S S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 207 SSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSS 266

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 267 SSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSS 301

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  S S S S S+S  S++SSSSSS ++ S SS S 
Sbjct: 209 SSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSS 268

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 269 SSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSS 303

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S++ +S++SSSSSS ++ S SS S 
Sbjct: 211 SSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSS 270

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS++SS  S SS S SS +S+S+S S
Sbjct: 271 SSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSS 305

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  + S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 212 SSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 271

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 272 SSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 306

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS   SSSSS  S S S S ++S +S++SSSSSS ++ S SS S 
Sbjct: 213 SSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 272

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S SS S SS +S+S+S S
Sbjct: 273 SSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 307

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S + S+S +S++SSSSSS ++ S SS S 
Sbjct: 152 SSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 211

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 212 SSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSS 246

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 168 SNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSS 227

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S S+ S SS +S+S+S S
Sbjct: 228 SSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSS 262

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  SSSSS  S S S S S+S ++++SSSSSS  + S SS S 
Sbjct: 180 SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSN 239

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 240 SSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 274

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S + S S S+S  S++SSSSS+ ++ S SS S 
Sbjct: 191 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSS 250

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S++ S
Sbjct: 251 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSS 285

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 50/98 (51%), Positives = 65/98 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSS+S  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 216 SSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 275

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FS 632
           S  SSS+  SS+SSS  S SS S SS +S+S+S S +S
Sbjct: 276 SSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSWS 313

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 161 SSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSN 220

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  S SS S SS  S+S+S S
Sbjct: 221 SSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSS 255

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSS+ ++ S SS + 
Sbjct: 172 SSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNS 231

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 232 SSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSS 266

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  S S S S ++S +S++SS+SSS ++ S SS S 
Sbjct: 185 NSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSS 244

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 245 SSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 279

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S S S+S +S+++SSSSS ++ S SS S 
Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSS 255

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 256 SSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSS 290

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S + S S S+S +S++SSSS+S ++ S SS S 
Sbjct: 201 SSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSS 260

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS + SS +S+S+S S
Sbjct: 261 SSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSS 295

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS++  SSSSS  S S S S ++S +S++S+SSSS ++ S SS S 
Sbjct: 204 SSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSS 263

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S +S S SS +S+S+S S
Sbjct: 264 SSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSS 298

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS+SS  S S + S S+S ++++SSSSSS ++ S SS S 
Sbjct: 208 SSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSS 267

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 268 SSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSS 302

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SS++  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 214 SSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSS 273

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 274 SSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSS 308

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 155 SSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S SS S +S +S+S+S S
Sbjct: 215 SSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNS 249

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 157 SSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+S+S  S SS + SS +S+S S S
Sbjct: 217 SSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSS 251

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  + S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 158 SSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 217

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS++SS  S SS S SS +S+++S S
Sbjct: 218 SSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSS 252

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 166 SSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSS 225

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+S+S  S SS + SS +S+S+S S
Sbjct: 226 SSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSS 260

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ + SS S 
Sbjct: 167 SSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSS 226

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS++SS  S SS S SS +S+S+S S
Sbjct: 227 SSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSS 261

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SS+SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 163 SSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSS 222

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S S+ +S+S+S S
Sbjct: 223 SSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSS 257

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 170 SSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSS 229

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 230 NSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSS 264

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSS+SS ++ S S+ S 
Sbjct: 174 SSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSS 233

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 234 SSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSS 268

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS +  S SS S 
Sbjct: 179 SSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSS 238

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 239 NSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSS 273

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S++ +S++SSSS+S ++ S S+ S 
Sbjct: 183 SSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSS 242

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 243 SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 277

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS+SS  S S S S S+S +S +SSSSSS  + S SS S 
Sbjct: 198 SSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSS 257

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S+ +S+S+S S
Sbjct: 258 SSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSS 292

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  S S + S S+S ++++SSSSSS ++ S SS S 
Sbjct: 199 SSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSS 258

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S +S +S+S+S S
Sbjct: 259 SSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSS 293

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  + S S S S S +S++SS+SSS ++ S SS S 
Sbjct: 203 SSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSS 262

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S+ S SS +S+S+S S
Sbjct: 263 SSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSS 297

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSS+  S S S + S+S +S+ SSSSSS ++ S SS S 
Sbjct: 206 SSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSS 265

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S+S S
Sbjct: 266 SSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSS 300

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  +SSSS  S + S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 210 SSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSS 269

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S+S  S SS S SS +S+S+S S
Sbjct: 270 SSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSS 304

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   S+S+  SSSS+  S S S + S+S +S++SSSSSS ++ S SS S 
Sbjct: 215 SSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 274

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 275 SSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 309

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  +SSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 149 SSSSSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 208

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+++S S
Sbjct: 209 SSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSS 243

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SS++  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 153 SNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 212

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  + SS S SS +S+S+S S
Sbjct: 213 SSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSS 247

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S + S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 156 SSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SS+  S SS S SS +S+S++ S
Sbjct: 216 SSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSS 250

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  SSS+S  S S S S S+S +S++SSSSSS ++ S SS + 
Sbjct: 162 SSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNS 221

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S+S S
Sbjct: 222 SSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSS 256

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  S+SSS  S S S S S+S +S++SSSSSS ++ S S+ S 
Sbjct: 164 SSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSS 223

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S +S +S+S+S S
Sbjct: 224 SSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSS 258

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S+S +S++SSSSSS ++ S +S S 
Sbjct: 165 SSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSS 224

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 225 SSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSS 259

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SS++  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 169 NSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSS 228

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S +S S SS +S+S+S S
Sbjct: 229 SNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSS 263

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S S S S S+S +S++SS+SSS ++ S +S S 
Sbjct: 175 SSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSS 234

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+S+S  S SS S SS +S+S+S S
Sbjct: 235 SSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSS 269

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS+  SSSSS  S S S S S S +S++SSS+SS ++ S +S S 
Sbjct: 184 SNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSS 243

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 244 SSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 278

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  S+SSS  S S S S S++ +S++SSSSSS ++ S SS S 
Sbjct: 148 SSSSSSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSS 207

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS++SS  S SS + SS +S+S S S
Sbjct: 208 SSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSS 242

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 46/99 (46%), Positives = 62/99 (62%)
 Frame = +3

Query: 327 LLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRS 506
           ++R  S SL         SSS+  +SSSS  S S S S ++S +S++SSSSSS +  S S
Sbjct: 130 VVRTESDSLLLCSKYGGQSSSSSSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSS 189

Query: 507 S*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSS 228

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 42/96 (43%), Positives = 60/96 (62%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           P++P + +   S +  S     SSSS  + S S S S+S +S+ SSSSSS ++ S SS +
Sbjct: 126 PAAPVVRTESDSLLLCSKYGGQSSSSSSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSN 185

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNS 221

 Score = 54.3 bits (129), Expect = 9e-06
 Identities = 43/104 (41%), Positives = 59/104 (56%)
 Frame = +3

Query: 312 SFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPA 491
           S F   L P +     + P     S +LL  S      S S S S+S +S++SSSSSS +
Sbjct: 111 SEFITKLNPDNRGCEPAAPVVRTESDSLLLCSKYGGQSSSSSSNSSSSSSSSSSSSSSNS 170

Query: 492 TPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           + S SS S S  SS+++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 171 SSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

[73][TOP]
>UniRef100_UPI0000DA34BF PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA34BF
          Length = 278

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SS+SSS ++ S SS S 
Sbjct: 157 SSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSS 216

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +SNS+S S
Sbjct: 217 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSS 251

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 122 SSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 181

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S S+ S SS +SNS+S S
Sbjct: 182 SNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSS 216

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S ++S +S++SSSSSS ++ S SS S 
Sbjct: 113 SSSSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 172

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S S+ S SS +SNS+S S
Sbjct: 173 SSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSS 207

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS+S ++ S SS S 
Sbjct: 136 SSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSS 195

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 196 SSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSS 230

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS +  S SS S 
Sbjct: 151 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSS 210

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 211 NSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 245

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 134 SSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSN 193

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S+S S
Sbjct: 194 SSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSS 228

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSS+ ++ S SS S 
Sbjct: 145 SSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSS 204

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 205 SSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSS 239

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S+SSSS ++ + SS S 
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSS 208

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 209 SSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 243

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S + S+S +S+++SSSSS ++ S SS S 
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSS 209

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 210 SNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 244

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S+SSSS ++ S SS S 
Sbjct: 139 SSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSS 198

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS++SS  S SS S SS +S+S+S S
Sbjct: 199 SSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSS 233

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+++SSSSS ++ + SS S 
Sbjct: 140 SSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSS 199

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 200 SSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 234

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 141 SSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSS 200

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S SS S SS +S+S+S S
Sbjct: 201 SNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 235

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S  S++SSSSSS ++ S SS + 
Sbjct: 144 SSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNS 203

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 204 SSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 238

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S ++++SSSSSS ++ S SS + 
Sbjct: 153 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNS 212

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 213 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNS 247

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS+S ++ S S+ S 
Sbjct: 155 SSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSS 214

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 215 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSS 249

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+S  S S S + S+S +S+ SSSSSS +  S SS S 
Sbjct: 160 SSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSS 219

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 220 SSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSS 254

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S+S  S++SSSSS+ ++ S SS S 
Sbjct: 163 SSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSS 222

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 223 SSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSS 257

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S++ +S++SSS+SS ++ S SS S 
Sbjct: 165 SSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSS 224

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 225 SSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSS 259

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  SSSSS  S S S S S+S +S+++SSSSS ++ S SS S 
Sbjct: 168 SSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSS 227

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 228 SSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSS 262

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+S  S S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 170 SSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSS 229

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 230 SSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSS 264

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  S S S S S+S  S++SSSSSS ++ S SS S 
Sbjct: 172 SSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSS 231

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 232 SSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSS 266

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S++ +S++SSSSSS ++ S SS S 
Sbjct: 174 SSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSS 233

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS++SS  S SS S SS +S+S+S S
Sbjct: 234 SSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSS 268

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  + S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 175 SSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 234

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 235 SSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 269

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS   SSSSS  S S S S ++S +S++SSSSSS ++ S SS S 
Sbjct: 176 SSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 235

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S SS S SS +S+S+S S
Sbjct: 236 SSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSS 270

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S + S+S +S++SSSSSS ++ S SS S 
Sbjct: 115 SSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 174

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 175 SSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSS 209

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 131 SNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSS 190

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S S+ S SS +S+S+S S
Sbjct: 191 SSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSS 225

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  SSSSS  S S S S S+S ++++SSSSSS  + S SS S 
Sbjct: 143 SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSN 202

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 203 SSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 237

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S + S S S+S  S++SSSSS+ ++ S SS S 
Sbjct: 154 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSS 213

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S++ S
Sbjct: 214 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSS 248

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 50/98 (51%), Positives = 65/98 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSS+S  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 179 SSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 238

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FS 632
           S  SSS+  SS+SSS  S SS S SS +S+S+S S +S
Sbjct: 239 SSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSWS 276

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 124 SSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSN 183

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  S SS S SS  S+S+S S
Sbjct: 184 SSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSS 218

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSS+ ++ S SS + 
Sbjct: 135 SSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNS 194

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 195 SSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSS 229

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  S S S S ++S +S++SS+SSS ++ S SS S 
Sbjct: 148 NSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSS 207

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 208 SSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 242

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S S S+S +S+++SSSSS ++ S SS S 
Sbjct: 159 SSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSS 218

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 219 SSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSS 253

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S + S S S+S +S++SSSS+S ++ S SS S 
Sbjct: 164 SSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSS 223

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS + SS +S+S+S S
Sbjct: 224 SSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSS 258

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS++  SSSSS  S S S S ++S +S++S+SSSS ++ S SS S 
Sbjct: 167 SSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSS 226

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S +S S SS +S+S+S S
Sbjct: 227 SSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSS 261

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS+SS  S S + S S+S ++++SSSSSS ++ S SS S 
Sbjct: 171 SSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSS 230

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 231 SSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSS 265

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SS++  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 177 SSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSS 236

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 237 SSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSS 271

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 118 SSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 177

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S SS S +S +S+S+S S
Sbjct: 178 SSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNS 212

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 120 SSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 179

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+S+S  S SS + SS +S+S S S
Sbjct: 180 SSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSS 214

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  + S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 121 SSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 180

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS++SS  S SS S SS +S+++S S
Sbjct: 181 SSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSS 215

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 129 SSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSS 188

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+S+S  S SS + SS +S+S+S S
Sbjct: 189 SSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSS 223

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ + SS S 
Sbjct: 130 SSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSS 189

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS++SS  S SS S SS +S+S+S S
Sbjct: 190 SSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSS 224

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SS+SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 126 SSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSS 185

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S S+ +S+S+S S
Sbjct: 186 SSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSS 220

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 133 SSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSS 192

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 193 NSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSS 227

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSS+SS ++ S S+ S 
Sbjct: 137 SSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSS 196

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 197 SSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSS 231

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS +  S SS S 
Sbjct: 142 SSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSS 201

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ +S+SSS  S SS S SS +S+S+S S
Sbjct: 202 NSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSS 236

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S++ +S++SSSS+S ++ S S+ S 
Sbjct: 146 SSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSS 205

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 206 SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 240

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS+SS  S S S S S+S +S +SSSSSS  + S SS S 
Sbjct: 161 SSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSS 220

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S+ +S+S+S S
Sbjct: 221 SSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSS 255

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  S S + S S+S ++++SSSSSS ++ S SS S 
Sbjct: 162 SSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSS 221

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S +S +S+S+S S
Sbjct: 222 SSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSS 256

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  + S S S S S +S++SS+SSS ++ S SS S 
Sbjct: 166 SSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSS 225

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S+ S SS +S+S+S S
Sbjct: 226 SSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSS 260

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSS+  S S S + S+S +S+ SSSSSS ++ S SS S 
Sbjct: 169 SSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSS 228

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S+S S
Sbjct: 229 SSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSS 263

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  +SSSS  S + S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 173 SSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSS 232

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S+S  S SS S SS +S+S+S S
Sbjct: 233 SSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSS 267

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   S+S+  SSSS+  S S S + S+S +S++SSSSSS ++ S SS S 
Sbjct: 178 SSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 237

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 238 SSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 272

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SS++  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 116 SNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 175

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  + SS S SS +S+S+S S
Sbjct: 176 SSSSSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSS 210

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S + S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 119 SSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 178

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SS+  S SS S SS +S+S++ S
Sbjct: 179 SSSSNSSSSSSSSSNSSSSSSSSNSSSSSSSSNSS 213

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  SSS+S  S S S S S+S +S++SSSSSS ++ S SS + 
Sbjct: 125 SSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNS 184

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S+S S
Sbjct: 185 SSSSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSS 219

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  S+SSS  S S S S S+S +S++SSSSSS ++ S S+ S 
Sbjct: 127 SSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSS 186

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S +S +S+S+S S
Sbjct: 187 SSSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSS 221

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S+S +S++SSSSSS ++ S +S S 
Sbjct: 128 SSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSS 187

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 188 SSSSSNSSSSSSSSNSSSSSSSSNSSSSSSSSSSS 222

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SS++  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 132 NSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSS 191

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S +S S SS +S+S+S S
Sbjct: 192 SNSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSS 226

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 46/95 (48%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S S S S S+S +S++SS+SSS ++ S +S S 
Sbjct: 138 SSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSS 197

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+S+S  S SS S SS +S+S+S S
Sbjct: 198 SSSSNSSSSSSSSNSSSSSSSSSSSSSSSSSSSSS 232

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS+  SSSSS  S S S S S S +S++SSS+SS ++ S +S S 
Sbjct: 147 SNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSNSSSS 206

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 207 SSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 241

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 46/95 (48%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S    + S  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 106 SKMGFNGSSSSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSS 165

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS  S+S+S S
Sbjct: 166 SSSSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSS 200

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 40/93 (43%), Positives = 60/93 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS  ++ S  +PV  + + +  + S  S S S S S+S +S+++SSSSS ++ S SS S 
Sbjct: 89  SSCHVNVSTANPVGDAKSKMGFNGSSSSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSN 148

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S SS S SS +S+S+S
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 181

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 40/90 (44%), Positives = 56/90 (62%)
 Frame = +3

Query: 354 SSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSS 533
           +++P     S      SSSS  S S S S S+S ++++SSSSSS ++ S S+ S S  SS
Sbjct: 97  TANPVGDAKSKMGFNGSSSSNSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSNSSSSSSSS 156

Query: 534 STALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S++ SS+SSS  S SS S SS +S+S S S
Sbjct: 157 SSSSSSSSSSSSSSSSSSSSSSSSSSNSSS 186

[74][TOP]
>UniRef100_A6RDA9 Predicted protein n=1 Tax=Ajellomyces capsulatus NAm1
           RepID=A6RDA9_AJECN
          Length = 194

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 50/99 (50%), Positives = 66/99 (66%)
 Frame = +3

Query: 327 LLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRS 506
           ++R  + S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S
Sbjct: 41  MIRDDNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 100

Query: 507 S*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 101 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 139

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 47  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 106

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 107 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 141

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 48  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 107

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 108 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 142

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 49  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 108

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 109 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 143

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 50  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 109

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 110 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 144

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 51  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 110

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 111 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 145

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 52  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 111

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 112 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 146

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 53  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 112

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 113 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 147

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 54  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 113

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 114 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 148

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 55  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 114

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 149

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 57  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 116

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 117 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRS 151

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 67  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 126

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 127 SSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSS 161

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 69  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 128

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 129 SSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSS 163

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 61  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 120

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S S+S S
Sbjct: 121 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSS 155

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 64  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 123

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 124 SSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSS 158

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 72  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 131

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 132 SSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSS 166

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 74  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 133

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 134 SSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSS 168

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 75  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 134

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 135 SSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSSSS 169

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 59  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 118

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSS 153

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 63  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 122

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 123 SSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSS 157

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 50/95 (52%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 46  NSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 105

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 106 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 140

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 58  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 117

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+  S
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSS 152

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 60  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 119

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+ +S S
Sbjct: 120 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSS 154

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 62  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 121

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS + +S+S S
Sbjct: 122 SSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSS 156

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 65  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 124

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S  +S+S+S S
Sbjct: 125 SSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSS 159

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 66  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 125

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S  S +S+S+S S
Sbjct: 126 SSSSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSS 160

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 68  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 127

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS   SS +S+S+S S
Sbjct: 128 SSSSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSS 162

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 70  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 129

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S  S SS +S+S+S S
Sbjct: 130 SSSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSS 164

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 71  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 130

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S  S S SS +S+S+S S
Sbjct: 131 SSSSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSS 165

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 73  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 132

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS    SS S SS +S+S+S S
Sbjct: 133 SSSSSSSSSSSSSSSSSRSSSSSSSSSSSSSSSSS 167

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/93 (51%), Positives = 61/93 (65%), Gaps = 2/93 (2%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ SRSS S 
Sbjct: 96  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSS 155

Query: 519 SPPSSSTALSSTSSSIFSISSL--SLSSPASNS 611
           S  SSS++ SS+SS  +  SS+    SSP SN+
Sbjct: 156 SSSSSSSSSSSSSSYYYYYSSIINQNSSPESNN 188

[75][TOP]
>UniRef100_UPI0000F2E979 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica
           RepID=UPI0000F2E979
          Length = 327

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 44/104 (42%), Positives = 55/104 (52%), Gaps = 2/104 (1%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLD-DVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           DG  N D D + E  D+ DN   ++  D D DD+  + + G+ D  D DG    DDE+  
Sbjct: 157 DGDANEDGDDDDEEDDDGDNGNDDSDDDEDGDDDGDDGDDGDDDDGDDDGDDDGDDEDDS 216

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDD-DGTGDGGDDDSDGDDG 335
            +  + E D D D D  DD DDNN DD D  GD GDDD   DDG
Sbjct: 217 DEDDENEDDEDDDGDDEDDSDDNNEDDEDDEGDDGDDDDGDDDG 260

 Score = 67.8 bits (164), Expect = 8e-10
 Identities = 42/103 (40%), Positives = 55/103 (53%), Gaps = 1/103 (0%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           DG ++ D D E + GD+ ++++     DD DD   +EE    D DD DG A ED ++   
Sbjct: 115 DGDDDEDKDNEDDDGDDEEDDD-----DDGDDGGDDEEDDGDDGDDDDGDANEDGDD--- 166

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGT-GDGGDDDSDGDDG 335
              D E D D D    D +DD + DDDG  GD GDDD   DDG
Sbjct: 167 ---DDEEDDDGDNGNDDSDDDEDGDDDGDDGDDGDDDDGDDDG 206

 Score = 67.8 bits (164), Expect = 8e-10
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 2/105 (1%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           GD G++ D D   E GD+ D E+ +   D+ +D++ ++E G+ D DD D    +D ++  
Sbjct: 150 GDDGDDDDGDAN-EDGDDDDEEDDDG--DNGNDDSDDDEDGDDDGDDGDDGDDDDGDDDG 206

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSD--GDDG 335
            D  D E D+D D +  DDEDD+  D+D + D  +DD D  GDDG
Sbjct: 207 DDDGDDEDDSDEDDENEDDEDDDGDDEDDSDDNNEDDEDDEGDDG 251

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 1/104 (0%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVE-EEGGEYDYDDLDGVAGEDDEEL 467
           GD  E  D     +  DE D+E+ +N  DD DD   + ++GG+ + DD DG    DDEE 
Sbjct: 59  GDDDEEEDDGDGDDDDDEDDDEDKDNEDDDGDDEEDDGDDGGDDEEDDGDG----DDEE- 113

Query: 466 VADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDG 335
             D  D + D D + D  DDE+D+  DDDG   G D++ DGDDG
Sbjct: 114 --DDGDDDEDKDNEDDDGDDEEDD--DDDGDDGGDDEEDDGDDG 153

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 43/106 (40%), Positives = 55/106 (51%), Gaps = 4/106 (3%)
 Frame = -1

Query: 640 DGG--ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDL--DGVAGEDDE 473
           DGG  E  D D + E  D  D+E+ +N  DD DD   +++ G+   DD   DG  G+DD+
Sbjct: 98  DGGDDEEDDGDGDDEEDDGDDDEDKDNEDDDGDDEEDDDDDGDDGGDDEEDDGDDGDDDD 157

Query: 472 ELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDG 335
                  DA  D D D +  DD D+ N D D   DG DD  DGDDG
Sbjct: 158 ------GDANEDGDDDDEEDDDGDNGNDDSDDDEDGDDDGDDGDDG 197

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 41/102 (40%), Positives = 55/102 (53%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           DG +  D   + E  D+ D ++ ++  DD D +  +++G   D ++ DG  G DDEE   
Sbjct: 51  DGDDEEDDGDDDEEEDDGDGDDDDDEDDDEDKDNEDDDG---DDEEDDGDDGGDDEEDDG 107

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDG 335
           D  D E D D      DDED +N DDDG  D  DDD DGDDG
Sbjct: 108 DGDDEEDDGD------DDEDKDNEDDDGD-DEEDDDDDGDDG 142

 Score = 58.9 bits (141), Expect = 4e-07
 Identities = 38/113 (33%), Positives = 58/113 (51%), Gaps = 3/113 (2%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           DGG++ + D     GD+ D+++ +   D  DD+  +++G   + D  D   G+DD +   
Sbjct: 141 DGGDDEEDD-----GDDGDDDDGDANEDGDDDDEEDDDGDNGNDDSDDDEDGDDDGDDGD 195

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDD---DGTGDGGDDDSDGDDGRSKKKKKE 311
           D  D + D D D D  DDEDD++ DD   D   D GDD+ D DD     +  E
Sbjct: 196 DGDDDDGDDDGDDDG-DDEDDSDEDDENEDDEDDDGDDEDDSDDNNEDDEDDE 247

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 30/83 (36%), Positives = 45/83 (54%)
 Frame = -1

Query: 559 DDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAEMDTDMDMDLIDDEDDNNVDDD 380
           +D DD   EE+ G+ D ++ DG   +DD+E   D  D + + D   D  DD DD   D++
Sbjct: 47  EDDDDGDDEEDDGDDDEEEDDGDGDDDDDE--DDDEDKDNEDDDGDDEEDDGDDGGDDEE 104

Query: 379 GTGDGGDDDSDGDDGRSKKKKKE 311
             GDG D++ DGDD   K  + +
Sbjct: 105 DDGDGDDEEDDGDDDEDKDNEDD 127

[76][TOP]
>UniRef100_Q80BM9 Putative uncharacterized protein n=1 Tax=Saimiriine herpesvirus 2
           RepID=Q80BM9_SHV2
          Length = 717

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 45/166 (27%), Positives = 83/166 (50%), Gaps = 7/166 (4%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           DG EN + + E E  +E DNEE E   +D +D   E+E  E D D+ D    +++ E   
Sbjct: 416 DGDENKEDEDEDEEDEEEDNEEDEED-EDEEDEENEDEENEEDEDEEDEENEDEENEEDE 474

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKK----KEKRKRKS 293
           +  D E + D D +  +DED+ + +D+   D  D+D + +D + ++ +    +E    K 
Sbjct: 475 EDEDEEDEEDEDEEDEEDEDEEDEEDEDEEDEEDEDEEDEDEKDEEDEEDEYEEDEDEKD 534

Query: 292 PFASLEEYKHLID---QDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
                +EY+   D   +D++++ +    A ++  K+  KKK +  E
Sbjct: 535 EEDEEDEYEEDEDDENEDDEDEDEKDENAENDKNKEDNKKKDEEDE 580

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 45/161 (27%), Positives = 80/161 (49%), Gaps = 2/161 (1%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLD-DVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           D  E+ + D E E  ++ +NE+ EN  D D +D   E+E  E D +D D    ED++E  
Sbjct: 430 DEEEDNEEDEEDEDEEDEENEDEENEEDEDEEDEENEDEENEEDEEDEDEEDEEDEDE-- 487

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
            D  D + + + D D  D+ED++  D+D      D++ + D+    + +K++   +  + 
Sbjct: 488 EDEEDEDEEDEEDEDEEDEEDEDEEDEDEK----DEEDEEDEYEEDEDEKDEEDEEDEYE 543

Query: 283 SLEEYKHLIDQDEKE-DSKTKRKATSEPTKKKKKKKSKASE 164
             E+ ++  D+DE E D   +     E  KKK ++  K  E
Sbjct: 544 EDEDDENEDDEDEDEKDENAENDKNKEDNKKKDEEDEKFGE 584

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 38/152 (25%), Positives = 71/152 (46%), Gaps = 4/152 (2%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
           EN D + E +  DE + +E +   +D +D   E+E  E + D+ D    ++DE+   D  
Sbjct: 464 ENEDEENEEDEEDEDEEDEEDEDEEDEEDEDEEDEEDEDEEDEEDEDEEDEDEKDEEDEE 523

Query: 451 DAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRK----SPFA 284
           D   + + + D  D+ED+   D+D   +  +D+ + D+     K KE  K+K      F 
Sbjct: 524 DEYEEDEDEKDEEDEEDEYEEDEDDENEDDEDEDEKDENAENDKNKEDNKKKDEEDEKFG 583

Query: 283 SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKK 188
              + K+  D + ++D +  RK       ++K
Sbjct: 584 EDYDGKYWKDDEGEDDEEKDRKDNEREDNERK 615

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 41/141 (29%), Positives = 71/141 (50%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  E  + D + E  DE D E+ E+  ++ D++  +EE  E +Y++ +    EDDE+   
Sbjct: 500 DEDEEDEEDEDEEDEDEKDEEDEEDEYEE-DEDEKDEEDEEDEYEEDEDDENEDDEDEDE 558

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
              +AE D + + +   DE+D    +D  G    DD   DD   +K +K+  +  +    
Sbjct: 559 KDENAENDKNKEDNKKKDEEDEKFGEDYDGKYWKDDEGEDD--EEKDRKDNEREDNERKD 616

Query: 280 LEEYKHLIDQDEKEDSKTKRK 218
            E+Y     +DE+EDSK++ K
Sbjct: 617 GEDYDGEYVEDEEEDSKSENK 637

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 35/165 (21%), Positives = 77/165 (46%), Gaps = 4/165 (2%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEY----DYDDLDGVAGEDDE 473
           DG   Y+     +   E  +++ E   DD D+N  +E+G E     D D+ D     +++
Sbjct: 379 DGNRKYNERKTEDKDREDKDKKDEENEDDKDENEEDEDGDENKEDEDEDEEDEEEDNEED 438

Query: 472 ELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKS 293
           E   D  D E + + + +  D+ED+ N D++   D  D+D + ++   ++ ++++ +   
Sbjct: 439 EEDEDEEDEENEDEENEEDEDEEDEENEDEENEEDEEDEDEEDEEDEDEEDEEDEDEEDE 498

Query: 292 PFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE*E 158
                E+ +   ++DE E  +   +   E  + +K ++ +  E E
Sbjct: 499 EDEDEEDEEDEDEEDEDEKDEEDEEDEYEEDEDEKDEEDEEDEYE 543

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 43/159 (27%), Positives = 73/159 (45%), Gaps = 13/159 (8%)
 Frame = -1

Query: 622 DSDVEFEAGDESDNEEIENMLDDVD----DNAVEEEGGEYDYDDLDGVAGEDDEELVADV 455
           D D E E  ++ +NEE E   D+ D    D   EE+  E D +D D    ED++E   D 
Sbjct: 457 DEDEEDEENEDEENEEDEEDEDEEDEEDEDEEDEEDEDEEDEEDEDEEDEEDEDEEDEDE 516

Query: 454 SDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDD--DSDGDDGRSKKKKKEKRKRKSPFAS 281
            D E + D   +  D++D+ + +D+   D  D+  D + +D + +  + +K K  +    
Sbjct: 517 KDEEDEEDEYEEDEDEKDEEDEEDEYEEDEDDENEDDEDEDEKDENAENDKNKEDNKKKD 576

Query: 280 LEEYKHLID-------QDEKEDSKTKRKATSEPTKKKKK 185
            E+ K   D        DE ED + K +  +E    ++K
Sbjct: 577 EEDEKFGEDYDGKYWKDDEGEDDEEKDRKDNEREDNERK 615

[77][TOP]
>UniRef100_C2N7X7 Putative uncharacterized protein n=1 Tax=Bacillus cereus ATCC 10876
           RepID=C2N7X7_BACCE
          Length = 315

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 43/121 (35%), Positives = 52/121 (42%), Gaps = 24/121 (19%)
 Frame = +1

Query: 328 YYDHHHH------HYHHHH-----HHQYHHHQRCY----HLHHQSGPCPCLCPSLHRSHQ 462
           ++ HHHH      H HHHH     HH +HHHQ  +    H HHQ           H  HQ
Sbjct: 146 HHGHHHHQGQHGHHGHHHHQGQHGHHGHHHHQGQHGHHGHHHHQGQH------GHHGHHQ 199

Query: 463 PRALHH------PRRLL---HLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQH 615
            +  HH      P+ +L   H  HH H H+     H H HH    Q  H H HHQ +  H
Sbjct: 200 QQVHHHGHHHIHPQAVLYQTHQGHHGHHHQGHQGHHGHHHHQG-QQGHHGHHHHQGQQGH 258

Query: 616 H 618
           H
Sbjct: 259 H 259

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 34/100 (34%), Positives = 45/100 (45%), Gaps = 4/100 (4%)
 Frame = +1

Query: 328 YYDHHHH---HYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLH 498
           ++ HHHH   H HH HH Q  HH   +H+H Q+         L+++HQ    HH +   H
Sbjct: 182 HHGHHHHQGQHGHHGHHQQQVHHHGHHHIHPQA--------VLYQTHQGHHGHHHQG--H 231

Query: 499 LDHHSHIHRPLLPQHYHQHHPAYSQSPHCH-SHHQPRIQH 615
             HH H H      H+  HH    Q  H H   H  + QH
Sbjct: 232 QGHHGHHHHQGQQGHHGHHHHQGQQGHHGHQGQHSQQHQH 271

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 36/100 (36%), Positives = 42/100 (42%), Gaps = 1/100 (1%)
 Frame = +1

Query: 340 HHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHHSHI 519
           HHHH   H HH +HHHQ   H HH            H  HQ +  HH        HH H 
Sbjct: 137 HHHHQGQHGHHGHHHHQG-QHGHHG-----------HHHHQGQHGHH-------GHHHH- 176

Query: 520 HRPLLPQH-YHQHHPAYSQSPHCHSHHQPRIQHHYRSFLH 636
                 QH +H HH    Q  H H HHQ ++ HH    +H
Sbjct: 177 ----QGQHGHHGHHHHQGQHGH-HGHHQQQVHHHGHHHIH 211

[78][TOP]
>UniRef100_Q299Y7 GA21679 n=1 Tax=Drosophila pseudoobscura pseudoobscura
           RepID=Q299Y7_DROPS
          Length = 930

 Score = 69.3 bits (168), Expect = 3e-10
 Identities = 61/186 (32%), Positives = 90/186 (48%), Gaps = 19/186 (10%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           GDG +N D D + + GD   N E E    D+D + V  E  E D D  DG A  +DE+L 
Sbjct: 214 GDGVQN-DKDEDID-GDGKVNHEDE----DLDGDGVRNEKDE-DLDG-DGKANTEDEDLD 265

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGT-----------GDGGDDDSDGDDGRSKKKK 317
            D    + D D+D D I +E DN+VD DG             D  DDD D DD ++K KK
Sbjct: 266 GDGVPNDKDDDLDGDGILNEHDNDVDGDGVPNERDDDDSHADDDDDDDDDDDDDKAKVKK 325

Query: 316 KEKRK--------RKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE* 161
           + KR+         ++P +  EE+   I+++  ++   + +A  EP  + + +  K  E 
Sbjct: 326 RSKREVDAAPVIDIEAPPSPAEEFP--IEEEIVKEESVEVEAEPEPEPEPEVEAVKEQEP 383

Query: 160 EARLVA 143
           E   VA
Sbjct: 384 EPEPVA 389

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 34/104 (32%), Positives = 56/104 (53%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           DG     SD      D+ D++E     +D+D + + ++  E D  D DG+  + D+++  
Sbjct: 53  DGSGELQSDQPRRDDDDDDDDEDAISANDIDGDGIPDD--EDDDIDGDGIPNDKDDDIDG 110

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRS 329
           D    E D DMD D + +EDD+++D DG  +  D+D DGD  R+
Sbjct: 111 DGIPNEDDDDMDGDGVPNEDDDDIDGDGVPNSKDEDIDGDGVRN 154

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)
 Frame = -1

Query: 643 GDG-GENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDG--VAGEDDE 473
           GDG  ++ D D++   GD   N++     DD+D + +  E    D DD+DG  V  EDD+
Sbjct: 84  GDGIPDDEDDDID---GDGIPNDKD----DDIDGDGIPNE----DDDDMDGDGVPNEDDD 132

Query: 472 ELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGD 341
           ++  D      D D+D D + + DD ++D DGT +  DDD DGD
Sbjct: 133 DIDGDGVPNSKDEDIDGDGVRNADDEDIDGDGTVNHEDDDLDGD 176

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 49/171 (28%), Positives = 77/171 (45%), Gaps = 12/171 (7%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           GDG  N++ D +F+ GD   N+E E+M  D   N  +E+       D DGV  + DE++ 
Sbjct: 175 GDGTPNHE-DNDFD-GDGVPNDEDEDMDGDGTVNHEDEDL------DGDGVQNDKDEDID 226

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGD------------DGRSKKK 320
            D      D D+D D + +E D ++D DG  +  D+D DGD            DG   + 
Sbjct: 227 GDGKVNHEDEDLDGDGVRNEKDEDLDGDGKANTEDEDLDGDGVPNDKDDDLDGDGILNEH 286

Query: 319 KKEKRKRKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKAS 167
             +      P    ++  H  D D+ +D     KA     KK+ K++  A+
Sbjct: 287 DNDVDGDGVPNERDDDDSHADDDDDDDDDDDDDKA---KVKKRSKREVDAA 334

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 36/118 (30%), Positives = 59/118 (50%), Gaps = 11/118 (9%)
 Frame = -1

Query: 643 GDGGENY-DSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYD----------DLD 497
           GDG  N  D D++ +    +D+E+I+       D  V  E  + D D          D D
Sbjct: 136 GDGVPNSKDEDIDGDGVRNADDEDIDG------DGTVNHEDDDLDGDGTPNHEDNDFDGD 189

Query: 496 GVAGEDDEELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKK 323
           GV  ++DE++  D +    D D+D D + ++ D ++D DG  +  D+D DGD  R++K
Sbjct: 190 GVPNDEDEDMDGDGTVNHEDEDLDGDGVQNDKDEDIDGDGKVNHEDEDLDGDGVRNEK 247

[79][TOP]
>UniRef100_UPI0000F2DB3F PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica
           RepID=UPI0000F2DB3F
          Length = 259

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 50/93 (53%), Positives = 63/93 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 7   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 66

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S SS S SS +S+S+S
Sbjct: 67  SSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSSS 99

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/93 (53%), Positives = 62/93 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 8   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 67

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS+  SS+SSS  S SS S SS +S+S+S
Sbjct: 68  SSSSSSSFSSSSSSSSSSSSSSSSSSSSSSSSS 100

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 6   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 65

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S SS S SS +S+S+S S
Sbjct: 66  SSSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSSSS 100

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 47/90 (52%), Positives = 62/90 (68%)
 Frame = +3

Query: 354 SSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSS 533
           ++S  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S  SS
Sbjct: 4   ANSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 63

Query: 534 STALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S++ SS+SSS FS SS S SS +S+S+S S
Sbjct: 64  SSSSSSSSSSSFSSSSSSSSSSSSSSSSSS 93

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/93 (52%), Positives = 62/93 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 9   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 68

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS + SS+SSS  S SS S SS +S+S++
Sbjct: 69  SSSSSSFSSSSSSSSSSSSSSSSSSSSSSSSSA 101

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           ++ S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 4   ANSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 63

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 64  SSSSSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSS 98

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 5   NSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 64

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S +SSS  S SS S SS +S+S+S S
Sbjct: 65  SSSSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSSS 99

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 47/89 (52%), Positives = 60/89 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S+
Sbjct: 16  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF 75

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
           S  SSS++ SS+SSS  S SS S S+ A+
Sbjct: 76  SSSSSSSSSSSSSSSSSSSSSSSSSAAAA 104

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/89 (53%), Positives = 59/89 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 14  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 73

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
           S  SSS++ SS+SSS  S SS S SS A+
Sbjct: 74  SFSSSSSSSSSSSSSSSSSSSSSSSSSAA 102

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/89 (51%), Positives = 59/89 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 18  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSS 77

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
           S  SSS++ SS+SSS  S SS S ++ A+
Sbjct: 78  SSSSSSSSSSSSSSSSSSSSSSSAAAAAA 106

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/89 (52%), Positives = 58/89 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 15  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 74

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
              SSS++ SS+SSS  S SS S SS A+
Sbjct: 75  FSSSSSSSSSSSSSSSSSSSSSSSSSAAA 103

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 44/89 (49%), Positives = 59/89 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 21  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSS 80

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
           S  SSS++ SS+SSS  S S+ + ++ A+
Sbjct: 81  SSSSSSSSSSSSSSSSSSSSAAAAAAAAA 109

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 43/89 (48%), Positives = 59/89 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 23  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSS 82

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
           S  SSS++ SS+SSS  S ++ + ++ A+
Sbjct: 83  SSSSSSSSSSSSSSSSSSAAAAAAAAAAA 111

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 42/89 (47%), Positives = 59/89 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 26  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSS 85

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
           S  SSS++ SS+SSS  + ++ + ++ A+
Sbjct: 86  SSSSSSSSSSSSSSSAAAAAAAAAAAAAA 114

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 42/89 (47%), Positives = 58/89 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 24  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSS 83

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
           S  SSS++ SS+SSS  + ++ + ++ A+
Sbjct: 84  SSSSSSSSSSSSSSSSSAAAAAAAAAAAA 112

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 42/89 (47%), Positives = 58/89 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 25  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSS 84

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
           S  SSS++ SS+SSS  + ++ + ++ A+
Sbjct: 85  SSSSSSSSSSSSSSSSAAAAAAAAAAAAA 113

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 41/95 (43%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSS  ++ S SS S 
Sbjct: 27  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSS 86

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  + ++ + ++ A+ + + S
Sbjct: 87  SSSSSSSSSSSSSSAAAAAAAAAAAAAAAAAAAAS 121

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 39/74 (52%), Positives = 51/74 (68%)
 Frame = +3

Query: 420 SMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSP 599
           S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS 
Sbjct: 6   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 65

Query: 600 ASNSTSLS*FSPPS 641
           +S+S+S S FS  S
Sbjct: 66  SSSSSSSSSFSSSS 79

 Score = 54.3 bits (129), Expect = 9e-06
 Identities = 37/76 (48%), Positives = 52/76 (68%)
 Frame = +3

Query: 396 LSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSI 575
           +  ++S  S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S 
Sbjct: 1   MDQANSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 60

Query: 576 SSLSLSSPASNSTSLS 623
           SS S SS +S+S+S S
Sbjct: 61  SSSSSSSSSSSSSSFS 76

[80][TOP]
>UniRef100_UPI0000F2C690 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica
           RepID=UPI0000F2C690
          Length = 359

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/99 (51%), Positives = 65/99 (65%)
 Frame = +3

Query: 327 LLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRS 506
           L+  SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S
Sbjct: 22  LISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 81

Query: 507 S*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S S  SSS++ SS+S S  S SS S SS +S+S+S S
Sbjct: 82  SSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSS 120

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 42  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSS 101

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 102 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 136

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 32  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 91

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 92  SSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSS 126

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 37  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 96

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 97  SSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 131

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 38  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 97

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 98  SGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 132

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 40  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSG 99

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 100 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 134

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 50/94 (53%), Positives = 63/94 (67%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           SP L SS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S
Sbjct: 19  SPDLISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 78

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 79  SSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSS 112

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 31  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 90

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 91  SSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSS 125

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 28  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 87

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 88  SSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSS 122

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 33  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 92

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 93  SSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSS 127

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 50/93 (53%), Positives = 63/93 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 45  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSS 104

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S SS S SS +S+S+S
Sbjct: 105 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 137

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 27  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 86

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+ SS  S SS S SS +S+S+S S
Sbjct: 87  SSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSS 121

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 29  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 88

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S +SSS  S SS S SS +S+S+S S
Sbjct: 89  SSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSS 123

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 30  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 89

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S SS S SS +S+S+S S
Sbjct: 90  SSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSS 124

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 34  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 93

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS ++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 94  SSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 128

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 35  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 94

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 95  SSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 129

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 36  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 95

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 96  SSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 130

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 39  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 98

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 99  GSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 133

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS   
Sbjct: 41  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGS 100

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 101 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 135

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S  S 
Sbjct: 43  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSS 102

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 103 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 137

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S  S S 
Sbjct: 44  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSS 103

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 104 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 138

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++   SS S 
Sbjct: 46  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSS 105

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 106 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRS 140

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSS S ++ S SS S 
Sbjct: 52  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSS 111

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  SNS S S
Sbjct: 112 SSSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSS 146

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/93 (53%), Positives = 61/93 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 50  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSS 109

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S SS S SS +S S S
Sbjct: 110 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSNS 142

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 51/95 (53%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 48  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSS 107

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 108 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSNS 142

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/96 (52%), Positives = 63/96 (65%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           P   S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S
Sbjct: 20  PDLISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 79

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 80  SSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSS 115

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 58  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSS 117

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S  +S S+S S
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSRSNSGSSSRSSSSS 152

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS RS S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 113 SSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSSSSSSSSSSSSSSSSSSSSS 172

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +S ++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 173 SRSNSGSSSSSSSSSNSSSSSSSSSSSSSSSSSSS 207

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS RS S S S S+S ++++SSSSSS ++ S SS S 
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSS 251

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S+SSS  S SS S SS +S+S+S S
Sbjct: 252 SSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSS 286

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 49/93 (52%), Positives = 62/93 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +S SS RS S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 200 SSSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 259

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS+  SS+SSS  S SS S SS +S+S+S
Sbjct: 260 SRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSS 292

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 59/129 (45%), Positives = 73/129 (56%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SSR  +G      S        SS S SSS  S   SSS+  SSSS  
Sbjct: 160 SSSSSSSSSSSSSSRSNSGSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRS 219

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++SSSSSS ++ S SS S S  SSS+  SS+S+S  S SS S SS
Sbjct: 220 NSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSS 279

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 280 SSSSSSSSS 288

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S S+  SSSSS  S S S S S+S +S++SSSSSS ++ SRSS S 
Sbjct: 207 SSSSSSSSSSSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSS 266

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S SS  S+S S S
Sbjct: 267 NSSSSSSSSSSSSSSSSSSSSSSSSSRRSSSRSSS 301

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++ SSSSS ++ S SS S 
Sbjct: 56  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSS 115

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S+  S+S S S
Sbjct: 116 SSSSSSSSSSSSSSSSSSSSSSSRSNSGSSSRSSS 150

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 71  SSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 130

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++ SS  S SS S SS +S+S+S S
Sbjct: 131 SSSSSSSSRSNSGSSSRSSSSSSSSSSSSSSSSSS 165

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 48/93 (51%), Positives = 60/93 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S    SS+  SSSSS  S S S S S+S +S++SSSSSS ++ SRS+   
Sbjct: 85  SSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGS 144

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S SS S SS +S S S
Sbjct: 145 SSRSSSSSSSSSSSSSSSSSSSSSSSSSSRSNS 177

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 50/95 (52%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S  S 
Sbjct: 87  SSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSS 146

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS++ SS+SSS  S SS S SS  SNS S S
Sbjct: 147 RSSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSS 181

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS RS S S S S+S +S++SSSSSS ++ S SS   
Sbjct: 235 SSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSRR 294

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS+  SS+SSS  S S+ S SS +S+S+S S
Sbjct: 295 SSSRSSSRSSSSSSSSSSSSNSSSSSSSSSSSSSS 329

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 50/95 (52%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSS+S  S S S S S+S +S++SSSSSS  + SRSS   
Sbjct: 244 SSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSRRSSSRSSSRS 303

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S S S
Sbjct: 304 SSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSRSSS 338

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 61  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSS 120

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S+   SS +S+S+S S
Sbjct: 121 SSSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSSSS 155

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/93 (52%), Positives = 61/93 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 80  SSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSR 139

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S   SS+  SS+SSS  S SS S SS +S+S+S
Sbjct: 140 SNSGSSSRSSSSSSSSSSSSSSSSSSSSSSSSS 172

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS S+  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 117 SSSSSSSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSRSN 176

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 177 SGSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 211

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS SS  S S S S S+S +S++SSSSSS ++ SR S S 
Sbjct: 239 SSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSRRSSSR 298

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 299 SSSRSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSS 333

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 59/133 (44%), Positives = 73/133 (54%)
 Frame = +3

Query: 225 LVFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSS 404
           L+  SS SS S     SS  ++       S        SS S SSS  S   SSS+  SS
Sbjct: 22  LISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 81

Query: 405 SSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSL 584
           SSS  S S S S S+S  S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S  S 
Sbjct: 82  SSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSN 141

Query: 585 SLSSPASNSTSLS 623
           S SS  S+S+S S
Sbjct: 142 SGSSSRSSSSSSS 154

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 63  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSS 122

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S  S  S +S+S+S S
Sbjct: 123 SSSSSSSSSSSSSSSSRSNSGSSSRSSSSSSSSSS 157

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S  +S +S++SSSSSS ++ S SS S 
Sbjct: 64  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSS 123

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  +  S S SS +S+S+S S
Sbjct: 124 SSSSSSSSSSSSSSSRSNSGSSSRSSSSSSSSSSS 158

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S S  S   SSS+  SSSSS  S S S S S+S +S++SSS S+  + SRSS S 
Sbjct: 93  SSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSSRSSSSS 152

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S  +S+S+S S
Sbjct: 153 SSSSSSSSSSSSSSSSSSSSSRSNSGSSSSSSSSS 187

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +S SS RS S S S S+S +S++SSSSSS ++   +S S 
Sbjct: 121 SSSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSS 180

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 181 SSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS    S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 72  SSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 131

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  +S SSS  S SS S SS +S+S+S S
Sbjct: 132 SSSSSSSRSNSGSSSRSSSSSSSSSSSSSSSSSSS 166

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 73  SSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 132

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + S +SS   S SS S SS +S+S+S S
Sbjct: 133 SSSSSSRSNSGSSSRSSSSSSSSSSSSSSSSSSSS 167

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 57/129 (44%), Positives = 73/129 (56%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SS  ++G      S        SS S SSS  S   SSS+  SSSS  
Sbjct: 81  SSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRS 140

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++SSSSSS ++ S SS S S   SS++ SS+S+S  S SS S SS
Sbjct: 141 NSGSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSSSSSSSSNSSSSSSSSSSSS 200

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 201 SSSSSSSSS 209

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/95 (51%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   S SSS  S S S S S+S +S++SSSSSS ++ S S  S 
Sbjct: 122 SSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSS 181

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 182 SSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S   S+S +S++SSSSSS ++ S SS S 
Sbjct: 66  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSS 125

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S S    SS S SS +S+S+S S
Sbjct: 126 SSSSSSSSSSSSSRSNSGSSSRSSSSSSSSSSSSS 160

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+   SSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 79  SSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 138

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              S S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 139 RSNSGSSSRSSSSSSSSSSSSSSSSSSSSSSSSSS 173

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S SSS  + S S S S+S +S++SSSSSS ++  RSS   
Sbjct: 240 SSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSRRSSSRS 299

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 300 SSRSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSS 334

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 65  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSS 124

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS   S SS   SS +S+S+S S
Sbjct: 125 SSSSSSSSSSSSSSRSNSGSSSRSSSSSSSSSSSS 159

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 67  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSS 126

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+ S+  S S  S SS +S+S+S S
Sbjct: 127 SSSSSSSSSSSSRSNSGSSSRSSSSSSSSSSSSSS 161

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 69  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 128

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S ++S   S SS S SS +S+S+S S
Sbjct: 129 SSSSSSSSSSRSNSGSSSRSSSSSSSSSSSSSSSS 163

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS S  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 76  SSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 135

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   S++  SS SSS  S SS S SS +S+S+S S
Sbjct: 136 SSSRSNSGSSSRSSSSSSSSSSSSSSSSSSSSSSS 170

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S + S S+S +S++SSSSSS ++ S SS   
Sbjct: 236 SSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSRRS 295

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S +S S SS +S+S+S S
Sbjct: 296 SSRSSSRSSSSSSSSSSSSNSSSSSSSSSSSSSSS 330

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/92 (51%), Positives = 59/92 (64%)
 Frame = +3

Query: 348 SLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPP 527
           S   SP     SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S  
Sbjct: 15  SYCQSPDLISSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 74

Query: 528 SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 75  SSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSS 106

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S   S S+S +S++SSSSSS ++ S SS S 
Sbjct: 68  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSS 127

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS S+S  S  S S SS +S+S+S S
Sbjct: 128 SSSSSSSSSSSRSNSGSSSRSSSSSSSSSSSSSSS 162

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 77  SSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 136

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S + S +SSS  S SS S SS +S+S+S S
Sbjct: 137 SSRSNSGSSSRSSSSSSSSSSSSSSSSSSSSSSSS 171

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS RS S S S S+S ++++SSSSSS ++ S SS S 
Sbjct: 148 SSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSSSSSSSSNSSSSSSSSSSSSSSSSSSS 207

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S ++S   S SS S +S +S+S+S S
Sbjct: 208 SSSSSSSSSSRSNSGSSSRSSSSSNSSSSSSSSSS 242

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 50/95 (52%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SS  SS  + SRSS S 
Sbjct: 248 SSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSRRSSSRSSSRSSSSS 307

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS  S+S S S
Sbjct: 308 SSSSSSSNSSSSSSSSSSSSSSSSSSSRSSSGSSS 342

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS   S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 75  SSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 134

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S S + SS+ SS  S SS S SS +S+S+S S
Sbjct: 135 SSSSRSNSGSSSRSSSSSSSSSSSSSSSSSSSSSS 169

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S SSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 78  SSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 137

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +S ++  S+SSS  S SS S SS +S+S+S S
Sbjct: 138 SRSNSGSSSRSSSSSSSSSSSSSSSSSSSSSSSSS 172

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 57/129 (44%), Positives = 71/129 (55%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SSR  +G      S        SS S SSS  S   S S   SSSSS 
Sbjct: 125 SSSSSSSSSSSSSSRSNSGSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSSSSS 184

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S + S S S+S +S++SSSSSS ++ S SS S S   SS+  SS+S+S  S SS S SS
Sbjct: 185 SSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSNSSSSSSSSSSSS 244

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 245 SSSSSSSSS 253

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 51/97 (52%), Positives = 61/97 (62%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS S SSS  S   SSS+  SSSSS  S S S   S+S  S++SSSSSS ++ S SS 
Sbjct: 226 RSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSS 285

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  SSS+  SS+ SS  S SS S SS +SNS+S S
Sbjct: 286 SSS--SSSSRRSSSRSSSRSSSSSSSSSSSSNSSSSS 320

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   SSS+  SSSSS  S S S S S+S ++++SSSSSS ++ S SS S 
Sbjct: 227 SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSS 286

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS   SS SSS  S SS S SS +++S+S S
Sbjct: 287 SSSSSSRRSSSRSSSRSSSSSSSSSSSSNSSSSSS 321

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS S+  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 255

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS ++ SS SSS  S SS S SS +S+S+S S
Sbjct: 256 SSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 290

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS   S S S S S+S +S++SSSSSS ++ S S  S 
Sbjct: 237 SSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSRRSS 296

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS ++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 297 SRSSSRSSSSSSSSSSSSNSSSSSSSSSSSSSSSS 331

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+  +S++SSSSSS ++ S SS S 
Sbjct: 62  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSS 121

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS    +S S S  +S+S+S S
Sbjct: 122 SSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSSSSS 156

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 47/95 (49%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S   S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 70  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 129

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++  S S S    SS S SS +S+S+S S
Sbjct: 130 SSSSSSSSSRSNSGSSSRSSSSSSSSSSSSSSSSS 164

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSS+  SSSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 231 SNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSS 290

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS+  SS SSS  S SS S +S +S+S+S S
Sbjct: 291 SSRRSSSRSSSRSSSSSSSSSSSSNSSSSSSSSSS 325

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 233 SSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSS-SS 291

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + S +SSS  S SS S SS +S+S+S S
Sbjct: 292 SRRSSSRSSSRSSSSSSSSSSSSNSSSSSSSSSSS 326

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 47/95 (49%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   S SSS  S S + S S+S +S++SSSSSS ++ S SS S 
Sbjct: 201 SSSSSSSSSSSSSSSSSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSS 260

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS + SS+SSS  S SS S SS +S+S+  S
Sbjct: 261 RSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSRRS 295

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 47/95 (49%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  SSSSS  S S S S S+S +S  SSS SS  + S SS S 
Sbjct: 252 SSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSRRSSSRSSSRSSSSSSSSS 311

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S SS S SS  S+S++ S
Sbjct: 312 SSSNSSSSSSSSSSSSSSSSSSSRSSSGSSSSNNS 346

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 47/95 (49%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++S  SSS ++   SS S 
Sbjct: 249 SSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSRRSSSRSSSRSSSSSS 308

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+ +S S
Sbjct: 309 SSSSSSNSSSSSSSSSSSSSSSSSSSRSSSGSSSS 343

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 46/95 (48%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S  S+  S   SSS+  SSSSS  S S S S S+S +S++SSSSS  ++ S SS S 
Sbjct: 213 SSSSSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSS 272

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S  S S  +S S+S S
Sbjct: 273 SSSSSSSSSSSSSSSSSSSSRRSSSRSSSRSSSSS 307

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 46/94 (48%), Positives = 59/94 (62%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           S S SSS  +   SSS+  SSSSS  S S S S S+S  S++SS+SSS ++ S SS S S
Sbjct: 223 SSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSSSSSS 282

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SSS++ SS  SS  S S  S SS +S+S+S S
Sbjct: 283 SSSSSSSSSSRRSSSRSSSRSSSSSSSSSSSSNS 316

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/93 (48%), Positives = 59/93 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S    S++  SS SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 204 SSSSSSSSSSSSSSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSS 263

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  +SS++ SS+SSS  S SS S SS +S  +S
Sbjct: 264 SSSNSSSSSSSSSSSSSSSSSSSSSSSSSRRSS 296

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 46/95 (48%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S   S SSS  + S S S S+S +S++SSSSSS ++ S S  S 
Sbjct: 205 SSSSSSSSSSSSSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSS 264

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +  S+S S
Sbjct: 265 SSNSSSSSSSSSSSSSSSSSSSSSSSSSRRSSSRS 299

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 49/96 (51%), Positives = 62/96 (64%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSS-SSPATPSRSS*S 515
           SS S S+S  S   SSS+  SSSSS  S S S S S+S +S++SSSS SS ++ S SS S
Sbjct: 214 SSSSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSS 273

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S  S S SS  S+S+S S
Sbjct: 274 SSSSSSSSSSSSSSSSSSSRRSSSRSSSRSSSSSSS 309

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 46/95 (48%), Positives = 58/95 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS   S   S S+  S+SSS  S S S S S+S +S++SSSSSS  + S S+ S 
Sbjct: 211 SSSSSSSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSS 270

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS   SS  S+S S S
Sbjct: 271 SSSSSSSSSSSSSSSSSSSSSSRRSSSRSSSRSSS 305

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 45/95 (47%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+   SS   S   SSS+  SSSSS  S S S S S+S +S+ SSSSS+ ++ S SS S 
Sbjct: 219 SNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSSSSS 278

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS   S  S S SS +S+S+S S
Sbjct: 279 SSSSSSSSSSSSSSRRSSSRSSSRSSSSSSSSSSS 313

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 45/95 (47%), Positives = 58/95 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S S      SS++  SSSSS  S S S S S+S +S++SS SSS +  S SS S 
Sbjct: 216 SSRSNSGSSSRSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSSSNSSSSSSSS 275

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS    SS   SS +S+S+S S
Sbjct: 276 SSSSSSSSSSSSSSSSSRRSSSRSSSRSSSSSSSS 310

[81][TOP]
>UniRef100_Q3MJK9 Cement protein 3B variant 1 n=1 Tax=Phragmatopoma californica
           RepID=Q3MJK9_PHRCA
          Length = 341

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 59/129 (45%), Positives = 76/129 (58%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S    YSS  ++    +  S   +    SS S SSS  S   SSS+  SSSSS 
Sbjct: 207 SSSSSSSSSSSYSSSSSSSSSSYSSSSSSY----SSSSSSSSSYSSSSSSSSSYSSSSSS 262

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S+ SSSSSS ++ S SS S S  SSS++ SS+SSS +S SS S SS
Sbjct: 263 SSSSYSSSSSSSSSSSYSSSSSSYSSSSSSSYSSSSSSSSSSYSSSSSSSYSSSSSSSSS 322

Query: 597 PASNSTSLS 623
            + +S+S S
Sbjct: 323 SSYSSSSSS 331

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 58/129 (44%), Positives = 74/129 (57%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SS  ++    +  S         S S SSS  S   SSS+  SSSSS 
Sbjct: 184 SSSSSSSYSSSSSSSYSSSSSSYSSSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSS 243

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS +S SS S SS
Sbjct: 244 SSYSSSSSSSSSYSSSSSSSSSSYSSSSSSSSSSSYSSSSSSYSSSSSSSYSSSSSSSSS 303

Query: 597 PASNSTSLS 623
             S+S+S S
Sbjct: 304 SYSSSSSSS 312

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 60/129 (46%), Positives = 76/129 (58%), Gaps = 2/129 (1%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS+SS S    YSS  ++       S +      SS S SSS  S   SSS+  SSSSS 
Sbjct: 42  SSYSSSSSSSSYSSSSSSS------SSYSSSSSSSSSSYSSSSSSYSSSSSSSYSSSSS- 94

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS--PPSSSTALSSTSSSIFSISSLSL 590
            S S S S S+S  S++SSSSSS ++ S SS SYS    SSS++ SS+SSS  S SS S 
Sbjct: 95  -SSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSY 153

Query: 591 SSPASNSTS 617
           SS +S+S+S
Sbjct: 154 SSSSSSSSS 162

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 56/129 (43%), Positives = 72/129 (55%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S     SS  ++  +    S +      S  S SSS  S   SSS+  SSSSS 
Sbjct: 54  SSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSS 113

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S   S S S+S  S++SSSSSS  + S SS S S  SS ++ SS+SSS +S SS S SS
Sbjct: 114 SSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSYSSSSSSSSSSYSSSSSSYSS 173

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 174 SSSSSSSYS 182

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 62/167 (37%), Positives = 88/167 (52%), Gaps = 1/167 (0%)
 Frame = +3

Query: 144 ATSLASYSDALDFFFFFFFVGSDVAFLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFF 323
           ++S +SYS +   +       S  +      SS+SS S     S   ++  +    S  +
Sbjct: 94  SSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSY 153

Query: 324 FLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSR 503
                SS S  SS  S   SSS+  SS SS  S S S S S+S + ++SSSS S ++ S 
Sbjct: 154 SSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSYSSSSSSYSSSSSSS 213

Query: 504 SS*SYSPPSSSTALS-STSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           SS SYS  SSS++ S S+SSS +S SS S SS +S+S+S S +S  S
Sbjct: 214 SSSSYSSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSS 260

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 56/129 (43%), Positives = 72/129 (55%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS+SS S     SS  ++       S  +     SS S SSS  S    SS+  SSSSS 
Sbjct: 79  SSYSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSSSSY 138

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S + ++SSSSSS +  S SS   S  SSS++ SS+SSS  S SS S SS
Sbjct: 139 SSSSSSYSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSS 198

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 199 YSSSSSSYS 207

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 51/96 (53%), Positives = 63/96 (65%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSS-PATPSRSS*S 515
           SS S SSS  S   SSS+  SSS S  S S S S S+S +S +SSSSSS  ++ S SS S
Sbjct: 40  SSSSYSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSYSSSSSSSSSS 99

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           YS  SSS + SS+SSS +S SS S SS +S+S+S S
Sbjct: 100 YSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSS 135

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/101 (49%), Positives = 62/101 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S    SS+  SSSSS  S S S S S+S + ++SSSSSS +  S SS   
Sbjct: 49  SSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSYSSSSSSSSSSYSSSSSSYS 108

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+SSS  S SS S SS +S S+S S +S  S
Sbjct: 109 SSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSS 149

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 59/133 (44%), Positives = 76/133 (57%), Gaps = 4/133 (3%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSL----SSSPPSPVPSSSTLLSS 404
           SS+SS S    YSS  ++    +  S   +    SS S     SSS  S   SSS+  SS
Sbjct: 143 SSYSS-SSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSYSS 201

Query: 405 SSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSL 584
           SSS  S S S S S+S +S++SSSSSS ++ S S  S S  SSS + SS+SSS +S SS 
Sbjct: 202 SSSSYSSSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSS 261

Query: 585 SLSSPASNSTSLS 623
           S SS  S+S+S S
Sbjct: 262 SSSSSYSSSSSSS 274

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 60/137 (43%), Positives = 75/137 (54%), Gaps = 3/137 (2%)
 Frame = +3

Query: 240 SFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIR 419
           S SS S    YSS  ++       S  +     SS S SSS  S   SSS+  SSSSS  
Sbjct: 154 SSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSYSSSSSSYSSSSSSS 213

Query: 420 SMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTAL---SSTSSSIFSISSLSL 590
           S S   S S+S +S+ SSSSSS ++ S SS SYS  SSS++    SS+SSS    SS S 
Sbjct: 214 SSSSYSSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSS 273

Query: 591 SSPASNSTSLS*FSPPS 641
           SS +S S+S S +S  S
Sbjct: 274 SSSSSYSSSSSSYSSSS 290

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 6/106 (5%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRS----- 506
           S S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S     
Sbjct: 90  SSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSS 149

Query: 507 S*SYSPPSSSTALS-STSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S SYS  SSS++ S S+SSS +S SS S SS +S+S+S S +S  S
Sbjct: 150 SSSYSSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSS 195

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 53/105 (50%), Positives = 67/105 (63%), Gaps = 2/105 (1%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSS-SSSSPATPSRSS 509
           R SS S SSS  S   S S+  SSSS   S S S S S+S +S++SS SSSS +  S SS
Sbjct: 27  RYSSSSYSSSSSSSSSSYSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSS 86

Query: 510 *SYSPPSSSTALS-STSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            SYS  SSS++ S S+SSS +S SS S SS +S+S+S S +S  S
Sbjct: 87  SSYSSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSS 131

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 59/129 (45%), Positives = 73/129 (56%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS+S     SS  ++       S        SS S SSS  S   SSS+  SSSSS 
Sbjct: 176 SSSSSYSSSSSSSSSYSSSSSSSYSSSSSSYSSSSSSSSSSSYSSSSSSSSSSYSSSSSS 235

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S S +S++SSSS S ++ S SS SYS  SSS++ SS SSS  S SS S SS
Sbjct: 236 YSSSSSSSSSYS-SSSSSSSSYSSSSSSSSS-SYSSSSSSSSSSSYSSSSSSYSSSSSSS 293

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 294 YSSSSSSSS 302

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 51/103 (49%), Positives = 65/103 (63%), Gaps = 2/103 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSM--SMSVSISASLTSATSSSSSSPATPSRSS* 512
           SS S SSS  S   SSS+  SSSSS  S   S S S S+S +S++SSSSSS  + S SS 
Sbjct: 227 SSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSSSSSSYSSSSSSY 286

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S S  SS ++ SS+SSS +S SS S  S +S+S+S S +S  S
Sbjct: 287 SSSSSSSYSSSSSSSSSSYSSSSSSSYSSSSSSSSSSSYSSSS 329

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 62/161 (38%), Positives = 83/161 (51%), Gaps = 1/161 (0%)
 Frame = +3

Query: 144 ATSLASYSDALDFFFFFFFVGSDVAFLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFF 323
           ++S +SYS +    +      S  ++     S  SS S    YSS  ++       S   
Sbjct: 139 SSSSSSYSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSS 198

Query: 324 FLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSR 503
           +    SS S SSS  S    SS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S 
Sbjct: 199 YSSSSSSYSSSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSS 258

Query: 504 SS*SYSPP-SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SS S S   SSS++ SS+SS   S SS S SS +S S+S S
Sbjct: 259 SSSSSSSSYSSSSSSSSSSSYSSSSSSYSSSSSSSYSSSSS 299

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 55/124 (44%), Positives = 70/124 (56%), Gaps = 6/124 (4%)
 Frame = +3

Query: 270 YSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMS--VSI 443
           YSS  ++    +  S        SS S SS   S   SSS+  SSSSS  S S S   S 
Sbjct: 33  YSSSSSSSSSSYSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSYSSS 92

Query: 444 SASLTSATSSSSSSPATPSRSS*SYSPPSSS----TALSSTSSSIFSISSLSLSSPASNS 611
           S+S +S+ SSSSSS ++ S SS SYS  SSS    ++ SS+SSS +S SS S SS +S+S
Sbjct: 93  SSSSSSSYSSSSSSYSSSSSSSSSYSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSS 152

Query: 612 TSLS 623
            S S
Sbjct: 153 YSSS 156

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 62/159 (38%), Positives = 83/159 (52%), Gaps = 1/159 (0%)
 Frame = +3

Query: 144 ATSLASYSDALDFFFFFFFVGSDVAFLLVFESSFSSWSIKCL-YSSRLANGDFRFLFSFF 320
           ++S +SYS +   +       S  ++     SS SS+S     YSS  ++       S+ 
Sbjct: 193 SSSSSSYSSSSSSYSSSSSSSSSSSYSSSSSSSSSSYSSSSSSYSSSSSSSS-----SYS 247

Query: 321 FFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPS 500
                 SS S SSS  S   SSS+  SSSSS  S S S S S+S + ++SSSSSS +  S
Sbjct: 248 SSSSSSSSYSSSSSSSSSSYSSSSSSSSSSSYSSSSSSYSSSSSSSYSSSSSSSSSSYSS 307

Query: 501 RSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            SS SYS  S     SS+SSS +S SS S SS +S S+S
Sbjct: 308 SSSSSYSSSS-----SSSSSSSYSSSSSSSSSSSSYSSS 341

[82][TOP]
>UniRef100_UPI0000D57518 PREDICTED: similar to CCAAT/enhancer binding protein zeta n=1
            Tax=Tribolium castaneum RepID=UPI0000D57518
          Length = 894

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 58/187 (31%), Positives = 85/187 (45%), Gaps = 32/187 (17%)
 Frame = -1

Query: 631  ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
            E ++  +E  AG   D+EE  + L+DV DN       + D    D    +DD+  + D S
Sbjct: 689  EEFEEMLEKMAGLPKDDEEDLDFLNDVGDNLKTNGKSQKDKKRTDDDDSDDDDSEMEDAS 748

Query: 451  DAEMDTDMDMDLIDDEDDNNVDDDG---TGDGGDDDS-----DGDDGRSKKKKKEKRK-R 299
            D E+  D D D   DEDD  ++DD     GD  DD+      D ++ +S K KK+K K  
Sbjct: 749  DEELSMDEDEDF--DEDDLEMNDDDKMLLGDLDDDEDEEVVFDDEEPKSAKSKKKKSKDT 806

Query: 298  KSPFASLEEYKHLIDQD--------------EKEDSKTKRKATSEPTKK---------KK 188
             S FAS EE+  L+D +               K+++ TK+ A  +   +          K
Sbjct: 807  NSIFASAEEFASLLDDEGSSKIAPGSSNALSNKDNASTKQLAWEQSRNRWLKGFDEVVGK 866

Query: 187  KKKSKAS 167
            KK SK S
Sbjct: 867  KKNSKGS 873

[83][TOP]
>UniRef100_Q8I259 Putative uncharacterized protein n=1 Tax=Plasmodium falciparum 3D7
           RepID=Q8I259_PLAF7
          Length = 2221

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 48/169 (28%), Positives = 82/169 (48%), Gaps = 18/169 (10%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
           E  D D   +  D  D ++++++ DDVDD+  +E+  + + DD D    +DD+E   D  
Sbjct: 305 EEIDVDDVDDVDDVDDVDDVDDV-DDVDDDEDDEDDEDDEDDDEDDDEDDDDDEDEDDDD 363

Query: 451 DAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDG-------------RSKKKKKE 311
           D + D D      DD+DD + DDD   D  +D+ D D+               +K+ K  
Sbjct: 364 DEDEDDDE-----DDDDDEDYDDDDDEDYDEDEDDDDENYNLKDKNNLKGFENNKRIKGN 418

Query: 310 KRKRKSPFA-----SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKK 179
           K+  + PF       +E     I+ +E E +  K+K+ ++  +KKKKK+
Sbjct: 419 KKGSEKPFVVNKEMVVENKNKNINNEEDEKNIDKKKSMNKKKRKKKKKR 467

[84][TOP]
>UniRef100_Q5Y828 Putative uncharacterized protein n=1 Tax=Atrina rigida
           RepID=Q5Y828_ATRRI
          Length = 257

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 36/103 (34%), Positives = 56/103 (54%), Gaps = 1/103 (0%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDL-DGVAGEDDEEL 467
           GD  E  + + +    D+ +++  ++  +D DD+  +++    D DD  D  + +DDEE 
Sbjct: 89  GDSAEEDEDNGDDSGADDGEDDSADDDSEDDDDDDDDDDDDSADNDDEEDDDSNDDDEEE 148

Query: 466 VADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
            AD  D + D D D D  DD+DD++ DDD   D  DDD D DD
Sbjct: 149 EADSGDDDDDDDDDDDASDDDDDDDDDDDDDDDASDDDDDDDD 191

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 41/106 (38%), Positives = 61/106 (57%), Gaps = 5/106 (4%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEE---GGEYDYDDLDGVAGEDDEE 470
           D  E+ D D + +  D +DN++ E+  DD +D+  EEE   G + D DD D  A +DD++
Sbjct: 114 DDSEDDDDDDDDDDDDSADNDDEED--DDSNDDDEEEEADSGDDDDDDDDDDDASDDDDD 171

Query: 469 LVADVSDAEMDTDMDMDLIDDEDDNNVDDDGT--GDGGDDDSDGDD 338
              D  D +  +D D D  DD+DD++ DDD     DGGDDD+  D+
Sbjct: 172 DDDDDDDDDDASDDDDDDDDDDDDDDDDDDNEEEDDGGDDDASADE 217

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 38/105 (36%), Positives = 53/105 (50%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D GE+  +D + E  D+ D+++     DD  DN  EE+    D D+ +     DD++   
Sbjct: 105 DDGEDDSADDDSEDDDDDDDDDD----DDSADNDDEEDDDSNDDDEEEEADSGDDDDDDD 160

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSK 326
           D  DA  D D D D  DD+DD + DDD   D  DDD D DD   +
Sbjct: 161 DDDDASDDDDDDDDDDDDDDDASDDDDDDDDDDDDDDDDDDNEEE 205

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 34/101 (33%), Positives = 53/101 (52%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           DG ++ D D   E  D  D+   ++  DD  D+  E++  + D DD D    +D+E+  +
Sbjct: 82  DGEDDDDGDSAEEDEDNGDDSGADDGEDDSADDDSEDDDDDDDDDDDDSADNDDEEDDDS 141

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
           +  D E + D      DD+DD++ DDD + D  DDD D DD
Sbjct: 142 NDDDEEEEADSG----DDDDDDDDDDDASDDDDDDDDDDDD 178

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 47/145 (32%), Positives = 69/145 (47%), Gaps = 9/145 (6%)
 Frame = -1

Query: 640 DGGEN-YDSDVEFEAGD---ESDNEEIENMLDDVDDNAVEEEGGEYDY----DDLDGVAG 485
           DGG N    DVE +A D   + D +  EN +DD +D   E +GG+ D     DD DG + 
Sbjct: 33  DGGANDVADDVEADAADLEEDVDQDVDENDVDDEEDADDEADGGDDDASDGEDDDDGDSA 92

Query: 484 EDDEELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDS-DGDDGRSKKKKKEK 308
           E+DE+   D S A+   D      D  DD++ DDD   D  DDDS D DD        + 
Sbjct: 93  EEDEDN-GDDSGADDGED------DSADDDSEDDDDDDDDDDDDSADNDDEEDDDSNDDD 145

Query: 307 RKRKSPFASLEEYKHLIDQDEKEDS 233
            + ++     ++     D D+ +D+
Sbjct: 146 EEEEADSGDDDD-----DDDDDDDA 165

 Score = 54.3 bits (129), Expect = 9e-06
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 6/107 (5%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENM----LDDVDDNAVEEEGGEYDYDDLDGVAGEDDE 473
           DGG++  SD E +   +S  E+ +N      DD +D++ +++  + D DD      +DD+
Sbjct: 74  DGGDDDASDGEDDDDGDSAEEDEDNGDDSGADDGEDDSADDDSEDDDDDD------DDDD 127

Query: 472 ELVADVSDAEMDTDMDMDLIDDED--DNNVDDDGTGDGGDDDSDGDD 338
           +  AD  D E D   D D  ++ D  D++ DDD   D  DDD D DD
Sbjct: 128 DDSADNDDEEDDDSNDDDEEEEADSGDDDDDDDDDDDASDDDDDDDD 174

[85][TOP]
>UniRef100_Q5DAV3 Putative uncharacterized protein n=1 Tax=Schistosoma japonicum
           RepID=Q5DAV3_SCHJA
          Length = 230

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 42/124 (33%), Positives = 54/124 (43%), Gaps = 20/124 (16%)
 Frame = +1

Query: 328 YYDHHHHHYHH-------HHHHQYHHHQRCYHLHHQSGPCPCLC--------PSLHRSHQ 462
           Y+  HHH YHH       H HH YHH  R +H  H     PCL          + H SH 
Sbjct: 19  YHLCHHHSYHHLLSRYPCHCHHPYHHLCRRHHHCH-----PCLPYHDHSSFHSNRHSSHF 73

Query: 463 PRALHH--PRRLLH---LDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRS 627
               HH  P  L H   + HH+H H      H+H H+  ++   H   HH+    HH+ S
Sbjct: 74  RSCRHHTSPHILCHKSRVHHHNHHHCNHRHHHFHHHYRHHNNLDHHIHHHRHHHIHHHHS 133

Query: 628 FLHH 639
           + HH
Sbjct: 134 YHHH 137

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 2/97 (2%)
 Frame = +1

Query: 328 YYDHHH--HHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHL 501
           +++HHH  H +HH HHH  HH+   +H+HH            HR H    +HH       
Sbjct: 93  HHNHHHCNHRHHHFHHHYRHHNNLDHHIHH------------HRHHH---IHHHH---SY 134

Query: 502 DHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQ 612
            HHS++H   L +H+H HH    +    H HH   +Q
Sbjct: 135 HHHSYLHHSYLHRHHHNHHRILRRRRRRHHHHHYLLQ 171

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 41/117 (35%), Positives = 49/117 (41%), Gaps = 11/117 (9%)
 Frame = +1

Query: 322 SSYYDHHHHHYHH---HHHH-----QYHHHQRCYHLHHQSGPCPCLCPSLHRSH-QPRAL 474
           S Y  H HH YHH    HHH      YH H   +   H S    C      R H  P  L
Sbjct: 32  SRYPCHCHHPYHHLCRRHHHCHPCLPYHDHSSFHSNRHSSHFRSC------RHHTSPHIL 85

Query: 475 HHPRRLLHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQH--HYRSFLHH 639
            H  R+ H +HH   HR     H+++HH       H H HH     H  H+ S+LHH
Sbjct: 86  CHKSRVHHHNHHHCNHRHHHFHHHYRHHNNLDHHIHHHRHHHIHHHHSYHHHSYLHH 142

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 8/115 (6%)
 Frame = +1

Query: 313 LSFSSYYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRL 492
           L   S   HH+HH+ +H HH +HHH R    HH +                  L H    
Sbjct: 85  LCHKSRVHHHNHHHCNHRHHHFHHHYR----HHNN------------------LDH---- 118

Query: 493 LHLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHH--------QPRIQHHYRSFL 633
            H+ HH H H   +  H+  HH +Y    + H HH        + R +HH+  +L
Sbjct: 119 -HIHHHRHHH---IHHHHSYHHHSYLHHSYLHRHHHNHHRILRRRRRRHHHHHYL 169

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 32/98 (32%), Positives = 44/98 (44%), Gaps = 4/98 (4%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHH----PRRLL 495
           ++ HHH H+H HHHH YHHH    +LHH           LHR H     HH     RR  
Sbjct: 118 HHIHHHRHHHIHHHHSYHHHS---YLHHS---------YLHRHHHN---HHRILRRRRRR 162

Query: 496 HLDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRI 609
           H  HH  +   ++P    +         H H+H++ R+
Sbjct: 163 HHHHHYLLQSSVIPHAGLRSLLLLHLHLHLHTHYRNRM 200

[86][TOP]
>UniRef100_B4P107 GE24532 n=1 Tax=Drosophila yakuba RepID=B4P107_DROYA
          Length = 1660

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 45/133 (33%), Positives = 66/133 (49%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D   N + + + E  D++ N+E +N  D+ DD   EEE  E D DD D   GEDD E   
Sbjct: 1109 DEDNNNEDEEDDEEEDDNGNDEDDNEDDNNDDENDEEEDEEEDNDD-DEDDGEDDNEDDK 1167

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
            D  D E + D D D  D ED+N+ D+D   D   DD D ++  +K    +    +     
Sbjct: 1168 DEDDEEDNNDDDKDEDDAEDNNDDDEDDEEDNNKDDDDDEEDNNKDDDDDADGCEQCTKV 1227

Query: 280  LEEYKHLIDQDEK 242
            LEE +++ D  +K
Sbjct: 1228 LEELENIDDDCDK 1240

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 41/109 (37%), Positives = 58/109 (53%), Gaps = 3/109 (2%)
 Frame = -1

Query: 643  GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
            GD G++ D++ E E  DE +N E E   ++ DDN  +E+  E D +D +    ED+EE  
Sbjct: 1093 GDDGDDEDNNNEDEEDDEDNNNEDEEDDEEEDDNGNDEDDNEDDNNDDENDEEEDEEEDN 1152

Query: 463  ADVSDAEMDTDMDMDLIDDEDDNNVDD---DGTGDGGDDDSDGDDGRSK 326
             D  D   D + D    DDE+DNN DD   D   D  DDD D ++  +K
Sbjct: 1153 DDDEDDGEDDNEDDKDEDDEEDNNDDDKDEDDAEDNNDDDEDDEEDNNK 1201

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 42/146 (28%), Positives = 65/146 (44%), Gaps = 10/146 (6%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNE----------EIENMLDDVDDNAVEEEGGEYDYDDLDGV 491
            D  +  + D + E GD+ D+E          E  N  D+ DD   ++ G + D ++ D  
Sbjct: 1079 DRADEDEDDEDDENGDDGDDEDNNNEDEEDDEDNNNEDEEDDEEEDDNGNDEDDNEDDNN 1138

Query: 490  AGEDDEELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKE 311
              E+DEE      D E D D D D  +D+++++ D+D   D  DDD D DD        E
Sbjct: 1139 DDENDEE-----EDEEEDNDDDEDDGEDDNEDDKDEDDEEDNNDDDKDEDDAEDNNDDDE 1193

Query: 310  KRKRKSPFASLEEYKHLIDQDEKEDS 233
                       EE  +  D D++ED+
Sbjct: 1194 DD---------EEDNNKDDDDDEEDN 1210

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 43/158 (27%), Positives = 71/158 (44%), Gaps = 8/158 (5%)
 Frame = -1

Query: 634  GENYDSDVEFEAGDESDN--EEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV- 464
            G + D D   E GD  D   E+  +  D+ +D+  +E G + D +D +    EDDE+   
Sbjct: 1058 GRDTDDD---ENGDNEDETGEKGTDRADEDEDDEDDENGDDGDDEDNNNEDEEDDEDNNN 1114

Query: 463  ADVSDAEMDTDMDMDLIDDEDDNNVD-----DDGTGDGGDDDSDGDDGRSKKKKKEKRKR 299
             D  D E + D   D  D+EDDNN D     +D   D  DD+ DG+D     K ++  + 
Sbjct: 1115 EDEEDDEEEDDNGNDEDDNEDDNNDDENDEEEDEEEDNDDDEDDGEDDNEDDKDEDDEED 1174

Query: 298  KSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKK 185
             +     E+     + D+++D +   K   +  +   K
Sbjct: 1175 NNDDDKDEDDAEDNNDDDEDDEEDNNKDDDDDEEDNNK 1212

[87][TOP]
>UniRef100_A7RSD0 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A7RSD0_NEMVE
          Length = 87

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 34/81 (41%), Positives = 42/81 (51%), Gaps = 4/81 (4%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRC---YHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLH 498
           ++ HHHHHYH+HHHH Y H +R    +H HH            HR HQ   LHH   + +
Sbjct: 16  HHHHHHHHYHYHHHHHYQHQKRINQQHHHHHHP-------YHYHRHHQ---LHHHPIIKN 65

Query: 499 LDHHS-HIHRPLLPQHYHQHH 558
             HH  H H    P HYH+HH
Sbjct: 66  NSHHQFHQH----PYHYHRHH 82

 Score = 67.8 bits (164), Expect = 8e-10
 Identities = 31/96 (32%), Positives = 44/96 (45%)
 Frame = +1

Query: 331 YDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHH 510
           +DHHHHH+HH+H+H +HH+Q    ++ Q           H  H P   H         HH
Sbjct: 14  HDHHHHHHHHYHYHHHHHYQHQKRINQQH----------HHHHHPYHYHR--------HH 55

Query: 511 SHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHH 618
              H P++    + HH  +    H H HHQ  + HH
Sbjct: 56  QLHHHPIIKN--NSHHQFHQHPYHYHRHHQ--LHHH 87

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 37/109 (33%), Positives = 45/109 (41%), Gaps = 5/109 (4%)
 Frame = +1

Query: 328 YYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDH 507
           Y+  H+H   H HHH +HHH   YH HH            H  HQ R        ++  H
Sbjct: 4   YHQQHNHRCRHDHHHHHHHH---YHYHHHH----------HYQHQKR--------INQQH 42

Query: 508 HSHIHRPLLPQHYHQ-----HHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
           H H H    P HYH+     HHP    + H H  HQ    +H    LHH
Sbjct: 43  HHHHH----PYHYHRHHQLHHHPIIKNNSH-HQFHQHPYHYHRHHQLHH 86

[88][TOP]
>UniRef100_C9J0G9 Putative uncharacterized protein ENSP00000406579 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J0G9_HUMAN
          Length = 194

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 41/151 (27%), Positives = 78/151 (51%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D GE  + D   +  DE D E+ ++ + D ++N  EE+ G+ D D+  G   +D+EE   
Sbjct: 1   DDGEEEEGDGNED--DEDDGEKEDDGIGDNENNGEEEDDGDEDDDEDGGEEEDDEEEDDG 58

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
           +  D + D D   +  ++E+D + DD+  G+  +DD DG+DG    +++   +R      
Sbjct: 59  EEEDEDRDEDDGKNDGEEEEDGDRDDEDDGEKEEDDGDGNDGEDDGEEEGDGERDDRKDY 118

Query: 280 LEEYKHLIDQDEKEDSKTKRKATSEPTKKKK 188
            EE +   D+D+ E ++ +     E  ++K+
Sbjct: 119 GEEEEDHGDEDDDEHNRKENDGDGEDDQEKE 149

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 51/157 (32%), Positives = 68/157 (43%), Gaps = 12/157 (7%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEG-------GEYDYDDLDGVAGE 482
           DGGE  D D E + G+E D +  E+  D  +D   EE+G       GE + DD DG  GE
Sbjct: 45  DGGEEED-DEEEDDGEEEDEDRDED--DGKNDGEEEEDGDRDDEDDGEKEEDDGDGNDGE 101

Query: 481 DDEELVADVSDAEMDTDMDM-----DLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKK 317
           DD E   +  D E D   D      D  D++DD +   +  GDG DD    D G   +  
Sbjct: 102 DDGE---EEGDGERDDRKDYGEEEEDHGDEDDDEHNRKENDGDGEDDQEKEDHGDGDEDG 158

Query: 316 KEKRKRKSPFASLEEYKHLIDQDEKEDSKTKRKATSE 206
            E    +      E+     D DEK+ +    K  SE
Sbjct: 159 DEDDGEEE-----EDDDGENDDDEKDGNGDDNKDDSE 190

[89][TOP]
>UniRef100_P87179 Cell wall integrity and stress response component 1 n=1
           Tax=Schizosaccharomyces pombe RepID=WSC1_SCHPO
          Length = 374

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 47/91 (51%), Positives = 62/91 (68%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SS+  +  PSSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 142 SSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 201

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNS 611
           S  SSS  ++S++SS  S SS S SS +S+S
Sbjct: 202 SSSSSSVPITSSTSSSHSSSSSSSSSSSSSS 232

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 52/103 (50%), Positives = 68/103 (66%), Gaps = 2/103 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  SP  SS+T  +S SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 133 SSTTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 192

Query: 519 SPPSSSTALSSTSSS--IFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+SSS  I S +S S SS +S+S+S S  S PS
Sbjct: 193 SSSSSSSSSSSSSSSVPITSSTSSSHSSSSSSSSSSSSSSRPS 235

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 49/101 (48%), Positives = 65/101 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S  +TS+TSSS SS ++ S SS S 
Sbjct: 172 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSVPITSSTSSSHSSSSSSSSSSSSS 231

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S PSSS++  +T SS   IS++++ +P+S+S+S S   P S
Sbjct: 232 SRPSSSSSFITTMSSSTFISTVTV-TPSSSSSSTSSEVPSS 271

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 47/93 (50%), Positives = 61/93 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + ++SP S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 147 SSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 206

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S P +S+  SS SSS  S SS S SS  S+S+S
Sbjct: 207 SVPITSSTSSSHSSSSSSSSSSSSSSRPSSSSS 239

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 59/149 (39%), Positives = 78/149 (52%)
 Frame = +3

Query: 177 DFFFFFFFVGSDVAFLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLS 356
           D ++  +  G+ V    V  SS SS +     SS  ++       S        SS S S
Sbjct: 110 DLYWSVYLTGNGVLQTTVSSSSVSSTTSSSSSSSPSSS-------STTTTTSPSSSSSSS 162

Query: 357 SSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSS 536
           SS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS + P  SS S S  SSS
Sbjct: 163 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSVPITSSTSSSHSSSS 222

Query: 537 TALSSTSSSIFSISSLSLSSPASNSTSLS 623
           ++ SS+SSS    SS S  +  S+ST +S
Sbjct: 223 SSSSSSSSSSRPSSSSSFITTMSSSTFIS 251

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 41/80 (51%), Positives = 52/80 (65%)
 Frame = +3

Query: 399 SSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSIS 578
           SS SS  S S S S S+S T+ T+S SSS ++ S SS S S  SSS++ SS+SSS  S S
Sbjct: 130 SSVSSTTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 189

Query: 579 SLSLSSPASNSTSLS*FSPP 638
           S S SS +S+S+S S  S P
Sbjct: 190 SSSSSSSSSSSSSSSSSSVP 209

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 49/108 (45%), Positives = 64/108 (59%), Gaps = 13/108 (12%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS   ++ S S S S +S++SSSSSS + PS SS   
Sbjct: 182 SSSSSSSSSSSSSSSSSSSSSSSSSSVPITSSTSSSHSSSSSSSSSSSSSSRPSSSSSFI 241

Query: 519 SPPSSSTAL-----------SSTSSSI-FSISSLSL-SSPASNSTSLS 623
           +  SSST +           SSTSS +  S ++L+L +S ASN TSL+
Sbjct: 242 TTMSSSTFISTVTVTPSSSSSSTSSEVPSSTAALALNASKASNHTSLN 289

[90][TOP]
>UniRef100_C2SRJ4 Putative uncharacterized protein n=1 Tax=Bacillus cereus BDRD-ST196
           RepID=C2SRJ4_BACCE
          Length = 359

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 6/110 (5%)
 Frame = +1

Query: 328 YYDHHHHHYH--HHHHHQYHHHQRCYHLHHQSGPCPCLCPSLH-RSHQPRALHHPRRLLH 498
           ++ HH HH H  HH HH +H  Q  +H HHQ  P   L  +   + HQ    HH     H
Sbjct: 169 HHQHHGHHGHQGHHQHHGHHQQQVHHHGHHQIHPQAVLFQTHQGQHHQGHHQHHG----H 224

Query: 499 LDHHSHIHRPLLPQHYHQHHPAYSQSPHCHSH---HQPRIQHHYRSFLHH 639
            DHH H        H+H HH  + Q+    +H   H  + QHH++   HH
Sbjct: 225 HDHHGHQGHHQQQVHHHGHHQIHPQAVLFQTHQGQHHHQGQHHHQGQHHH 274

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 36/121 (29%), Positives = 48/121 (39%), Gaps = 11/121 (9%)
 Frame = +1

Query: 307 FSLSFSSYYDHHHHHYHHHHHHQYHHHQRCYHLHHQSGPCPCLCPSLHRSHQPRALHHPR 486
           F      +++HH HH  H HH  + HHQ  +H HHQ           H  HQ    HH  
Sbjct: 138 FPQGVHGHHEHHGHHQQHGHHQHHGHHQ--HHGHHQHHG--------HHGHQGHHQHHGH 187

Query: 487 RLLHLDHHSH-----------IHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFL 633
               + HH H            H+    Q +HQHH  +    H   HHQ ++ HH    +
Sbjct: 188 HQQQVHHHGHHQIHPQAVLFQTHQGQHHQGHHQHHGHHDHHGH-QGHHQQQVHHHGHHQI 246

Query: 634 H 636
           H
Sbjct: 247 H 247

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 35/103 (33%), Positives = 44/103 (42%), Gaps = 2/103 (1%)
 Frame = +1

Query: 337 HHHHHYHHHHH-HQYHHHQRCYHL-HHQSGPCPCLCPSLHRSHQPRALHHPRRLLHLDHH 510
           HH HH HH HH HQ HH Q+ +H  HHQ  P   L  +    H  +  HH     H   H
Sbjct: 218 HHQHHGHHDHHGHQGHHQQQVHHHGHHQIHPQAVLFQTHQGQHHHQGQHH-----HQGQH 272

Query: 511 SHIHRPLLPQHYHQHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
            H       QH+HQ    +    H    H  + QHH++    H
Sbjct: 273 HH-----QGQHHHQGQHHHQGQHHHQGQHHHQGQHHHQGQQGH 310

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 41/119 (34%), Positives = 52/119 (43%), Gaps = 5/119 (4%)
 Frame = +1

Query: 298 SVFFSLSFSSYYDHHHHHYHHHHH--HQYHHHQRCYHL-HHQSGPCPCLCPSLHRSHQPR 468
           +V F      ++  HH H+ HH H  HQ HH Q+ +H  HHQ  P   L  +    H  +
Sbjct: 204 AVLFQTHQGQHHQGHHQHHGHHDHHGHQGHHQQQVHHHGHHQIHPQAVLFQTHQGQHHHQ 263

Query: 469 ALHHPRRLLHLDHHSHIHRPLLPQHYH--QHHPAYSQSPHCHSHHQPRIQHHYRSFLHH 639
             HH     H   H H       QH+H  QHH    Q  H   HHQ   QHH++   HH
Sbjct: 264 GQHH-----HQGQHHH-----QGQHHHQGQHH---HQGQH---HHQG--QHHHQGQHHH 304

[91][TOP]
>UniRef100_P54397 39 kDa FK506-binding nuclear protein n=1 Tax=Drosophila
           melanogaster RepID=FKB39_DROME
          Length = 357

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 45/153 (29%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 625 YDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDA 446
           Y  D++ E  ++ D   IEN+L+     A++      D +D +  +GE+DEE   D S  
Sbjct: 86  YLHDIDSEDDEDDDQMTIENLLNS---KAIKNSKKSEDDED-ENESGEEDEEDTDDDSQI 141

Query: 445 EMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKK-KEKRKRKSPFASLEEY 269
             + +  ++  ++EDD++VD+D    G +D+ D DD  +++++ K K  + SP AS ++ 
Sbjct: 142 IEEYESFLENGEEEDDDDVDEDNEESGEEDEQDSDDSEAEEEQPKAKVAKLSPGASAKKS 201

Query: 268 -KHLIDQDEKEDSKTKRKATSEPTKKKKKKKSK 173
            K      +KE++K ++K   +P  KK++ K+K
Sbjct: 202 GKEQNGVAKKEEAKQQQKKKEKPEAKKEQPKAK 234

[92][TOP]
>UniRef100_B9QLW9 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii VEG
           RepID=B9QLW9_TOXGO
          Length = 1202

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 58/118 (49%), Positives = 72/118 (61%), Gaps = 1/118 (0%)
 Frame = +3

Query: 273 SSRLANGDFRFLFSFFFFLLRPSSPSLSSSP-PSPVPSSSTLLSSSSSIRSMSMSVSISA 449
           S+RL+  + R  F      L   + SLSSS  PS  PSSS+  SSSSS  + S S S S+
Sbjct: 616 STRLSAVEIRLYFDDVLNALEDKNASLSSSSSPSSSPSSSSSSSSSSSPSASSSSSSPSS 675

Query: 450 SLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S +S++SSSSSS  +PS SS S SP SSS+  SS SSS  S SS S SSP+ +   LS
Sbjct: 676 SPSSSSSSSSSS--SPSASSSSSSPSSSSS--SSPSSSSSSSSSSSSSSPSCSPWFLS 729

[93][TOP]
>UniRef100_B9Q7Y5 Poly(A) polymerase, putative n=1 Tax=Toxoplasma gondii VEG
           RepID=B9Q7Y5_TOXGO
          Length = 778

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 56/113 (49%), Positives = 69/113 (61%), Gaps = 10/113 (8%)
 Frame = +3

Query: 333 RPSSPSLSSSP------PSPVPSSSTLLSSSSSIRSMSMSVSISASLTS----ATSSSSS 482
           RPS P+  SSP      PSP   SS+ LSSSSS+   S+S S+S+S  S    ++SS SS
Sbjct: 29  RPSPPAPLSSPGTDSRKPSPSSLSSSSLSSSSSLSPSSLSSSLSSSSLSSSSLSSSSLSS 88

Query: 483 SPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S ++ S SS S S  SSS + SS SSS  S SSLSLSS +S+S S S  S  S
Sbjct: 89  SLSSSSLSSSSSSLSSSSLSSSSPSSSSLSSSSLSLSSLSSSSLSSSSLSSSS 141

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 51/107 (47%), Positives = 68/107 (63%), Gaps = 12/107 (11%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISAS-----------LTSATSSSSSS 485
           SSP   S  PSP   SS+ LSSSSS+   S+S S+S+S           L+S+ SSSS S
Sbjct: 37  SSPGTDSRKPSPSSLSSSSLSSSSSLSPSSLSSSLSSSSLSSSSLSSSSLSSSLSSSSLS 96

Query: 486 PATPSRSS*SYSPPS-SSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            ++ S SS S S  S SS++LSS+S S+ S+SS SLSS + +S+SLS
Sbjct: 97  SSSSSLSSSSLSSSSPSSSSLSSSSLSLSSLSSSSLSSSSLSSSSLS 143

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 52/95 (54%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS SLS S  S   SSS+L  SSSS+ S S+S S+S+S  S++SSS SS +  S S  S 
Sbjct: 58  SSSSLSPSSLSSSLSSSSL--SSSSLSSSSLSSSLSSSSLSSSSSSLSSSSLSSSSPSSS 115

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS +LSS SSS  S SSLS SS  S+S+SLS
Sbjct: 116 SLSSSSLSLSSLSSSSLSSSSLS-SSSLSSSSSLS 149

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 52/99 (52%), Positives = 66/99 (66%), Gaps = 4/99 (4%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S  SLSSS  S   SSS+L SSS S    S S+S S+S  S++S SSSSP++ S SS S 
Sbjct: 63  SPSSLSSSLSSSSLSSSSLSSSSLSSSLSSSSLSSSSSSLSSSSLSSSSPSSSSLSSSSL 122

Query: 519 SPPS-SSTALSSTS---SSIFSISSLSLSSPASNSTSLS 623
           S  S SS++LSS+S   SS+ S SSLS SS + +S+SLS
Sbjct: 123 SLSSLSSSSLSSSSLSSSSLSSSSSLSSSSSSLSSSSLS 161

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 48/98 (48%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPV--PSSSTLLSSSSSIRSMSMSVSISASLTSATSS-SSSSPATPSRSS 509
           SS +   SPP+P+  P + +   S SS+ S S+S S S S +S +SS SSSS ++ S SS
Sbjct: 24  SSTTRRPSPPAPLSSPGTDSRKPSPSSLSSSSLSSSSSLSPSSLSSSLSSSSLSSSSLSS 83

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S S   SS++LSS+SSS+ S SSLS SSP+S+S S S
Sbjct: 84  SSLSSSLSSSSLSSSSSSL-SSSSLSSSSPSSSSLSSS 120

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVS--ISASLTSAT-SSSSSSPATPSRSS 509
           SS SLSSS  S   SSS+L SSSSS+ S S+S S   S+SL+S++ S SS S ++ S SS
Sbjct: 77  SSSSLSSSSLSSSLSSSSLSSSSSSLSSSSLSSSSPSSSSLSSSSLSLSSLSSSSLSSSS 136

Query: 510 *SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S S  SSS++LSS+SSS+ S SSLS S   +   S S
Sbjct: 137 LSSSSLSSSSSLSSSSSSL-SSSSLSSSGQGAGEVSRS 173

[94][TOP]
>UniRef100_B9Q762 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii VEG
           RepID=B9Q762_TOXGO
          Length = 461

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 52/95 (54%), Positives = 64/95 (67%)
 Frame = +3

Query: 357 SSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSS 536
           SS  SP  SSS   SSSSS  S S S S  +S +S++SSSSSS ++ S SS S S  SSS
Sbjct: 34  SSSSSPFSSSSLSSSSSSSSLSSSSSSSSLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 93

Query: 537 TALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           +  SS+SSS+ S SS SLSSP S+S+SLS  +P S
Sbjct: 94  SLSSSSSSSLSSSSSSSLSSP-SSSSSLSSGAPLS 127

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 49/89 (55%), Positives = 58/89 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS SLSSS      SSS+ LSSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 50  SSSSLSSS------SSSSSLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSLSSSSSSSL 103

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPAS 605
           S  SSS++LSS SSS    SSLS  +P S
Sbjct: 104 S-SSSSSSLSSPSSS----SSLSSGAPLS 127

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 46/113 (40%), Positives = 61/113 (53%)
 Frame = +3

Query: 303 FLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSS 482
           FLFS  F  +    P         +   +   SSSS   S S+S S S+S  S++SSSSS
Sbjct: 3   FLFSAPFSRVAVGRPGAHLHDTGTLQYHTHFSSSSSPFSSSSLSSSSSSSSLSSSSSSSS 62

Query: 483 SPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
             ++ S SS S S  SSS++ SS+SSS  S S  S SS + +S+S S  S PS
Sbjct: 63  LSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSLSSSSSSSLSSSSSSSLSSPS 115

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 45/88 (51%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           S S SSS  S   SSS+L SSSSS  S S S S S+S +S++SSSSSS  + S SS   S
Sbjct: 46  SSSSSSSSLSSSSSSSSLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSLSSSSSSSLSS 105

Query: 522 PPSSSTALSSTSSSIFSISSLSL--SSP 599
             SSS +  S+SSS+ S + LS+  SSP
Sbjct: 106 SSSSSLSSPSSSSSLSSGAPLSVGPSSP 133

[95][TOP]
>UniRef100_B9Q5V8 Zinc finger (C3HC4 type, RING finger) protein n=1 Tax=Toxoplasma
           gondii VEG RepID=B9Q5V8_TOXGO
          Length = 787

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 49/81 (60%), Positives = 58/81 (71%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSSP S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++PS SS S 
Sbjct: 593 SSPSCSSSPSSSPSSSSS--SSSSSSSSPSSSPSSSSSPSSSPSSSSSSSSSPSSSS-SS 649

Query: 519 SPPSSSTALSSTSSSIFSISS 581
           S PSSS++ SS+SSS FS SS
Sbjct: 650 SSPSSSSSSSSSSSSSFSFSS 670

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 51/93 (54%), Positives = 63/93 (67%)
 Frame = +3

Query: 345 PSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSP 524
           PS SSS  SP  SSS+  SS S   S S S S S+S +S++SSSSSS ++PS S  S S 
Sbjct: 570 PSFSSSS-SPSASSSSSSSSPSPSSSPSCSSSPSSSPSSSSSSSSSSSSSPSSSPSSSSS 628

Query: 525 PSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           PSSS + SS+SSS  S SS S SSP+S+S+S S
Sbjct: 629 PSSSPSSSSSSSSSPS-SSSSSSSPSSSSSSSS 660

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/92 (53%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSP-ATPSRSS*S 515
           +S S SSS PSP  S S   S SSS  S S S S S+S  S++ SSSSSP ++PS SS S
Sbjct: 580 ASSSSSSSSPSPSSSPSCSSSPSSSPSSSSSSSSSSSSSPSSSPSSSSSPSSSPSSSSSS 639

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNS 611
            S PSSS++ SS SSS  S SS S S   S+S
Sbjct: 640 SSSPSSSSSSSSPSSSSSSSSSSSSSFSFSSS 671

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS  S  PS S+  S SSS  S     S S+S +S++SSSSS  ++PS SS   
Sbjct: 576 SSPSASSSSSSSSPSPSSSPSCSSSPSS-----SPSSSSSSSSSSSSSPSSSPSSSSSPS 630

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S PSSS++ SS+ SS  S SS S SS +S+S+S S
Sbjct: 631 SSPSSSSSSSSSPSSSSSSSSPSSSSSSSSSSSSS 665

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 47/96 (48%), Positives = 58/96 (60%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           P SP   S    P  SSS+  S+SSS  S S S S S S +S+ SSS SS ++ S SS  
Sbjct: 558 PRSPLAQSVERVPSFSSSSSPSASSSSSSSSPSPSSSPSCSSSPSSSPSSSSSSSSSS-- 615

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S PSSS + SS+ SS  S SS S SSP+S+S+S S
Sbjct: 616 SSSPSSSPSSSSSPSSSPSSSSSSSSSPSSSSSSSS 651

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 39/96 (40%), Positives = 58/96 (60%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           P+ PS +S+  +      T + + +     S S S ++S +S++SSSSSS ++ S SS S
Sbjct: 351 PALPSRTSASTARTEGGQTGIQNRTQAAEESTSSSSASSSSSSSSSSSSSSSSSSSSSSS 410

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 411 SSSSSSSPSSSSSSSSSSSSSSSSSSSSSSSSSSSS 446

[96][TOP]
>UniRef100_B9Q545 PHD-finger domain-containing protein, putative n=1 Tax=Toxoplasma
           gondii VEG RepID=B9Q545_TOXGO
          Length = 742

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLS--SSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           S PSLSSS  S   SSS+L S  SSSS+ S S+S S S S +S++ SSSSS ++ S SS 
Sbjct: 310 SHPSLSSSSLSSSLSSSSLSSSFSSSSLSSSSLSSSSSPSSSSSSPSSSSSLSSSSLSSS 369

Query: 513 SYSPPS-SSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S+S  S SS++LSS+S S  S+SS SLSS + +S+SLS
Sbjct: 370 SFSSSSLSSSSLSSSSLSSSSLSSSSLSSSSLSSSSLS 407

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/97 (48%), Positives = 61/97 (62%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R   P LSS P     S S+ LSSSS   S S S S+S+S  S++SS SSS ++PS SS 
Sbjct: 302 RDLCPPLSSHPSLSSSSLSSSLSSSSLSSSFSSS-SLSSSSLSSSSSPSSSSSSPSSSSS 360

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             S   SS++ SS+S S  S+SS SLSS + +S+SLS
Sbjct: 361 LSSSSLSSSSFSSSSLSSSSLSSSSLSSSSLSSSSLS 397

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 61/133 (45%), Positives = 74/133 (55%), Gaps = 1/133 (0%)
 Frame = +3

Query: 240 SFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIR 419
           S SS S+    SS   +  F         L   SSPS SSS PS   SSS+L SSS S  
Sbjct: 313 SLSSSSLSSSLSSSSLSSSFSSSSLSSSSLSSSSSPSSSSSSPS---SSSSLSSSSLSSS 369

Query: 420 SMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPS-SSTALSSTSSSIFSISSLSLSS 596
           S S S S+S+S  S++S SSSS ++ S SS S S  S SS++LSS SSS  S SSLS S 
Sbjct: 370 SFSSS-SLSSSSLSSSSLSSSSLSSSSLSSSSLSSSSLSSSSLSSASSSSLSSSSLSSSF 428

Query: 597 PASNSTSLS*FSP 635
             S+ +S    SP
Sbjct: 429 HPSSCSSPQSSSP 441

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 51/101 (50%), Positives = 64/101 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS SLSSS  S   SSS+L SSSSS  S S S S S+SL+S++ SSSS  ++   SS   
Sbjct: 324 SSSSLSSSFSSSSLSSSSL-SSSSSPSSSSSSPSSSSSLSSSSLSSSSFSSSSLSSSSLS 382

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S   SS++LSS+S S  S+SS SLSS + +S S S  S  S
Sbjct: 383 SSSLSSSSLSSSSLSSSSLSSSSLSSSSLSSASSSSLSSSS 423

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +3

Query: 345 PSLSSSPPSPVPSSSTL---LSSSSSIRSMSMSVSISAS-LTSATSS---SSSSPATPSR 503
           P   SS P    SS  L   LSS  S+ S S+S S+S+S L+S+ SS   SSSS ++ S 
Sbjct: 288 PCSVSSSPFTAASSRDLCPPLSSHPSLSSSSLSSSLSSSSLSSSFSSSSLSSSSLSSSSS 347

Query: 504 SS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S S S PSSS++LSS+S S  S SS SLSS + +S+SLS
Sbjct: 348 PSSSSSSPSSSSSLSSSSLSSSSFSSSSLSSSSLSSSSLS 387

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 61/145 (42%), Positives = 77/145 (53%)
 Frame = +3

Query: 207 SDVAFLLVFESSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSS 386
           S ++  L   S  SS+S   L SS L++       S        SSPS SSS  S   SS
Sbjct: 317 SSLSSSLSSSSLSSSFSSSSLSSSSLSSSSSPSSSS--------SSPSSSSSLSSSSLSS 368

Query: 387 STLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSI 566
           S+  SSS S  S+S S S+S+S  S++S SSSS ++ S SS S S  SSS+  SS+ SS 
Sbjct: 369 SSFSSSSLSSSSLSSS-SLSSSSLSSSSLSSSSLSSSSLSSSSLSSASSSSLSSSSLSSS 427

Query: 567 FSISSLSLSSPASNSTSLS*FSPPS 641
           F  S  S SSP S+S       PPS
Sbjct: 428 FHPS--SCSSPQSSSP-----QPPS 445

[97][TOP]
>UniRef100_B9PPC3 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1
           RepID=B9PPC3_TOXGO
          Length = 1359

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 53/105 (50%), Positives = 67/105 (63%), Gaps = 4/105 (3%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS--- 509
           SS S SSS  S   SSS+  SSSSS  S + S S S+S  S++S+SSSS A+PS SS   
Sbjct: 43  SSSSSSSSASSSSSSSSSSASSSSSSSSSASSSSSSSSSASSSSNSSSSSASPSSSSSSS 102

Query: 510 -*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
             S S  SSS+A SS+SSS  S+SS S SS +S+S+S + F   S
Sbjct: 103 ASSSSSSSSSSASSSSSSSSSSVSSSSSSSASSSSSSSASFHASS 147

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  SSSSS  S S S S SAS +S++SSS+SS +  S SS S 
Sbjct: 36  SSSSASSSSSSSSSSASSSSSSSSSSASSSSSSSSSASSSSSSSSSASSSSNSSSSSASP 95

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+A SS+SSS  S SS S SS +S S+S S
Sbjct: 96  SSSSSSSASSSSSSSSSSASSSSSSSSSSVSSSSS 130

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 48/97 (49%), Positives = 62/97 (63%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           RP++   SSS  S   SSS+  SSSSS  S S S S S+S +SA+SSSSSS +  S SS 
Sbjct: 19  RPTAAMSSSSSASSSSSSSSSASSSSSSSSSSASSSSSSSSSSASSSSSSSSSASSSSSS 78

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  SSS + SS++S   S SS + SS +S+S+S S
Sbjct: 79  SSSASSSSNSSSSSASPSSSSSSSASSSSSSSSSSAS 115

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+S  S S S S S+S +S++S+SSSS ++ S SS S 
Sbjct: 28  SSASSSSSSSSSASSSSSSSSSSASSSSSSSSSSASSSSSSSSSASSSSSSSSSASSSSN 87

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS++  SS+SSS  S SS S SS +S+S+S S
Sbjct: 88  SSSSSASPSSSSSSSASSSSSSSSSSASSSSSSSS 122

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S ++++SSSSSS A+ S +S S 
Sbjct: 32  SSSSSSSSASSSSSSSSSSASSSSSSSSSSASSSSSSSSSASSSSSSSSSASSSSNSSSS 91

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ SS SSS  S SS + SS +S+S+S+S
Sbjct: 92  SASPSSSSSSSASSSSSSSSSSASSSSSSSSSSVS 126

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS   SSSSS  S S S S S+S +S++SSSSS+ ++ + SS S 
Sbjct: 34  SSSSSSASSSSSSSSSSASSSSSSSSSSASSSSSSSSSASSSSSSSSSASSSSNSSSSSA 93

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SP SSS++ +S+SSS  S S+ S SS +S+S S S
Sbjct: 94  SPSSSSSSSASSSSSSSSSSASSSSSSSSSSVSSS 128

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 46/92 (50%), Positives = 61/92 (66%)
 Frame = +3

Query: 348 SLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPP 527
           S+S  P + + SSS+  SSSSS  S S S S S+S  S++SSSSSS A+ S SS S +  
Sbjct: 15  SISQRPTAAMSSSSSASSSSSSSSSASSSSSSSSSSASSSSSSSSSSASSSSSSSSSASS 74

Query: 528 SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SSS++ S++SSS  S SS S SS +S+S S S
Sbjct: 75  SSSSSSSASSSSNSSSSSASPSSSSSSSASSS 106

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 51/96 (53%), Positives = 64/96 (66%), Gaps = 1/96 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S S S SAS +S++SSS+SS ++ S S+ S 
Sbjct: 26  SSSSASSSSSSSSSASSSSSSSSSSASSSSSSSSSSASSSSSSSSSASSSSSSSSSASSS 85

Query: 519 SPPSSSTAL-SSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+A  SS+SSS  S SS S SS AS+S+S S
Sbjct: 86  SNSSSSSASPSSSSSSSASSSSSSSSSSASSSSSSS 121

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S S S+S +S++S+SSSS ++ S +S S 
Sbjct: 38  SSASSSSSSSSSSASSSSSSSSSSASSSSSSSSSASSSSSSSSSASSSSNSSSSSASPSS 97

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 98  SSSSSASSSSSSSSSSASSSSSSSSSSVSSSSSSS 132

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 46/93 (49%), Positives = 61/93 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S + S S+S +SA+SSSSSS +  S S+ S 
Sbjct: 31  SSSSSSSSSASSSSSSSSSSASSSSSSSSSSASSSSSSSSSASSSSSSSSSASSSSNSSS 90

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  S S++ SS++SS  S SS S SS +S+S+S
Sbjct: 91  SSASPSSSSSSSASSSSSSSSSSASSSSSSSSS 123

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/103 (45%), Positives = 63/103 (61%)
 Frame = +3

Query: 315 FFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPAT 494
           FF +      P+ + S  S   SSS   SSSSS  S S S S SAS +S++SSSS+S ++
Sbjct: 10  FFLYESISQRPTAAMSSSSSASSSS---SSSSSASSSSSSSSSSASSSSSSSSSSASSSS 66

Query: 495 PSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S SS S S  SSS+A SS++SS  S S  S SS +++S+S S
Sbjct: 67  SSSSSASSSSSSSSSASSSSNSSSSSASPSSSSSSSASSSSSS 109

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 46/90 (51%), Positives = 57/90 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S S S+S +SA+SSSSSS ++ S SS S 
Sbjct: 63  SSSSSSSSSASSSSSSSSSASSSSNSSSSSASPSSSSS-SSASSSSSSSSSSASSSSSSS 121

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASN 608
           S   SS++ SS SSS  S +S   SSP S+
Sbjct: 122 SSSVSSSSSSSASSSSSSSASFHASSPCSS 151

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 47/94 (50%), Positives = 61/94 (64%), Gaps = 1/94 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   S+S+  SSSSS  S S S S SAS +S++SSS+SS ++ S SS S 
Sbjct: 57  SSSSSASSSSSSSSSASSSSSSSSSASSSSNSSSSSASPSSSSSSSASSSSSSSSSSASS 116

Query: 519 SPPSSSTAL-SSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS+++ SS+SSS  S SS S S  AS+  S
Sbjct: 117 SSSSSSSSVSSSSSSSASSSSSSSASFHASSPCS 150

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 45/101 (44%), Positives = 63/101 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SS++  SSSSS  S S + S S++  S++SSSS+S ++ S SS   
Sbjct: 56  SSSSSSASSSSSSSSSASSSSSSSSSASSSSNSSSSSASPSSSSSSSASSSSSSSSS--- 112

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
              S+S++ SS+SSS+ S SS S SS +S+S S    SP S
Sbjct: 113 ---SASSSSSSSSSSVSSSSSSSASSSSSSSASFHASSPCS 150

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 43/101 (42%), Positives = 62/101 (61%)
 Frame = +3

Query: 321 FFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPS 500
           FFL    S   +++  S   +SS+  SSSS+  S S S S ++S +S++SSS+SS ++ S
Sbjct: 10  FFLYESISQRPTAAMSSSSSASSSSSSSSSASSSSSSSSSSASSSSSSSSSSASSSSSSS 69

Query: 501 RSS*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S+ S S  SSS + SS SSS  +  S S SS AS+S+S S
Sbjct: 70  SSASSSSSSSSSASSSSNSSSSSASPSSSSSSSASSSSSSS 110

[98][TOP]
>UniRef100_B6KJ65 Zinc finger (C3HC4 type RING finger) protein, putative n=1
           Tax=Toxoplasma gondii ME49 RepID=B6KJ65_TOXGO
          Length = 805

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 49/81 (60%), Positives = 58/81 (71%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSSP S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++PS SS S 
Sbjct: 590 SSPSCSSSPSSSPSSSSS--SSSSSSSSPSSSPSSSSSPSSSPSSSSSSSSSPSSSS-SS 646

Query: 519 SPPSSSTALSSTSSSIFSISS 581
           S PSSS++ SS+SSS FS SS
Sbjct: 647 SSPSSSSSSSSSSSSSFSFSS 667

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 51/93 (54%), Positives = 63/93 (67%)
 Frame = +3

Query: 345 PSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSP 524
           PS SSS  SP  SSS+  SS S   S S S S S+S +S++SSSSSS ++PS S  S S 
Sbjct: 567 PSFSSSS-SPSASSSSSSSSPSPSSSPSCSSSPSSSPSSSSSSSSSSSSSPSSSPSSSSS 625

Query: 525 PSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           PSSS + SS+SSS  S SS S SSP+S+S+S S
Sbjct: 626 PSSSPSSSSSSSSSPS-SSSSSSSPSSSSSSSS 657

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 49/92 (53%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSP-ATPSRSS*S 515
           +S S SSS PSP  S S   S SSS  S S S S S+S  S++ SSSSSP ++PS SS S
Sbjct: 577 ASSSSSSSSPSPSSSPSCSSSPSSSPSSSSSSSSSSSSSPSSSPSSSSSPSSSPSSSSSS 636

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNS 611
            S PSSS++ SS SSS  S SS S S   S+S
Sbjct: 637 SSSPSSSSSSSSPSSSSSSSSSSSSSFSFSSS 668

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SSPS SSS  S  PS S+  S SSS  S     S S+S +S++SSSSS  ++PS SS   
Sbjct: 573 SSPSASSSSSSSSPSPSSSPSCSSSPSS-----SPSSSSSSSSSSSSSPSSSPSSSSSPS 627

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S PSSS++ SS+ SS  S SS S SS +S+S+S S
Sbjct: 628 SSPSSSSSSSSSPSSSSSSSSPSSSSSSSSSSSSS 662

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 47/96 (48%), Positives = 58/96 (60%)
 Frame = +3

Query: 336 PSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           P SP   S    P  SSS+  S+SSS  S S S S S S +S+ SSS SS ++ S SS  
Sbjct: 555 PRSPLAQSVERVPSFSSSSSPSASSSSSSSSPSPSSSPSCSSSPSSSPSSSSSSSSSS-- 612

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S PSSS + SS+ SS  S SS S SSP+S+S+S S
Sbjct: 613 SSSPSSSPSSSSSPSSSPSSSSSSSSSPSSSSSSSS 648

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 40/83 (48%), Positives = 53/83 (63%), Gaps = 3/83 (3%)
 Frame = +3

Query: 381 SSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSS 560
           SSS+  SSSSS  S S S S S+S +S++SSSSSSP++ S SS S S  SSS++ SS+SS
Sbjct: 383 SSSSASSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSSSSSSSSSSSSSSSSSSSSS 442

Query: 561 S---IFSISSLSLSSPASNSTSL 620
           S    F  +S S + P    + L
Sbjct: 443 SPRHTFVAASSSSAHPGEGRSCL 465

[99][TOP]
>UniRef100_B6KEA9 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii ME49
            RepID=B6KEA9_TOXGO
          Length = 2476

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            + P  SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 1007 TGPFTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 1066

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 1067 SSSSSSSSFSSSSSSSSSSSSSSSSSSSSSSASCS 1101

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 50/93 (53%), Positives = 61/93 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            +S S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 1011 TSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 1070

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
            S  S S++ SS+SSS  S SS S SS AS STS
Sbjct: 1071 SSSSFSSSSSSSSSSSSSSSSSSSSSSASCSTS 1103

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS + S + P    SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 1000 SSCTSSFTGPFTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 1059

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 1060 SSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSSSS 1094

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 48/97 (49%), Positives = 60/97 (61%)
 Frame = +3

Query: 333  RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
            RP   S  SS  S      T  SSSSS  S S S S S+S +S++SSSSSS ++ S SS 
Sbjct: 992  RPRKKSALSSCTSSFTGPFTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 1051

Query: 513  SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            S S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 1052 SSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSS 1088

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 49/92 (53%), Positives = 59/92 (64%)
 Frame = +3

Query: 348  SLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPP 527
            S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S S  
Sbjct: 1012 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 1071

Query: 528  SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
            SSS + SS+SSS  S SS S SS +S S S S
Sbjct: 1072 SSSFSSSSSSSSSSSSSSSSSSSSSSASCSTS 1103

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/86 (52%), Positives = 56/86 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S S  S 
Sbjct: 1019 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSS 1078

Query: 519  SPPSSSTALSSTSSSIFSISSLSLSS 596
            S  SSS++ SS+SSS  S +S S SS
Sbjct: 1079 SSSSSSSSSSSSSSSSSSSASCSTSS 1104

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 41/81 (50%), Positives = 53/81 (65%)
 Frame = +3

Query: 339  SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
            SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 1025 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSS 1084

Query: 519  SPPSSSTALSSTSSSIFSISS 581
            S  SSS++ SS+S+S  + S+
Sbjct: 1085 SSSSSSSSSSSSSASCSTSSA 1105

[100][TOP]
>UniRef100_UPI0000F2EAE8 PREDICTED: hypothetical protein, partial n=1 Tax=Monodelphis
           domestica RepID=UPI0000F2EAE8
          Length = 467

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 38/104 (36%), Positives = 61/104 (58%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  +N DSD + +  D+ D+++  N  DD DD+  +++  +YD DD D    +DD++   
Sbjct: 25  DDDDNDDSDYDDDDDDDDDSDDDNNNDDDDDDD--DDDDNDYDNDDDDDDDDDDDDDDDD 82

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRS 329
           D  D + D+D + D  DD+DDN+ DD+   D  DDD D ++ RS
Sbjct: 83  DDDDDDDDSDDEEDGDDDDDDND-DDNDNDDDDDDDEDEEEERS 125

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 33/114 (28%), Positives = 60/114 (52%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
           +N + D +++  D+ DN++ +   DD DD+  +++    D DD D     D +    D  
Sbjct: 13  QNDNDDSDYDDDDDDDNDDSDYDDDDDDDDDSDDDNNNDDDDDDDDDDDNDYDNDDDDDD 72

Query: 451 DAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSP 290
           D + D D D D  DD+DD++ ++DG  D  D+D D D+       +++ + +SP
Sbjct: 73  DDDDDDDDDDDDDDDDDDSDDEEDGDDDDDDNDDDNDNDDDDDDDEDEEEERSP 126

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = -1

Query: 610 EFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAEMD-T 434
           E +  +++DN++ +   DD DDN    +  +YD DD D    +DD     D  D + D  
Sbjct: 7   ETKLKNQNDNDDSDYDDDDDDDN----DDSDYDDDDDDDDDSDDDNNNDDDDDDDDDDDN 62

Query: 433 DMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
           D D D  DD+DD++ DDD   D  DDD D DD
Sbjct: 63  DYDND-DDDDDDDDDDDDDDDDDDDDDDDSDD 93

[101][TOP]
>UniRef100_Q76SB0 ORF 73 n=2 Tax=Human herpesvirus 8 RepID=Q76SB0_HHV8
          Length = 1162

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 41/160 (25%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  E  ++D E E  DE D+EE +   D+ DD   +EE  E D ++ D    E+D+E   
Sbjct: 330 DDEEEQETDEEDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEED 389

Query: 460 DVSDAEMDTDMDMDLIDDEDDN-NVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
           +  D E D + + +  DD++DN + +DD   D  +D+ DG DG      +  ++++ P  
Sbjct: 390 EEEDEEEDEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQ 449

Query: 283 SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
              + +    Q+  ++ + +     EP +++  ++ +  E
Sbjct: 450 QEPQQQEPQQQEPLQEPQQQEPQQQEPQQQEPLQEPQQQE 489

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 40/160 (25%), Positives = 77/160 (48%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           GD   + +S V+ +  D  D+EE E   D+ D+   EE+  E D +D +    EDDEE  
Sbjct: 311 GDNEISKESQVDKDDNDNKDDEE-EQETDEEDEEDDEEDDEEDDEEDDEEDDEEDDEE-- 367

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
            D  D E D + D +  D+E+D   D++   +  D++ D D+    ++  E+  +K    
Sbjct: 368 DDEEDDEEDDEEDDEEDDEEEDEEEDEEEDEEEEDEEDDDDEDNEDEEDDEEEDKKED-- 425

Query: 283 SLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
                    ++D  + +KT    +S+  ++ ++++ +  E
Sbjct: 426 ---------EEDGGDGNKTLSIQSSQQQQEPQQQEPQQQE 456

[102][TOP]
>UniRef100_A9VVF7 AAA ATPase containing von Willebrand factor type A (VWA)-like
           domain n=1 Tax=Bacillus weihenstephanensis KBAB4
           RepID=A9VVF7_BACWK
          Length = 312

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 43/145 (29%), Positives = 71/145 (48%), Gaps = 3/145 (2%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  ++ D D E E  D+ D+++ ++  DD DD+  +E+  + D DD D    ++D+E   
Sbjct: 168 DDEDDDDEDDEDEDDDDEDDDDDDDDEDDEDDDDEDEDDDDEDEDDDDDDEDDEDDEDED 227

Query: 460 DVSDA---EMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSP 290
           D  D    E D D D D  DDEDD + D+D   D  DDD + D+    +  ++    +  
Sbjct: 228 DDDDDDEDEDDDDDDEDDEDDEDDEDDDEDDEDDEDDDDDEDDEDEDDEDDEDDDDDEDD 287

Query: 289 FASLEEYKHLIDQDEKEDSKTKRKA 215
               +EY+   D D+ +D   +  A
Sbjct: 288 DDDEDEYEDDEDDDDDDDDGEEEDA 312

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 42/135 (31%), Positives = 67/135 (49%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  ++ D D E E  D+ D +E +   DD DD   E++  + D DD D    ED+++   
Sbjct: 98  DDDDDEDEDEEEEEDDDDDEDEDDEDEDDEDDEDEEDDDDDDDDDDEDEDE-EDEDDDDE 156

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
           D  D E D D D +  DDEDD + DDD   D  DDD + D+    + + +  + +     
Sbjct: 157 DDEDDEDDEDDDDEDDDDEDDEDEDDDDEDDDDDDDDEDDEDDDDEDEDDDDEDEDDDDD 216

Query: 280 LEEYKHLIDQDEKED 236
            E+ +   D+D+ +D
Sbjct: 217 DEDDEDDEDEDDDDD 231

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 41/131 (31%), Positives = 66/131 (50%)
 Frame = -1

Query: 622 DSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAE 443
           D D + E  D+ D+E+ E+  DD DD+  +E+  + D DD D    EDDE+   +  D E
Sbjct: 116 DEDEDDEDEDDEDDEDEEDDDDDDDDDDEDEDEEDEDDDDEDDEDDEDDEDDDDEDDDDE 175

Query: 442 MDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEEYKH 263
            D D D D  DD+DD++ +DD   D  D+D D +D       ++    +      ++ + 
Sbjct: 176 DDEDEDDDDEDDDDDDDDEDDEDDDDEDEDDDDEDEDDDDDDEDDEDDEDEDDDDDDDED 235

Query: 262 LIDQDEKEDSK 230
             D D+ ED +
Sbjct: 236 EDDDDDDEDDE 246

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 42/135 (31%), Positives = 68/135 (50%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  ++ D D E E  D+ D+E+ E+  DD D++  +E+  + D DD D    +DDE+   
Sbjct: 139 DDDDDEDEDEEDEDDDDEDDEDDEDDEDDDDEDDDDEDDEDEDDDDEDDDDDDDDEDDED 198

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
           D  + E D D D D  DD++D+  DD+   D  DDD D DD    +  ++    +     
Sbjct: 199 DDDEDEDDDDEDEDDDDDDEDDE-DDEDEDDDDDDDEDEDDDDDDEDDEDDEDDEDDDED 257

Query: 280 LEEYKHLIDQDEKED 236
            E+ +   D ++ ED
Sbjct: 258 DEDDEDDDDDEDDED 272

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 39/101 (38%), Positives = 55/101 (54%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  E+ D D + +  DE ++EE E   DD +D   E+E  E D D+ D    +DD++   
Sbjct: 88  DDDEDEDEDDD-DDDDEDEDEEEEEDDDDDEDEDDEDEDDEDDEDEEDDDDDDDDDDEDE 146

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
           D  D + D + D D  DDEDD++ DDD   D  +DD D DD
Sbjct: 147 DEEDEDDDDEDDEDDEDDEDDDDEDDDDEDDEDEDDDDEDD 187

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 43/137 (31%), Positives = 66/137 (48%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  E+ D + E +  DE D E+ ++  DD D++  EE+  + D DD D    EDD++   
Sbjct: 114 DDDEDEDDEDEDDEDDE-DEEDDDDDDDDDDEDEDEEDEDDDDEDDEDDEDDEDDDDEDD 172

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
           D  D E + D D D  DD+DD + +DD   D  DDD D DD    +  ++          
Sbjct: 173 DDEDDEDEDDDDEDDDDDDDDEDDEDDDDEDEDDDDEDEDDDDDDEDDEDDEDEDDDDDD 232

Query: 280 LEEYKHLIDQDEKEDSK 230
            E+     D ++ ED +
Sbjct: 233 DEDEDDDDDDEDDEDDE 249

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 37/101 (36%), Positives = 55/101 (54%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           D  E+ D   E E  +E D+++ E+  +D DD+  E+E  E + DD D    +D++E   
Sbjct: 68  DEDEDKDEVDEEEEEEEDDDDDDEDEDEDDDDDDDEDEDEEEEEDDDDDEDEDDEDEDDE 127

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
           D  D E D D D D  +DED+ + DDD   D  D+D + DD
Sbjct: 128 DDEDEEDDDDDDDDDDEDEDEEDEDDDDEDDEDDEDDEDDD 168

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 40/132 (30%), Positives = 64/132 (48%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
           +  D + E E  D+ D+E+ +   DD DD   +EE  E D DD D    ++D+E   D  
Sbjct: 74  DEVDEEEEEEEDDDDDDEDEDEDDDDDDDEDEDEEEEEDDDDDEDEDDEDEDDEDDEDEE 133

Query: 451 DAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEE 272
           D + D D D +  D+ED+++ D+D   D  D+D D +D   +  + E    +      ++
Sbjct: 134 DDDDDDDDDDEDEDEEDEDDDDEDDEDDEDDEDDDDEDDDDEDDEDEDDDDEDDDDDDDD 193

Query: 271 YKHLIDQDEKED 236
                D DE ED
Sbjct: 194 EDDEDDDDEDED 205

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 37/131 (28%), Positives = 67/131 (51%)
 Frame = -1

Query: 622 DSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAE 443
           +++V F   +E D+E+ +   D+VD+   EEE  + D +D D    +DD+E   D  + E
Sbjct: 53  ETEVIFTDEEEEDDEDEDEDKDEVDEEEEEEEDDDDDDEDEDEDDDDDDDE---DEDEEE 109

Query: 442 MDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEEYKH 263
            + D D +  DDED+++ DD+   D  DDD D D+   ++ + +  +        E+   
Sbjct: 110 EEDDDDDEDEDDEDEDDEDDEDEEDDDDDDDDDDEDEDEEDEDDDDEDDEDDEDDEDDDD 169

Query: 262 LIDQDEKEDSK 230
             D DE ++ +
Sbjct: 170 EDDDDEDDEDE 180

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 37/98 (37%), Positives = 52/98 (53%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
           E  D + E E  DE D EE E   DD DD   +E+  + D +D D    EDD++   D  
Sbjct: 62  EEEDDEDEDEDKDEVDEEEEEEEDDDDDDEDEDEDDDDDDDEDEDEEEEEDDDD-DEDED 120

Query: 451 DAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
           D + D + D D  DD+DD++ DD+   +  +DD D DD
Sbjct: 121 DEDEDDEDDEDEEDDDDDDDDDDEDEDEEDEDDDDEDD 158

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 40/134 (29%), Positives = 64/134 (47%), Gaps = 5/134 (3%)
 Frame = -1

Query: 622 DSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSDAE 443
           D D + +  D+ D +E E   +D DD+  E++  E D DD D    +DD++   +  D E
Sbjct: 90  DEDEDEDDDDDDDEDEDEEEEEDDDDDEDEDDEDEDDEDDEDEEDDDDDDDDDDEDEDEE 149

Query: 442 MDTDMDMDLIDDEDD-NNVDDDGTG----DGGDDDSDGDDGRSKKKKKEKRKRKSPFASL 278
            + D D D  DDEDD ++ D+D       D  DDD D DD    +  ++           
Sbjct: 150 DEDDDDEDDEDDEDDEDDDDEDDDDEDDEDEDDDDEDDDDDDDDEDDEDDDDEDEDDDDE 209

Query: 277 EEYKHLIDQDEKED 236
           +E     D+D+++D
Sbjct: 210 DEDDDDDDEDDEDD 223

[103][TOP]
>UniRef100_A5AD22 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5AD22_VITVI
          Length = 222

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 42/153 (27%), Positives = 75/153 (49%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
           E+ D + E E  D+ D+EE E   ++ D+   E + GE D  D DG   E++EE   D  
Sbjct: 62  EDDDDEEEEEKEDDDDDEEEEKKEEEEDEEEKENDDGEED--DNDGKKEEEEEEGEDDDD 119

Query: 451 DAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEE 272
           D E +   + +  DDE++   +D+   +  DD+ + DD    +K+KE    +        
Sbjct: 120 DEEEEEKEEEEEDDDEEEEEEEDEEEKEDDDDEKENDDEEDDEKEKEDDDNE-------- 171

Query: 271 YKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSK 173
                ++DE+ED   ++    +  +KK+K++ K
Sbjct: 172 -----EEDEEEDDDNEKGEEDDNNEKKEKEEEK 199

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 43/142 (30%), Positives = 70/142 (49%), Gaps = 4/142 (2%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDN----EEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           E  + + E + G+E DN    EE E   +D DD+  EEE  E + DD +    E+DEE  
Sbjct: 87  EEDEEEKENDDGEEDDNDGKKEEEEEEGEDDDDDEEEEEKEEEEEDDDEEEEEEEDEEEK 146

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFA 284
            D  D + + D + D  + EDD+N ++D   D  ++  + DD   KK+K+E+++      
Sbjct: 147 EDDDDEKENDDEEDDEKEKEDDDNEEEDEEEDDDNEKGEEDDNNEKKEKEEEKEEGE--- 203

Query: 283 SLEEYKHLIDQDEKEDSKTKRK 218
                    D D+ ED + + K
Sbjct: 204 ---------DDDDNEDEEEEEK 216

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 41/156 (26%), Positives = 80/156 (51%), Gaps = 1/156 (0%)
 Frame = -1

Query: 628 NYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVSD 449
           N   + EF   +E + EE+++  D+ ++   EEE  E + DD D    E++EE   D  D
Sbjct: 23  NVFEEEEFNVFEEKEEEEVDDDDDEKEEEKEEEEEEEEEEDDDD----EEEEEKEDDDDD 78

Query: 448 AEMDT-DMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASLEE 272
            E +  + + D  + E+D+  +DD  G   +++ +G+D    ++++EK + +      EE
Sbjct: 79  EEEEKKEEEEDEEEKENDDGEEDDNDGKKEEEEEEGEDDDDDEEEEEKEEEEEDDDEEEE 138

Query: 271 YKHLIDQDEKEDSKTKRKATSEPTKKKKKKKSKASE 164
            +   D++EKED   +++   E   +K+K+     E
Sbjct: 139 EEE--DEEEKEDDDDEKENDDEEDDEKEKEDDDNEE 172

[104][TOP]
>UniRef100_Q5Y827 Putative uncharacterized protein n=1 Tax=Atrina rigida
           RepID=Q5Y827_ATRRI
          Length = 244

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 40/105 (38%), Positives = 58/105 (55%), Gaps = 4/105 (3%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENM----LDDVDDNAVEEEGGEYDYDDLDGVAGEDDE 473
           DGG++  SD E +   +S  E+ +N      DD +D++ +++  + D DD D  A +DD 
Sbjct: 74  DGGDDDASDGEDDDDGDSAEEDEDNGDDSGADDGEDDSADDDSEDDDDDDDDDDASDDDG 133

Query: 472 ELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
           +   D SD + D D D D  DD+DD + DDD   D  DDD D DD
Sbjct: 134 DDDDDASDDDDDDDDDDDDDDDDDDEDDDDDDDDDDDDDDDDDDD 178

 Score = 67.8 bits (164), Expect = 8e-10
 Identities = 43/134 (32%), Positives = 64/134 (47%)
 Frame = -1

Query: 640 DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
           DG ++ D D   E  D  D+   ++  DD  D+  E++  + D DD     G+DD++   
Sbjct: 82  DGEDDDDGDSAEEDEDNGDDSGADDGEDDSADDDSEDDDDDDDDDDASDDDGDDDDDASD 141

Query: 460 DVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFAS 281
           D  D + D D D D  D++DD++ DDD   D  DDD D DD       +E+       AS
Sbjct: 142 DDDDDDDDDDDDDDDDDEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDNEEEDDGGDDDAS 201

Query: 280 LEEYKHLIDQDEKE 239
            +E     D DE +
Sbjct: 202 ADEADE-ADADEAD 214

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 42/109 (38%), Positives = 59/109 (54%), Gaps = 8/109 (7%)
 Frame = -1

Query: 640 DGGEN-YDSDVEFEAGD---ESDNEEIENMLDDVDDNAVEEEGGEYDY----DDLDGVAG 485
           DGG N    DVE +A D   + D +  EN +DD +D   E +GG+ D     DD DG + 
Sbjct: 33  DGGANDVADDVEADAADLEEDVDQDVDENDVDDEEDADDEADGGDDDASDGEDDDDGDSA 92

Query: 484 EDDEELVADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
           E+DE+   D    + + D   D  +D+DD++ DDD + D GDDD D  D
Sbjct: 93  EEDEDNGDDSGADDGEDDSADDDSEDDDDDDDDDDASDDDGDDDDDASD 141

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 38/154 (24%), Positives = 72/154 (46%), Gaps = 8/154 (5%)
 Frame = -1

Query: 643 GDGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
           GD  E  + + +    D+ +++  ++  +D DD+  +++  + D DD D  + +DD++  
Sbjct: 89  GDSAEEDEDNGDDSGADDGEDDSADDDSEDDDDDDDDDDASDDDGDDDDDASDDDDDDDD 148

Query: 463 ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSD--------GDDGRSKKKKKEK 308
            D  D + D + D D  DD+DD++ DDD   D  DDD D        GDD  S  +  E 
Sbjct: 149 DDDDDDDDDDEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDNEEEDDGGDDDASADEADEA 208

Query: 307 RKRKSPFASLEEYKHLIDQDEKEDSKTKRKATSE 206
              ++     +      D+ +  D  T+ +  ++
Sbjct: 209 DADEADADEADADNDAADETDAADVGTEAEDVAD 242

[105][TOP]
>UniRef100_B4J884 GH21314 n=1 Tax=Drosophila grimshawi RepID=B4J884_DROGR
          Length = 843

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 47/141 (33%), Positives = 72/141 (51%), Gaps = 12/141 (8%)
 Frame = -1

Query: 631 ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGE-----DDEEL 467
           E  D +V     + + +EE E   +DV+++ +EEE  E+  DD D   G+     DD+EL
Sbjct: 145 EEEDDEVSENEIEANSDEEAEEGDEDVNES-LEEEEEEFMDDDNDAQIGKLDDLFDDDEL 203

Query: 466 VADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKK-------KKKEK 308
           +   S+ + D  +D +   + D+++VDDD   D  DDD D DD    K       KK +K
Sbjct: 204 I---SEPDQDQAIDSENGQESDEDDVDDDDDDDDDDDDDDDDDDGENKLPIERANKKLKK 260

Query: 307 RKRKSPFASLEEYKHLIDQDE 245
           R+ K    S EE +  +DQ E
Sbjct: 261 RQEKDAILSREEMQMSVDQSE 281

[106][TOP]
>UniRef100_B4J6K1 GH20141 n=1 Tax=Drosophila grimshawi RepID=B4J6K1_DROGR
          Length = 2304

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 52/142 (36%), Positives = 75/142 (52%), Gaps = 8/142 (5%)
 Frame = -1

Query: 640  DGGENYDS---DVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEE 470
            D  ENYD    D + +  D+ DN++IEN  DD DD    E   E D D+ D    +DD++
Sbjct: 1231 DDDENYDDENGDDDEDEDDDEDNDDIENKDDDEDDEDENENDNEDDDDNGDDDDDDDDDD 1290

Query: 469  LVAD-VSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGD--DDSDGDDGRSKKKKKEKRKR 299
               D  +D E + D D D  D++DDN+ DDD   D  D  DD+D ++  SK+  K K K 
Sbjct: 1291 DDEDGENDNENNKDDDND-DDNDDDNDDDDDNDDDNDDKNDDNDEEEDISKQIYKHKAKG 1349

Query: 298  KSPFASLEEY--KHLIDQDEKE 239
            ++    L +    HLID+ + E
Sbjct: 1350 RT-IHRLSDLCAGHLIDEIDDE 1370

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 4/103 (3%)
 Frame = -1

Query: 631  ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEE----EGGEYDYDDLDGVAGEDDEELV 464
            +N D+D + E  D+ D ++ EN  DD D++  E+    E GE D D+ D    EDDE+  
Sbjct: 1087 DNDDNDNDDENDDDEDEDDDENGDDDEDEDEDEDDDDDENGEDDEDEDDDENVEDDEDDD 1146

Query: 463  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDG 335
             D  + E + D D +  DD DD+N DD+   D  DDD D ++G
Sbjct: 1147 EDEDEDEDEDDDDDENGDDNDDDNDDDENDDDDNDDDDDDENG 1189

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 45/162 (27%), Positives = 77/162 (47%), Gaps = 9/162 (5%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDD---LDGVAGEDDEE 470
            + G++ D D + +  D+ D+   +N  D+ DDN  +++    D DD    D   G+DDE+
Sbjct: 1187 ENGDDNDDDNDDDENDDEDDNNDDNGDDNDDDNEDDDDDNNDDEDDDENYDDENGDDDED 1246

Query: 469  LVADVSDAEMDTDMDMDLIDDEDDN-NVDDDGTGDGGDDDSDGDDGRSKKKKKEKRK--- 302
               D  + +++   D +  +DE++N N DDD  GD  DDD D DD    +   E  K   
Sbjct: 1247 EDDDEDNDDIENKDDDEDDEDENENDNEDDDDNGDDDDDDDDDDDDEDGENDNENNKDDD 1306

Query: 301  --RKSPFASLEEYKHLIDQDEKEDSKTKRKATSEPTKKKKKK 182
                +   + ++  +  D D+K D   + +  S+   K K K
Sbjct: 1307 NDDDNDDDNDDDDDNDDDNDDKNDDNDEEEDISKQIYKHKAK 1348

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 17/118 (14%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDD--NAVEEEGGEYDYDDLDGVAGEDDE-- 473
            D G++ D D   +  D++DN++  +  +D DD  N  ++E  + D DD D   GEDDE  
Sbjct: 1074 DNGDDDDEDDTDDDNDDNDNDDENDDDEDEDDDENGDDDEDEDEDEDDDDDENGEDDEDE 1133

Query: 472  ---ELVADVSDAEMDTDMDMDLIDDEDDNNVD----------DDGTGDGGDDDSDGDD 338
               E V D  D + D D D D  DD+D+N  D          DD   D  DDD +GDD
Sbjct: 1134 DDDENVEDDEDDDEDEDEDEDEDDDDDENGDDNDDDNDDDENDDDDNDDDDDDENGDD 1191

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 43/145 (29%), Positives = 67/145 (46%), Gaps = 9/145 (6%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            D  E+ D D +    D+ D ++ EN+ DD DD+  E+E  + D DD +     DD+    
Sbjct: 1114 DEDEDEDDDDDENGEDDEDEDDDENVEDDEDDDEDEDEDEDEDDDDDENGDDNDDDNDDD 1173

Query: 460  DVSDAEMDTDMDMDLIDDEDDNNVDD---------DGTGDGGDDDSDGDDGRSKKKKKEK 308
            +  D + D D D +  DD DD+N DD         D  GD  DDD++ DD  +   + + 
Sbjct: 1174 ENDDDDNDDDDDDENGDDNDDDNDDDENDDEDDNNDDNGDDNDDDNEDDDDDNNDDEDDD 1233

Query: 307  RKRKSPFASLEEYKHLIDQDEKEDS 233
                      +E     D+D+ ED+
Sbjct: 1234 ENYDDENGDDDE-----DEDDDEDN 1253

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 41/102 (40%), Positives = 58/102 (56%), Gaps = 1/102 (0%)
 Frame = -1

Query: 640  DGGENYDSDV-EFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELV 464
            D  EN D D  E E  D+ D+E  E+  D+ DD  VE++  E D +D D    EDD++  
Sbjct: 1104 DDDENGDDDEDEDEDEDDDDDENGEDDEDEDDDENVEDD--EDDDEDEDEDEDEDDDD-- 1159

Query: 463  ADVSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
             D +  + D D D D  DD+D+++ DDD  GD  DDD+D D+
Sbjct: 1160 -DENGDDNDDDNDDDENDDDDNDDDDDDENGDDNDDDNDDDE 1200

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 35/105 (33%), Positives = 57/105 (54%), Gaps = 7/105 (6%)
 Frame = -1

Query: 631  ENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVADVS 452
            +N D D + +  D  D+++ ++  DD DDN  ++E  + D D+ D   G+DDE+   D  
Sbjct: 1062 KNDDDDGDDDDDDNGDDDDEDDTDDDNDDNDNDDENDD-DEDEDDDENGDDDEDEDEDED 1120

Query: 451  D-------AEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDD 338
            D        + D D D ++ DDEDD+  +D+   +  DDD +GDD
Sbjct: 1121 DDDDENGEDDEDEDDDENVEDDEDDDEDEDEDEDEDDDDDENGDD 1165

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 32/108 (29%), Positives = 59/108 (54%), Gaps = 7/108 (6%)
 Frame = -1

Query: 640  DGGENYDSDVEFEAGDESDNEEIENMLDDVDDNAVEEEGGEYDYDDLDGVAGEDDEELVA 461
            DG ++ D + + +  D++D++  +N  DD +D+  +E+  E   DD D    EDD++   
Sbjct: 1067 DGDDDDDDNGDDDDEDDTDDDNDDNDNDDENDDDEDEDDDENGDDDEDEDEDEDDDDDEN 1126

Query: 460  DVSDAEMDTDMDMDLIDDEDDN-------NVDDDGTGDGGDDDSDGDD 338
               D + D D +++  +D+D++       + DDD  GD  DDD+D D+
Sbjct: 1127 GEDDEDEDDDENVEDDEDDDEDEDEDEDEDDDDDENGDDNDDDNDDDE 1174

[107][TOP]
>UniRef100_UPI0001552E13 PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI0001552E13
          Length = 196

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   +S+T  +S+SS  S + S S ++S+TS+TS+S+SS +T S SS S 
Sbjct: 51  SSTSTSSTSSSTCSTSTTSSTSTSSTSSSTCSTSTTSSITSSTSTSTSSTSTSSTSSTST 110

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+ST   STS+S  + SS S S+ +S STS S
Sbjct: 111 SSTSTSTPTPSTSTSTSTTSSTSTSTTSSTSTSTS 145

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/97 (48%), Positives = 63/97 (64%), Gaps = 4/97 (4%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSI-SASLTSATSSSSSSPATPSRS--- 506
           S+ S +SS  S + S ST  +SS+S  + S S SI S S TS+TS+SS+S +T S S   
Sbjct: 10  STSSTTSSSTSSITSISTSTTSSTSTSTSSTSSSICSTSTTSSTSTSSTSSSTCSTSTTS 69

Query: 507 S*SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S S S  SSST  +ST+SSI S +S S SS +++STS
Sbjct: 70  STSTSSTSSSTCSTSTTSSITSSTSTSTSSTSTSSTS 106

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 46/102 (45%), Positives = 63/102 (61%), Gaps = 1/102 (0%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSS-SSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*S 515
           S+ S++S   S   S+ST  SS SSSI S S + S S S TS+++ S+S+ ++ S SS S
Sbjct: 18  STSSITSISTSTTSSTSTSTSSTSSSICSTSTTSSTSTSSTSSSTCSTSTTSSTSTSSTS 77

Query: 516 YSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
            S  S+ST  S TSS+  S SS S SS +S STS +  S P+
Sbjct: 78  SSTCSTSTTSSITSSTSTSTSSTSTSSTSSTSTSSTSTSTPT 119

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 37/94 (39%), Positives = 61/94 (64%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           S S +SS  +   SSST  +S++S  + S S S S++ TS+TSS+S+S  + S  + S S
Sbjct: 64  STSTTSSTSTSSTSSSTCSTSTTSSITSSTSTSTSSTSTSSTSSTSTSSTSTSTPTPSTS 123

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             +S+T+ +STS++  + +S S SS +++STS S
Sbjct: 124 TSTSTTSSTSTSTTSSTSTSTSTSSTSTSSTSTS 157

[108][TOP]
>UniRef100_UPI0000DA43B2 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA43B2
          Length = 423

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S ++S  S++SSSSSS ++ S SS S 
Sbjct: 123 SSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSS 182

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +SNS+S S
Sbjct: 183 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSS 217

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 58/129 (44%), Positives = 74/129 (57%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           +S SS S     SS  +N   R   S        SS S SSS  S   +SS+  SSSSS 
Sbjct: 110 NSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSCSSSSSSS 169

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S   S+S +S++SSSSSS ++ S SS S S  SSS++ SS+SSS  S SS S SS
Sbjct: 170 SSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSS 229

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 230 SSSSSSSSS 238

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS    S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 150 SSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 209

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 210 SSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 244

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 158 NSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSSS 217

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S S S
Sbjct: 218 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSS 252

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 51/95 (53%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 145 SSSSSSSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S+S S
Sbjct: 205 SSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 239

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/95 (52%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 151 SSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 210

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 211 SNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 245

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 50/95 (52%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 149 SSSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 209 SSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 243

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 59/129 (45%), Positives = 73/129 (56%)
 Frame = +3

Query: 237 SSFSSWSIKCLYSSRLANGDFRFLFSFFFFLLRPSSPSLSSSPPSPVPSSSTLLSSSSSI 416
           SS SS S  C  SS  ++       S        SS S SSS  S   SSS+  SSSSS 
Sbjct: 153 SSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSN 212

Query: 417 RSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPPSSSTALSSTSSSIFSISSLSLSS 596
            S S S S S+S +S++SSSSSS ++ S SS S S  SSS++ S  SSS  S SS S SS
Sbjct: 213 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSGSGGSSSSSSSSSSSSSS 272

Query: 597 PASNSTSLS 623
            +S+S+S S
Sbjct: 273 SSSSSSSSS 281

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 50/95 (52%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS RS S S S S+S +S +SSSS+S +  S SS S 
Sbjct: 80  SSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSS 139

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS   SS +S+S+S S
Sbjct: 140 SSSSSSSSSSSSSSSSSSNSSSCSSSSSSSSSSSS 174

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS+SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSC 249

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS +  SS+SSS  S SS S SS +S+S+S S
Sbjct: 250 SSSSSGSGGSSSSSSSSSSSSSSSSSSSSSSSSSS 284

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 49/95 (51%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 198 SSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSGSG 257

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS++ SS+SSS  S SS S SS +SN  S S
Sbjct: 258 GSSSSSSSSSSSSSSSSSSSSSSSSSSSSNKRSAS 292

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/97 (50%), Positives = 63/97 (64%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R +S S SSS  S   SSS+  SSSSS  S S S S S+  +S ++SSSSS ++ S SS 
Sbjct: 67  RSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSS 126

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           + S  SSS++ SS+SSS  S SS S SS +SNS+S S
Sbjct: 127 NSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSCS 163

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS +  SSSSS  S S   S S+S +S++SSSSSS ++ S SS S 
Sbjct: 146 SSSSSSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSS 205

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 206 SSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSS 240

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S S+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 147 SSSSSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 206

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 207 SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 241

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 49/95 (51%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S  SS  S   SSS+  +SSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 101 SSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSNSS 160

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 161 SCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSS 195

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 51/101 (50%), Positives = 61/101 (60%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S  S   
Sbjct: 200 SSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSGSGGS 259

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPPS 641
           S  SSS++ SS+SSS  S SS S SS    S S S  SP S
Sbjct: 260 SSSSSSSSSSSSSSSSSSSSSSSSSSSNKRSASNSTISPRS 300

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S      SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 152 SSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 211

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 212 NSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 246

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 50/97 (51%), Positives = 64/97 (65%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS S SSS  S   SSS   SS+SS RS S S S S+S +S++SSSSSS ++ + SS 
Sbjct: 106 RSSSNSNSSSSSSSSNSSS---SSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSC 162

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  SSS++ SS+ SS  S SS S SS +S+S+S S
Sbjct: 163 SSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSS 199

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 188 SSSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 247

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+    +SSS  S SS S SS +S+S+S S
Sbjct: 248 SCSSSSSGSGGSSSSSSSSSSSSSSSSSSSSSSSS 282

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  +SSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSS 251

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   S  + SS+SSS  S SS S SS +S+S+S S
Sbjct: 252 SSSGSGGSSSSSSSSSSSSSSSSSSSSSSSSSSSS 286

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S   SSSSS  S S S S S S +S++SSSSSS ++ S SS S 
Sbjct: 95  SSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSS 154

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS+  SS+SSS  S SS   SS +S+S+S S
Sbjct: 155 SSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSS 189

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +    SS+  SSSSS  S   S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 148 SSSSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 207

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 208 SSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 242

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  S+SSS  S S S S S+S +S++SSSSSS ++ S SS   
Sbjct: 191 SSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCS 250

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S S   SS+SSS  S SS S SS +S+S+S S
Sbjct: 251 SSSSGSGGSSSSSSSSSSSSSSSSSSSSSSSSSSS 285

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS++  SSSSS  S S S S S+S +S++SSSSSS ++   SS S 
Sbjct: 196 SSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSSG 255

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S   S
Sbjct: 256 SGGSSSSSSSSSSSSSSSSSSSSSSSSSSSSNKRS 290

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S + + S S+S ++++SSS+SS  + S SS S 
Sbjct: 81  SSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSS 140

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S+S S
Sbjct: 141 SSSSSSSSSSSSSSSSSNSSSCSSSSSSSSSSSSS 175

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+S  S S S S S+S ++++S SSSS ++ S SS S 
Sbjct: 87  SSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSS 146

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+ +S S
Sbjct: 147 SSSSSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSS 181

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 93  SSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSS 152

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++  S+SSS  S SS S  S +S+S+S S
Sbjct: 153 SSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSS 187

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS+S  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 189 SSSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 248

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS +  S+SSS  S SS S SS +S+S+S S
Sbjct: 249 CSSSSSGSGGSSSSSSSSSSSSSSSSSSSSSSSSS 283

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 47/93 (50%), Positives = 60/93 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 195 SSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSCSSSSS 254

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
               SS++ SS+SSS  S SS S SS +S+S++
Sbjct: 255 GSGGSSSSSSSSSSSSSSSSSSSSSSSSSSSSN 287

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/97 (48%), Positives = 63/97 (64%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS S SSS  S   SSS+  +SSSS  S S S S S+S +S++SSSSS  ++ S SS 
Sbjct: 56  RSSSSSSSSSSRSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSS 115

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  +SS++ +S+S S  S SS S SS +S+S+S S
Sbjct: 116 SSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSS 152

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS  S S S S S+S ++++SSSSSS ++ S +S S 
Sbjct: 72  SSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSR 131

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+ +S S
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSNSSSCSSSS 166

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS    S + + S+S +S+ SSSSS+ ++ S SS S 
Sbjct: 79  SSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSS 138

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S +S S SS +S+S+S S
Sbjct: 139 SSSSSSSSSSSSSSSSSSSNSSSCSSSSSSSSSSS 173

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS   S S S S S+S  S++SS+SSS ++ S SS S 
Sbjct: 82  SSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSS 141

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S S  S SS +S+S+S S
Sbjct: 142 SSSSSSSSSSSSSSSSNSSSCSSSSSSSSSSSSSS 176

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 47/97 (48%), Positives = 62/97 (63%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R  S S SSS  S   S+S+  SS+SS  S S S S S+S +S++SSSSSS  + S S+ 
Sbjct: 54  RRRSSSSSSSSSSRSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNS 113

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  SS+++ SS SSS  S SS S SS +S+S+S S
Sbjct: 114 SSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSS 150

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SS+SSS +  S  S S 
Sbjct: 76  SSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSS 135

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS + SS +S+S+S S
Sbjct: 136 SSSSSSSSSSSSSSSSSSSSSSNSSSCSSSSSSSS 170

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 48/95 (50%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS   S   SSS+  SS+SS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 99  SSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSN 158

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S   SS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 159 SSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSS 193

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S S +S++SSSS+S ++ + SS S 
Sbjct: 74  SSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSS 133

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S +S + +S+S S
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSNSSSCSSSSSS 168

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S S SSS  S   SSS+  SSSSS  S S S S S+S +S+++SSSSS ++ SRSS S 
Sbjct: 78  NSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSS-SRSSSSS 136

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S  +S+S+S S
Sbjct: 137 SSSSSSSSSSSSSSSSSSSSSNSSSCSSSSSSSSS 171

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS++  SSSSS  + S S + S+  +S++SSSSSS ++ S SS S 
Sbjct: 94  SSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSS 153

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 154 SSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSS 188

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  SSSS+  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 97  SSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSS 156

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS ++ SS+SSS  S S  S SS +S+S+S S
Sbjct: 157 SNSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSS 191

 Score = 61.2 bits (147), Expect = 7e-08
 Identities = 46/95 (48%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS   SS+  S   SSS+  SSSS+  S S S S S+S +S++SSSSSS ++ S +S S 
Sbjct: 103 SSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSC 162

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS   S SS S SS +S+S+S S
Sbjct: 163 SSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSS 197

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSSSS  S S S S S+S +S +SS+S+S ++ S S+ S 
Sbjct: 65  SSRSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSS 124

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 125 SSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSNS 159

 Score = 60.8 bits (146), Expect = 9e-08
 Identities = 47/95 (49%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S   S S S+S +S++SSSSSS ++ S S+ S 
Sbjct: 102 SSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSNSSS 161

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
              SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 162 CSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSS 196

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 47/95 (49%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SSS+  SSSSS  S S S S S+S +S++SSSS S +  + SS S 
Sbjct: 59  SSSSSSSSRSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSS 118

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+ SS  S SS S SS +S+S+S S
Sbjct: 119 SSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSS 153

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   S+S+  SSSSS  S S S S S+S +S++ SSS+S ++ S SS + 
Sbjct: 63  SSSSRSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNS 122

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 123 SSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSS 157

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 46/95 (48%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS   SSS+S    S S S S+S +S++SSSSSS ++ S SS   
Sbjct: 104 SSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSSNSSSCS 163

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S S  S SS S SS +S+S+S S
Sbjct: 164 SSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSS 198

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 49/95 (51%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS   S   SSS+  SSSSS  S S S S S+S +S++SSS SS  + S SS S 
Sbjct: 60  SSSSSSSRSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSS 119

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS SSS  S SS S SS +S+S+S S
Sbjct: 120 SNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSS 154

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SS+S+  S S S + S+S  S++ SSSSS ++ S SS S 
Sbjct: 88  SSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSS 147

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SS   S SS S SS +S S+S S
Sbjct: 148 SSSSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSS 182

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 46/95 (48%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   S+S+S  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 89  SSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSS 148

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+S S  S SS S SS + +S+S S
Sbjct: 149 SSSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSS 183

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 48/95 (50%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S S+  S+SSS  S S S S S S + ++SSSSSS ++ S SS S 
Sbjct: 91  SSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSS 150

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS SSS  S SS S SS +S+S+S S
Sbjct: 151 SSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSSS 185

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 45/95 (47%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  S S   S +++ +S++SSS+SS ++ S S  S 
Sbjct: 75  SSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSS 134

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 135 SSSSSSSSSSSSSSSSSSSSSSSNSSSCSSSSSSS 169

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 46/95 (48%), Positives = 58/95 (61%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S S  +   SSS   SSSSS  S S S S S+S +S++SS SSS +  S SS S 
Sbjct: 61  SSSSSSRSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSSSSSSSS 120

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS + S +SSS  S SS S SS +S+S+S S
Sbjct: 121 NSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSS 155

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 45/95 (47%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SS +  +S+SS  S S + S S++ +S +SSSSSS ++ S SS S 
Sbjct: 90  SSSSSSSSSSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSS 149

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+ SS  S SS S SS  S+S+S S
Sbjct: 150 SSSSSSSSNSSSCSSSSSSSSSSSSSSGSSSSSSS 184

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 44/97 (45%), Positives = 63/97 (64%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS S SSS      +SS+  S+SSS  S S S S S+S +S++SSSSSS ++ + +S 
Sbjct: 55  RRSSSSSSSSSSRSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSRSSSNSNSS 114

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  S+S++ S++SS   S SS S SS +S+S+S S
Sbjct: 115 SSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSS 151

 Score = 58.2 bits (139), Expect = 6e-07
 Identities = 44/95 (46%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  SSS+S  S + S   S+S +S++SSSSSS ++ S SS S 
Sbjct: 98  SSSSSSSSRSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSSSSSSSSSSSSSSSS 157

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  S S++ SS+SSS  S  S S SS +S+S+S S
Sbjct: 158 NSSSCSSSSSSSSSSSSSSGSSSSSSSSSSSSSSS 192

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 43/97 (44%), Positives = 61/97 (62%)
 Frame = +3

Query: 333 RPSSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           R SS S      S   SSS+  +S+SS  S + S S S+S +S++SSSSSS ++ S SS 
Sbjct: 47  RSSSNSRRRRSSSSSSSSSSRSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSR 106

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  +SS++ SS++SS  S SS   SS +S+S+S S
Sbjct: 107 SSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSSSSSS 143

 Score = 54.3 bits (129), Expect = 9e-06
 Identities = 43/94 (45%), Positives = 60/94 (63%)
 Frame = +3

Query: 342 SPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYS 521
           S S S+S      SSS+  SS S+  S S S + S+S +S++SSSSSS ++ S SS S S
Sbjct: 46  SRSSSNSRRRRSSSSSSSSSSRSNSNSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 105

Query: 522 PPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
             SS++  SS+SSS  S SS + SS +S+S+S S
Sbjct: 106 RSSSNSNSSSSSSSSNSSSSSNSSSRSSSSSSSS 139

[109][TOP]
>UniRef100_UPI0000DA21F8 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA21F8
          Length = 176

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/100 (51%), Positives = 63/100 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   SS+T  S+SSS  S S S S S+S +S+ SSSSSS +  S SS S 
Sbjct: 73  SSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSSSSSSSNSSSSSSSS 132

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS*FSPP 638
           S  SSS + SS+SSS  S SS S SS +S+S+S S   PP
Sbjct: 133 SSSSSSNSSSSSSSSSNSSSSSSSSSSSSSSSSSSSRLPP 172

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 48/95 (50%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS +  S SS S 
Sbjct: 64  SSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSSSSSSS 123

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +  SSS++ SS+SSS  S SS S S+ +S+S+S S
Sbjct: 124 NSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSS 158

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S S+S  S   SSS+  SSS+S  S S S S S+S +S++S+SSSS ++ + SS S 
Sbjct: 71  SSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSSSSSSSNSSSSSS 130

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 131 SSSSSSSSNSSSSSSSSSNSSSSSSSSSSSSSSSS 165

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 47/95 (49%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSS+  S + S S S+S +S++SSSSSS  + S SS S 
Sbjct: 65  SSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSSSSSSSN 124

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  S SS S +S +S+S+S S
Sbjct: 125 SSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSSS 159

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 48/95 (50%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ + SSS  S   SSS+  SSSSS  S S + S S S +S++SSSSSS ++ S SS S 
Sbjct: 58  SNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSS 117

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S S S
Sbjct: 118 SSSSSSNSSSSSSSSSSSSSSNSSSSSSSSSNSSS 152

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/95 (49%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S SSS  S   SSST  SSS++  S S S S S+S +S++SSSSSS ++ S SS + 
Sbjct: 66  SNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSSSSSSSNS 125

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+S+S  S SS S SS +S+S+S S
Sbjct: 126 SSSSSSSSSSSSSNSSSSSSSSSNSSSSSSSSSSS 160

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           ++ S SS+  S   SSST  SSS+S  S + S S S+S +S++SSSSSS ++ S +S S 
Sbjct: 60  NTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSSS 119

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  S+S++ SS+SSS  S +S S SS +SNS+S S
Sbjct: 120 SSSSNSSSSSSSSSSSSSSNSSSSSSSSSNSSSSS 154

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 46/95 (48%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   S+S+  S++SS  S S S S S+S +S++SSSS+S ++ S S+ S 
Sbjct: 68  SSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSSSSSSSNSSS 127

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S SS S SS +S+S+S S
Sbjct: 128 SSSSSSSSSSSNSSSSSSSSSNSSSSSSSSSSSSS 162

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   SSS+  +SSS+  S S S S S+S +S++SS+SSS ++ S SS S 
Sbjct: 70  SSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSSSSSSSNSSSSS 129

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ +S+SSS  S +S S SS +S+S+S S
Sbjct: 130 SSSSSSSSSNSSSSSSSSSNSSSSSSSSSSSSSSS 164

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 44/95 (46%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  ++SSS  S S S S S+S +S++SSS+SS ++ S +S S 
Sbjct: 69  SSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSSSSSSSNSSSS 128

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S S+ S SS +S+S+S S
Sbjct: 129 SSSSSSSSSSNSSSSSSSSSNSSSSSSSSSSSSSS 163

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S +SS  S   S+S+  S+SSS  + S S S S+S +S++SSSSSS ++ + SS S 
Sbjct: 62  SSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSSSSS 121

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS  S+S+S S
Sbjct: 122 SSNSSSSSSSSSSSSSSNSSSSSSSSSNSSSSSSS 156

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 45/95 (47%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  +   S+++  +SSSS  S S S S S S +S+TSSSSS+ ++ + SS S 
Sbjct: 41  SSSSNSSSCTTTGSSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSS 100

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SS+  S SS S SS +S+S+S S
Sbjct: 101 SSSSSSSSSSSSSSNSSSSSSSSNSSSSSSSSSSS 135

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 47/97 (48%), Positives = 62/97 (63%), Gaps = 2/97 (2%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSS--SSIRSMSMSVSISASLTSATSSSSSSPATPSRSS* 512
           SS S SS+  S   SS T   SS  S+  S S S S S+S +S+TSSSSS+ ++ S +S 
Sbjct: 33  SSSSSSSNSSSSNSSSCTTTGSSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSS 92

Query: 513 SYSPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S S  SSS++ SS+SSS  S S+ S SS +SNS+S S
Sbjct: 93  SNSSSSSSSSSSSSSSSSSSSSNSSSSSSSSNSSSSS 129

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 44/92 (47%), Positives = 62/92 (67%)
 Frame = +3

Query: 348 SLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPP 527
           S ++S  +   SS++  SSSSS  S S S S S+S TS+++SSSSS ++ S SS S S  
Sbjct: 54  SSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSS-SSSSS 112

Query: 528 SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           SS+++ SS+SS+  S SS S SS +SNS+S S
Sbjct: 113 SSNSSSSSSSSNSSSSSSSSSSSSSSNSSSSS 144

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 43/95 (45%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SS+  S   + S+  S+++S  S + S S S+S TS++SS+SSS +T S S+ S 
Sbjct: 38  SSNSSSSNSSSCTTTGSSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSS 97

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S+S S
Sbjct: 98  SSSSSSSSSSSSSSSSSNSSSSSSSSNSSSSSSSS 132

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 46/95 (48%), Positives = 59/95 (62%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S  +  SS  S   SSS+  SSSSS  S + S S ++S +S TSSS+SS ++ S SS S 
Sbjct: 48  SCTTTGSSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSS 107

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS+  SS+SSS  S SS S SS +S+S S S
Sbjct: 108 SSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSNSSS 142

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 45/95 (47%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           +S + SSS  +   SSS+  +SSSS  S S S + S++ +S++SSSSSS ++ S SS S 
Sbjct: 57  NSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSS-SN 115

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 116 SSSSSSSSNSSSSSSSSSSSSSSNSSSSSSSSSNS 150

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 42/95 (44%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           ++ S SSS  S   SSS+  SSSS+  S S + S ++S +S++SSSSSS ++ S S+ S 
Sbjct: 59  NNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSSNSSS 118

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SS+++ SS+SSS  S S+ S SS +S+++S S
Sbjct: 119 SSSSSNSSSSSSSSSSSSSSNSSSSSSSSSNSSSS 153

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 42/93 (45%), Positives = 62/93 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S ++S  S   SSS+  SS+SS  S S S S ++S  S++SSSSSS ++ S SS S 
Sbjct: 55  SNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSS 114

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           +  SSS++ +S+SSS  S SS S +S +S+S+S
Sbjct: 115 NSSSSSSSSNSSSSSSSSSSSSSSNSSSSSSSS 147

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS   + SS+  + + S S ++S +S++SS+SSS +T S SS + 
Sbjct: 32  SSSSSSSSNSSSSNSSSCTTTGSSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTS 91

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S++ S
Sbjct: 92  SSNSSSSSSSSSSSSSSSSSSSSNSSSSSSSSNSS 126

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 42/95 (44%), Positives = 60/95 (63%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S S+S       SS   +++SS  S S S S S+S +S++S+SSSS  T S +S S 
Sbjct: 39  SNSSSSNSSSCTTTGSSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSS 98

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S S+ +S+S+S S
Sbjct: 99  SSSSSSSSSSSSSSSSNSSSSSSSSNSSSSSSSSS 133

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 42/95 (44%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   +SS+  ++ SS  S + S S S S +S++SSS+SS ++ S SS + 
Sbjct: 31  SSSSSSSSSNSSSSNSSSCTTTGSSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTT 90

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  +SS++ SS+SSS  S SS S +S +S+S+S S
Sbjct: 91  SSSNSSSSSSSSSSSSSSSSSSSSNSSSSSSSSNS 125

 Score = 56.6 bits (135), Expect = 2e-06
 Identities = 42/92 (45%), Positives = 60/92 (65%)
 Frame = +3

Query: 348 SLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPP 527
           S +S+  S   S+S+  SSSSS  S S + S S++ +S+ SSSSSS ++ S SS S S  
Sbjct: 55  SNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSSS 114

Query: 528 SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           +SS++ SS++SS  S SS S SS  S+S+S S
Sbjct: 115 NSSSSSSSSNSSSSSSSSSSSSSSNSSSSSSS 146

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 42/95 (44%), Positives = 62/95 (65%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + + S  +   +SS+  +SSSS  S S S S S S +S+T+SSS+S ++ S SS S 
Sbjct: 47  SSCTTTGSSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSS 106

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  + SS S SS +S+S++ S
Sbjct: 107 SSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSSNSS 141

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = +3

Query: 348 SLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SYSPP 527
           S SSS  S   +SS+  SSS +    S + + ++S +S +SSSSSS +T S SS S S  
Sbjct: 29  SSSSSSSSSSSNSSSSNSSSCTTTGSSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSS 88

Query: 528 SSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           ++S++ SS+SSS  S SS S SS +SNS+S S
Sbjct: 89  TTSSSNSSSSSSSSSSSSSSSSSSSSNSSSSS 120

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 42/95 (44%), Positives = 61/95 (64%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           S+ S  ++  S   S++T  SSS+S  S S S + S+S TS++SS++SS  + S SS S 
Sbjct: 44  SNSSSCTTTGSSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSS 103

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS SSS  S S+ S SS +S+S+S S
Sbjct: 104 SSSSSSSSSSSNSSSSSSSSNSSSSSSSSSSSSSS 138

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 41/95 (43%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS + +++  S   SSS+  SSS+S  S + S S + S ++++SSSSSS ++ S SS S 
Sbjct: 54  SSNNSNNTSSSSSNSSSSSSSSSTSSSSSTSSSSSTTSSSNSSSSSSSSSSSSSSSSSSS 113

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ S++SSS  S SS S S+ +S+S+S S
Sbjct: 114 SNSSSSSSSSNSSSSSSSSSSSSSSNSSSSSSSSS 148

[110][TOP]
>UniRef100_UPI0000D9F76B PREDICTED: hypothetical protein, partial n=1 Tax=Macaca mulatta
           RepID=UPI0000D9F76B
          Length = 213

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 114 SSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 173

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 174 SSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 117 SSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSG 176

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 177 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 211

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/93 (53%), Positives = 62/93 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 48  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSS 107

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTS 617
           S  SSS++ SS+SSS  S SS S SS +S+S+S
Sbjct: 108 SGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 140

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 55  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSGSSSSS 114

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS  S+S+S S
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSS 149

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 81  SSSSSSSSGSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 140

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 141 SGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 175

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 90  SSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSS 149

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSS 184

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S +SSSSSS ++ S SS S 
Sbjct: 101 SSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSS 160

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 161 SSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSS 195

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 110 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSS 169

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS + SS+SSS  S SS S SS +S+S+S S
Sbjct: 170 SSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSS S  S S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSS 178

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 179 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S++SSSSSS  + S SS S 
Sbjct: 59  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSGSSSSSSSSS 118

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSS 153

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS  S S S S S+S +S+ SSSSSS ++ S SS S 
Sbjct: 100 SSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSS 159

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 160 SSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSS 194

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)
 Frame = +3

Query: 339 SSPSLSSSPPSPVPSSSTLLSSSSSIRSMSMSVSISASLTSATSSSSSSPATPSRSS*SY 518
           SS S SSS  S   SSS+  SSSSS    S S S S+S +S++SSSSSS ++ S SS S 
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 174

Query: 519 SPPSSSTALSSTSSSIFSISSLSLSSPASNSTSLS 623
           S  SSS++ SS+SSS  S SS S SS +S+S+S S
Sbjct: 175 SGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 209

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 50/95 (52%), Positives = 63/95 (66%)